(data stored in ACNUC16935 zone)

EMBL: FR796432

ID   FR796432; SV 1; linear; genomic DNA; STD; INV; 2682151 BP.
XX
AC   FR796432; CT005272;
XX
PR   Project:PRJNA10724;
XX
DT   03-FEB-2011 (Rel. 107, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Leishmania major strain Friedlin complete genome, chromosome 36
XX
KW   complete genome.
XX
OS   Leishmania major strain Friedlin
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Leishmaniinae;
OC   Leishmania.
XX
RN   [1]
RP   1-2682151
RA   Aslett M.;
RT   ;
RL   Submitted (21-JAN-2011) to the INSDC.
RL   Aslett M., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, Cambridgeshire, CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [3]
RX   DOI; 10.1126/science.1112680.
RX   PUBMED; 16020728.
RA   Ivens A.C., Peacock C.S., Worthey E.A., Murphy L., Aggarwal G.,
RA   Berriman M., Sisk E., Rajandream M.A., Adlem E., Aert R., Anupama A.,
RA   Apostolou Z., Attipoe P., Bason N., Bauser C., Beck A., Beverley S.M.,
RA   Bianchettin G., Borzym K., Bothe G., Bruschi C.V., Collins M., Cadag E.,
RA   Ciarloni L., Clayton C., Coulson R.M., Cronin A., Cruz A.K., Davies R.M.,
RA   De Gaudenzi J., Dobson D.E., Duesterhoeft A., Fazelina G., Fosker N.,
RA   Frasch A.C., Fraser A., Fuchs M., Gabel C., Goble A., Goffeau A.,
RA   Harris D., Hertz-Fowler C., Hilbert H., Horn D., Huang Y., Klages S.,
RA   Knights A., Kube M., Larke N., Litvin L., Lord A., Louie T., Marra M.,
RA   Masuy D., Matthews K., Michaeli S., Mottram J.C., Muller-Auer S.,
RA   Munden H., Nelson S., Norbertczak H., Oliver K., O'neil S., Pentony M.,
RA   Pohl T.M., Price C., Purnelle B., Quail M.A., Rabbinowitsch E.,
RA   Reinhardt R., Rieger M., Rinta J., Robben J., Robertson L., Ruiz J.C.,
RA   Rutter S., Saunders D., Schafer M., Schein J., Schwartz D.C., Seeger K.,
RA   Seyler A., Sharp S., Shin H., Sivam D., Squares R., Squares S., Tosato V.,
RA   Vogt C., Volckaert G., Wambutt R., Warren T., Wedler H., Woodward J.,
RA   Zhou S., Zimmermann W., Smith D.F., Blackwell J.M., Stuart K.D.,
RA   Barrell B., Myler P.J.;
RT   "The genome of the kinetoplastid parasite, Leishmania major";
RL   Science, e1252229 309(5733):436-442(2005).
XX
RN   [4]
RX   PUBMED; 22038252.
RA   Rogers M.B., Hilley J.D., Dickens N.J., Wilkes J., Bates P.A.,
RA   Depledge D.P., Harris D., Her Y., Herzyk P., Imamura H., Otto T.D.,
RA   Sanders M., Seeger K., Dujardin J.C., Berriman M., Smith D.F.,
RA   Hertz-Fowler C., Mottram J.C.;
RT   "Chromosome and gene copy number variation allow major structural change
RT   between species and strains of Leishmania";
RL   Genome Res. 21(12):2129-2142(2011).
XX
DR   MD5; 67a20fe57db326e258af2cc203ba0f48.
DR   BioSample; SAMEA3138173.
DR   EnsemblGenomes-Gn; LmjF.36.0325.
DR   EnsemblGenomes-Gn; LmjF.36.1395.
DR   EnsemblGenomes-Gn; LmjF.36.2350.
DR   EnsemblGenomes-Gn; LmjF.36.5595.
DR   EnsemblGenomes-Gn; LmjF.36.6785.
DR   EnsemblGenomes-Gn; LmjF.36.TRNACYS.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAGLN.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAGLY.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAGLY.02.
DR   EnsemblGenomes-Gn; LmjF.36.TRNALEU.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAMET.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAPRO.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNAPRO.02.
DR   EnsemblGenomes-Gn; LmjF.36.TRNATHR.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNATHR.02.
DR   EnsemblGenomes-Gn; LmjF.36.TRNATHR.03.
DR   EnsemblGenomes-Gn; LmjF.36.TRNATYR.01.
DR   EnsemblGenomes-Gn; LmjF.36.TRNATYR.02.
DR   EnsemblGenomes-Gn; LmjF.36.ncRNA1.
DR   EnsemblGenomes-Gn; LmjF.36.snRNA.01.
DR   EnsemblGenomes-Gn; LmjF.36.snRNA.02.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0001.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0058.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0059.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0060.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0061.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0062.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0063.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0064.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0065.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0066.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0067.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0068.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0069.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0070.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0071.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0072.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0073.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0074.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0075.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0076.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0077.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0078.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0079.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0080.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0081.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0082.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0083.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0084.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0085.
DR   EnsemblGenomes-Gn; LmjF.36.snoRNA0086.
DR   EnsemblGenomes-Tr; LmjF.36.0325:mRNA.
DR   EnsemblGenomes-Tr; LmjF.36.1395:pseudogenic_transcript.
DR   EnsemblGenomes-Tr; LmjF.36.2350:mRNA.
DR   EnsemblGenomes-Tr; LmjF.36.5595:pseudogenic_transcript.
DR   EnsemblGenomes-Tr; LmjF.36.6785:pseudogenic_transcript.
DR   EnsemblGenomes-Tr; LmjF.36.TRNACYS.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAGLN.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAGLY.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAGLY.02:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNALEU.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAMET.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAPRO.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNAPRO.02:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNATHR.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNATHR.02:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNATHR.03:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNATYR.01:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.TRNATYR.02:tRNA.
DR   EnsemblGenomes-Tr; LmjF.36.ncRNA1:ncRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snRNA.01:snRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snRNA.02:snRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0001:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0058:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0059:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0060:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0061:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0062:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0063:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0064:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0065:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0066:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0067:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0068:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0069:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0070:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0071:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0072:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0073:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0074:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0075:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0076:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0077:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0078:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0079:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0080:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0081:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0082:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0083:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0084:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0085:snoRNA.
DR   EnsemblGenomes-Tr; LmjF.36.snoRNA0086:snoRNA.
DR   EuropePMC; PMC3227102; 22038252.
DR   GeneDB; LmjF.36.0325.
DR   GeneDB; LmjF.36.1395.
DR   GeneDB; LmjF.36.2350.
DR   GeneDB; LmjF.36.5595.
DR   GeneDB; LmjF.36.6785.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01522; TB10Cs1H1.
DR   RFAM; RF01523; TB10Cs1H2.
DR   RFAM; RF01524; TB10Cs1H3.
DR   RFAM; RF01531; TB10Cs3H1.
DR   RFAM; RF01535; TB10Cs5H2.
DR   RFAM; RF01536; TB10Cs5H3.
DR   RFAM; RF01538; TB11Cs3H1.
DR   RFAM; RF01549; TB8Cs2H1.
XX
CC   Data release policy www.sanger.ac.uk/legal/#t_2
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2682151
FT                   /organism="Leishmania major strain Friedlin"
FT                   /strain="Friedlin"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:347515"
FT   CDS_pept        complement(4809..7349)
FT                   /transl_table=1
FT                   /gene="SCG4"
FT                   /locus_tag="LMJF_36_0010"
FT                   /old_locus_tag="LmjF36_0010"
FT                   /product="phosphoglycan beta 1,3 galactosyltransferase 4"
FT                   /db_xref="GOA:Q7YXV1"
FT                   /db_xref="GeneDB:LmjF.36.0010"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YXV1"
FT                   /protein_id="CAJ08951.1"
FT                   /translation="MQPSVCLCHFAGHLHTLGTPSATPALRGKYTIMREENNVPAEWAP
FT                   RDTHRLDPLQLLPPSQRHCGQSSAAESGEGCHSRSRGKPEVHSTRASSGGKRSTGTLPR
FT                   SDDCLNAVARTPLFNSCGHPRRSAAQCLRLCTRQRRLAALAVLLALIVMVHWVISQFTT
FT                   NVGLQQKSSIELLNEANREYESSSPFSVLVQHERAVERLTTAQRGLAASGAGSLARLDR
FT                   DQLPSWTLRVIDEDCTMCFDNVTYASAVAADAGRSTNKTGHHKQKGLSVFATTSAPLGL
FT                   MGPMLFAMASVTDDVDVAAELPRWQWVTWSYAQQRRFVHASQSRSTGERPRHLIVLGIP
FT                   STDQPMRYPLRDAQRATWLTYREVARTENNFTGALLQLYVFAAAEHDSEDSTHSAVDMV
FT                   QLAPTVSEYAAATEQHLAVEAGDVNNAPPYLQRRVVLRDGWRDIPRSDDAVWRSPCAGV
FT                   RTTVVTAASLVAGTSSLAALSAQLSLPVTPAFTAAAQYVCHVSAALWQEALHHRNSLWL
FT                   DFLTDRKPTTKKKMGMSISWGIPTEVGMSQKTVLWLNYAYTAFPDVPYIMKGDDDMYLK
FT                   VPQYLSDLRHVRGGWQKPRNLTVTIPHRGVIPPTLAIDDAEECLYRVWWTYSKKIAYGN
FT                   GVGYILDRRLIQAALNPFDGFNALLMKLLTNPYDYRLEKEYLSLNMQYEDMHIGKQIRD
FT                   HHDAVERFCPKKRVCYMADRRFRAHQILRPKPVKLTWISVMAHFGMPAIPYYVHYFHKN
FT                   EFKVAEEAKRLIAQGIDAKTIEENATQRMHEWVASQVPSTLVGLGASFHLDWVRGDPHT
FT                   AYTVAEEDEVAVYDVRYKLRRRNDVACVLESGKR"
FT   CDS_pept        complement(9129..9431)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0020"
FT                   /old_locus_tag="LmjF36_0020"
FT                   /product="histone H4"
FT                   /db_xref="GOA:Q4Q277"
FT                   /db_xref="GeneDB:LmjF.36.0020"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q277"
FT                   /protein_id="CAJ08952.1"
FT                   /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKRI
FT                   SSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
FT   CDS_pept        complement(11415..11873)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0030"
FT                   /old_locus_tag="LmjF36_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0030:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q276"
FT                   /protein_id="CAJ08953.1"
FT                   /translation="MGCTASKTKTPAANVASKGADEFYALATTERHPVAEKLLEEWVLF
FT                   VDAQARRNAGDSSAARAYETRLKEVWADTTNRPVTHRSVDYVGKMFLEYIKEDLSHRGW
FT                   GGNFDYKVAGVVTQGFLKANANIDTALSDTPEEVTWEIKIHYDSLGVS"
FT   CDS_pept        complement(14019..15317)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0040"
FT                   /old_locus_tag="LmjF36_0040"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0040:mRNA"
FT                   /db_xref="GOA:Q4Q275"
FT                   /db_xref="GeneDB:LmjF.36.0040"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q275"
FT                   /protein_id="CAJ08954.1"
FT                   /translation="MGNATIIKGNIVTTSKVLYGGCVIVVNDLIVSVCGNETVARKYLV
FT                   ELESTHPGVGAATWYEAAFVLPGFVDIHNHGLGGASDVIGHWSNPEYSLKELARCGTLT
FT                   TLASVIFSDSHKKLVTECIDAIEKRVGTYTEDNCILGGIHAEGPVIHDRGGLPECKSEM
FT                   SLGDFKRLVDSMPSLRVMTISPHIDARCNYEKVRYLLEKKVRVALGHDRAASKSEIMGA
FT                   LKLAASEEEKMHVTHLCNVSTFNHRASSLVNAAMCPRFPNAPLYKGARPPTLEIIADLI
FT                   HVDSVTLQSVLASRSVDDIAIITDCISAHIPGKHVVYNGRDSVVQAGGACYLCDSFGRA
FT                   SSTLAGGTSMLADLFHILITLFCKDVVEACLHTATVPARIANLPDVGAITEGKKANLLL
FT                   FDAELHTIEKRMIHGHWTSHKPYAILHPSVVHL"
FT   CDS_pept        complement(17464..19125)
FT                   /transl_table=1
FT                   /gene="PUF1"
FT                   /locus_tag="LMJF_36_0050"
FT                   /old_locus_tag="LmjF36_0050"
FT                   /product="putative PUF1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0050"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0050:mRNA"
FT                   /db_xref="GOA:Q4Q274"
FT                   /db_xref="GeneDB:LmjF.36.0050"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q274"
FT                   /protein_id="CAJ08955.1"
FT                   /translation="MSSEEKLTALYARRQEILKDLSEVDTSIKFLESEIQTKATEAAKR
FT                   TIDENKSGNADLDRVNEVIASCVRDATGLRDALKLVEACRYVQEFGKEDDAARQKIPFR
FT                   NVFAQECIRHALDLSNDANGSELMQHLVPLLRSGTRPVTMGDIFYDPTTNEHDLSEVLL
FT                   LIRELSSDIVTVACNTNGARVSQRIIDVLCTHEEFDVYTSVLEPSIVDVAKDINGNHSL
FT                   SKLITSARFCQLGDSDKSASGAAAIYERIFQKIADNCIDICKNRQGCCIIQKCLQHAPQ
FT                   PYHTTIINTVLNNSLKLVQDPFGNYVVQFILDKQQDINGAKKEDADDDAMSTAPNYTNQ
FT                   IIRQMLHHVAELSCNKFSSNVIEKCLKTSSPDVRQLLVDELTAPHVLPKLLTDSFANYV
FT                   IQTAISTASDDGQLTQLRDAIIPLQSLLKNSPYGVKIESKLSRRHREAARRLLKKKEAA
FT                   TTVTQAPPAQQEPLLPPYMPPQGMSAIPMMAPDASMGQQVSFTNLNTDMASFLQPQRMI
FT                   GMPFVLQGQQMISIPNAPPPSFTTGMINGSGLPEYR"
FT   CDS_pept        complement(20911..22602)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0060"
FT                   /old_locus_tag="LmjF36_0060"
FT                   /product="putative L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0060:mRNA"
FT                   /db_xref="GOA:Q4Q273"
FT                   /db_xref="GeneDB:LmjF.36.0060"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q273"
FT                   /protein_id="CAJ08956.1"
FT                   /translation="MIPKQMAEPLVIGLDYGSDCARAVLVRVRDGAELQSAVFSYPRWA
FT                   KGEYCDPKRMQYRQHPCDYMEAAEDVITTVLKAAGPAARDNVVGLAFDTTGSTPCMVDE
FT                   TCTPLALRPSFANNPNAMFILWKDHTSVKEAAAINALAHRSTPDYTSFCGGTYSSEWFW
FT                   SKALHVIRSDEKVSQAAYGIVECSEWLPALFTGVTSYQKLIRSRCACGHKAMWHESWGG
FT                   FPPRSFFAQLHPRLGLLRSRMSDVTETIDKPVGTLSEEWARRLGLSTRVVVAGGAIDAH
FT                   LGALGAGIKPYTLVRVMGTSTCDMMVIDSSILGHRRVKGICGQVDGSIVPHMIGLEAGQ
FT                   SAYGDVFAWFSELLQYSSARIVAGTTLLDENAKAELTCEIKRKMLITLAEDASRIRPGE
FT                   SSVHALDWFNGRRTPDANQNLQSVIGGLTLGSDAASVYRALVEATAYGSRAIVERFRRE
FT                   GVRIDNVIAVGGIAKKSSLVVQVLSDVLDMPITVCKSEQVCALGSAIAAATAAACYKSI
FT                   PEAQKKMASGSSAAYKPCPEAARVYDELYKRYIKLAANTEQMYSHM"
FT   CDS_pept        complement(23448..24416)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0065"
FT                   /old_locus_tag="LmjF36_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0065"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0065:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0065"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q272"
FT                   /protein_id="CAJ08957.1"
FT                   /translation="MDPVKRRLVYVADENEALLSELSGTPPTRQSRHTRLLVPLSPPTS
FT                   SQPSPHLVSPPPRPVDATAEAAPVATADKALLVSYDGFLLTDGSGRFSTPRDAAQAANI
FT                   RDALKTCRSFLNGFLNVARPESESAESCSSGASSSTYMEEEDSDLEDTSSDDSPAPRPR
FT                   AAKAARASRPHSHTHSPSQMTVTKLKELLRNRGLSIAGNKACLVKRAQKLRAHESERAS
FT                   ETAPLPLGASRRALQGSLRHETKLNSGVSVSSPPLSPRPSQRRSPNCHTSDDKNNSIWG
FT                   ALVHAGSRLFRGGARASWGFHTRPAEDADDAPLSTRRRISA"
FT   CDS_pept        complement(25377..26144)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0070"
FT                   /old_locus_tag="LmjF36_0070"
FT                   /product="stress-inducible protein STI1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0070"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0070:mRNA"
FT                   /db_xref="GOA:Q4Q271"
FT                   /db_xref="GeneDB:LmjF.36.0070"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q271"
FT                   /protein_id="CAJ08958.1"
FT                   /translation="MEDYKAKGNDAFKAKRYQEAIDWYTKAIELDPNGEASGALYSNRA
FT                   GSWQNLNNFEKAAADSEQCIRLRPDWLKGYFRLGVAMESMVKYDEAQKAFQKALQLSPG
FT                   NEEVMDKLHAINTKVRERNEKTKSQQCKTPEEAKQLGNSFFKDGKYDQAAEFYTRAIEL
FT                   QTEPVKEKAVYYTNRAACHQQTHMYSLMVDDCNAAIEIDPANVKAYLRRGIAYEGMEKW
FT                   KLALEDYTKAQSISPGVAGASQGILRCQRVLRS"
FT   CDS_pept        complement(28924..29814)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0080"
FT                   /old_locus_tag="LmjF36_0080"
FT                   /product="putative leucine carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0080:mRNA"
FT                   /db_xref="GOA:Q4Q270"
FT                   /db_xref="GeneDB:LmjF.36.0080"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016651"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040212"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q270"
FT                   /protein_id="CAJ08959.1"
FT                   /translation="MALIQTAHDACSRKVHCVRKGYLNDPFVSFFEKDHTIVNSPLMNR
FT                   GTWLRTTAFENCVRGFATAAGQPIQVINFGAGMDTLYFRLKHSDPQFPVQKFMELDLAD
FT                   LVAEKERIIKRHSEMHSLVGSQYVLVSCDLYDAKGVAKALKEHLHGGTPTIMIAEMVFV
FT                   YIEGSVTTNLLRTVMSDVIEPGTKTMLVTYDAIQPFDRFGKVMVENLQHFGADFKGIGD
FT                   FPTPEAHAGRCSELGFKAVKSVTMKNLYLGVPRQIQIRLNKLEMIDDWEEWNLMHEHYC
FT                   FVVASTEDAPLPKLF"
FT   CDS_pept        complement(30598..33765)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0090"
FT                   /old_locus_tag="LmjF36_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0090:mRNA"
FT                   /db_xref="GOA:Q4Q269"
FT                   /db_xref="GeneDB:LmjF.36.0090"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q269"
FT                   /protein_id="CAJ08960.1"
FT                   /translation="MVHVAMSSHIEQAATCLRCGNHNGAAAALRELEVGEGVRTLQTAM
FT                   QCLMNENGESDDVYVRFVAFKVLAYALTRCRHGRRQQSDTVITFLLGYAYQMAAEVETP
FT                   AWTPVVSELATATAVALKLGCVGDNLDACVEEVTAVCSGLVDLAQTCTPSPKAYLHRII
FT                   CQSAVEEFGLFSGPSRYRGLPMRVHRRCRKLFAEEGRLPTLIQALLRGLLLSAGESSMS
FT                   VDKGLTVLVSCLAWPSHQFFEEDSSTEESCGVFYVAHEEWDRLLVGDVGLESGACVTVH
FT                   GVLREWYESGAVNGVPANRQKVIEIIQLLCSFKGSEWTEGQTLRFLVSSLSLCLDVFAH
FT                   LSRWATKDDFHLFPLLANAILRLVSNYVEFFFHPQAHTLVSRLTALTDFLIRRDTSSNT
FT                   DTDVMSCVDEMLSVWFHLTSYIERSSFSGNGFETIAQRHLISQGCQSIFSTYLDTKVNT
FT                   DAAELELDCFADTFTNSHLHLVAQVGRLCASDTCELLIRYLRSLRSTLASTLGAGGTAP
FT                   TPLFEALWTLLKIVGLFIADPLEGEQSYIPRCFLEMGSQGSALLLHVVKELDALLPLLQ
FT                   NPAAASPAVLAAFLDVFTQYITTYVEAEESCTLYADAFSGGADMVAQSLLAVVGALRLT
FT                   PFEEESTSAACRLLDCLADKSSRVRSFCHRQDAFQALTRAVQDIHQFRFYGHTRGRLIA
FT                   FVISCCSDADSVQAQLHEFALSPSSEDDVNLVLELLSSLAGLFESLHSQQVIRCVFPAL
FT                   LTTGQRLIGVSASKFYEREIVIESVQCVRSMFVTCSPLLEDSDTRMLLDLVVAELRYAV
FT                   TALQSSSAWTSADGEGDKAEFIIATARLLSSLAQWKALDCFLSDDDTRAVSIATVEAAG
FT                   ALLRHMDERSLSLPSLEDGIFTCMELCAESFTADFVFASCSDAFLSAMLYALNSERANI
FT                   QRAGISVTASVAAFLEAATPPASHASACCDLLRVVLRSLTSGKVFNNLRQISRVLLLLV
FT                   RGVPYDSVVATVEAAVREVANCDAFVAAIFPALQSAAGSANATESGFEELLQDALSSLH
FT                   GTTIMGA"
FT   CDS_pept        complement(34482..36341)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0100"
FT                   /old_locus_tag="LmjF36_0100"
FT                   /product="putative DNA damage repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0100:mRNA"
FT                   /db_xref="GOA:Q4Q268"
FT                   /db_xref="GeneDB:LmjF.36.0100"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q268"
FT                   /protein_id="CAJ08961.1"
FT                   /translation="MTAMSRSVRDQVNSLQHFQQHSRLYFIGQWRTKMEDVFREWFVAH
FT                   PEWNHGTLEQQRTFVHIDMDAFFCSVQLAKPEYAHLKTKPVGIAAGKYNSDISSCNYVA
FT                   RSYGIHAGMYVNSAKERCPELVTLGYDLEACERVAKTLYQIIFDLFPTGVKMSMEVYSI
FT                   DEVMLAADTTDYALLQPFCETVRRELFSATGCTASCGIGPNIMLARVATDRGKPNGICV
FT                   VHAKDVAQTMTSLPLKYIHGAGASTMEKICRALREQGILDERTDAGGVTCGSVQKLKRE
FT                   ALQRILGKRQGETFYHLVRGEDGRVVTRTGDPEDQRHLGKRIPNAVGCSMNYAVRPEGV
FT                   DDVWKIVRQLLEDVCTKLRRTDAVAQGLRVTLLERHPLHPKETQKYMGRGKCVEVHLPI
FT                   KLPHAMAADEVEAMELEIRKAVAPLLVASRAISDAERAAQLGLSPNEMDLVIWTVAIAS
FT                   LRDIVVEDLRGMTVQATGLRQKQQAPFTRQRLSGQQMTLATGFFNAKRPRTQDVVTVVE
FT                   PTPAQPPSDTVRGPPADSCLDAATLYLLYAQPWPHRDDATAAQWRCGCESACRQLDYPA
FT                   VKAYLRCALAKLSEWPEPQEAAGTFQQLLSFANTRLPAPLDFL"
FT   CDS_pept        complement(37511..40327)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0110"
FT                   /old_locus_tag="LmjF36_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0110:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0110"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q267"
FT                   /protein_id="CAJ08962.1"
FT                   /translation="MPSRLMLPLPSLPLFSSSLYARHMCICVRVRVHGSGGEEELLSAT
FT                   TETHTPSLHYTRLAVSRVALPLLTLSVSLFFASAGRSCKGEDCPMSAYQVARPTDGALR
FT                   TALKAVLTTSPPPTLVPHPPSKNVAWRPRRIVEELKALRCVEALSSFEAELRGLVGLQE
FT                   IRCRTKLVNHAYRDECALREVEHLLAAEAAQRRDVTEKFFDIVRAPFEVLHLHLREELT
FT                   RRSLRCEERSIWRALQLRASGSRLGLAEADNRATLGALEECSREELKNRRLIELGDNLQ
FT                   REIVVQRRLAGHLRCVDHSKGAQRARQRLEWQEEMGRATLERLYSLHLILLLQDVKVDF
FT                   SEAVKRDVVLLSEASRATTQQVRVADCEERVLACLEQERRLRLTLEEQEHTGSKAVTQA
FT                   FLLGWRGVYRQITKDSDVTSVFGKIELLVRRDIADQRRSELSSLLLACQAQTRVLKRHQ
FT                   AERRALCQQYIDGARFISGEENREANQLFCDHHVWQCQQAALHRATVLAVEEVASSRAI
FT                   RGAEAQARLACKLEYLAEKLQLQCEEGRQRVAEEEERCLGALRERYVHIFFIQGAVRLF
FT                   DSERAERMLIEVEESAAAVDTLLPLRQALTHSLVSDAYRPLSGLEDEFRARVTVEETRE
FT                   RCGLVRQHVLLSEAAHRIGLFELEHNFWIRPITAQVSAMEADARRRLCSSAEAEMLLVR
FT                   RCVLEDWEWEKRKSIHKCEMLVRESLALTNRLPALPSLSRLTDATDMWGALEADWGDAA
FT                   SDVATWSANWLLHDPPSLTCYSTLRCEDVLVEAYLERDLIHFMEHREWLQVLQHKTTTN
FT                   SSAESSAVDQTYWKLHSLSMRLEPQQRAAFINVWHSNQSFDVSFPLTQQPDEAIVGERT
FT                   ISFYAPDAGTTAALMQRDTDAGMVFFLILDDEGTVLACATMVVEVAPKCSAHLCIPLDS
FT                   NRGFVRLV"
FT   CDS_pept        complement(40903..41874)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0120"
FT                   /old_locus_tag="LmjF36_0120"
FT                   /product="putative mRNA capping methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0120:mRNA"
FT                   /db_xref="GOA:Q4Q266"
FT                   /db_xref="GeneDB:LmjF.36.0120"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039753"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q266"
FT                   /protein_id="CAJ08963.1"
FT                   /translation="MSQNQAAAAYDDVTRKRKDDWSSQQVAFRHFNNFVKKALIQFSLD
FT                   CVLANRAASPSEGAAVLDLASGRGGDIGKWFFMQSPPQSNLRAPSAALHTSVYDCYDVS
FT                   RECINEAERRCKEMIAAMKRPPQCGASFTVADCFTESFLRGTLPCSPHFGRYSVVSIQF
FT                   AFHYACKSLDLIRDVFSAVSDALAPGGVVLITTVDIAMLSKRAAEGTLGNELYSIFFPH
FT                   PPEYAAASNGNALLVTGTEYHFRLDGFVDCTEYVVPHDAVVRIASEARLRLCERMSKPF
FT                   SEFVPEYSANWKANKGNKLSQAELELVTLYRALCFVKEKVSL"
FT   CDS_pept        complement(42761..43864)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0130"
FT                   /old_locus_tag="LmjF36_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0130:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0130"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q265"
FT                   /protein_id="CAJ08964.1"
FT                   /translation="MSSEGKETEPPQAGEPSAAVKLPSENSSSSEDTDSDTYTISQVLF
FT                   DSLTGRGFSENAIKKSIVAGCIDEGTCTQWIQMHEGHPELDTALEDGVEVIIKAKRVLT
FT                   EAEREAKVRELQERVRRNKEEEKLELQRKERERVEVGRKMLRMKSEMEELRRKMNAEEA
FT                   RRENAAELEARRRIKIQIAADRLERRGHTRDEALALAEKEYEEAAAKARAEAAAKLETL
FT                   QRTQAPVQTATSSSDGAWNLSAITAPSSAQSTLVSLFAGEAPTCAQPLVDNIHKRAPAE
FT                   QTGECVRTLRLILGNIVSDPFDTKKRTLRISTKAFRDSILPVDEAVRLLRWCGFALSTD
FT                   AANNQTLCLSTVVVRRLHQVLGLLGSE"
FT   CDS_pept        complement(44682..46634)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0140"
FT                   /old_locus_tag="LmjF36_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0140:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0140"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q264"
FT                   /protein_id="CAJ08965.1"
FT                   /translation="MLKQLKETVVSAISSSPLNAYELDTSGTTLCGRSDLFEKCDAVVR
FT                   ANGKKVSIFTLCIKRVLQRCTASEALALIKVVKESVALLTHMRHPGILSIEGPLVEDKK
FT                   KIWFVAERVSMVLAPETVQGLPLQVKLLGLCHCAEAIRFLHEKAELLLFNFALSSIYVT
FT                   EDNQWKVGDLCFAVPRAQLSAPSPPPFPFHSVAAPLLDYLPTEYVEFCTEKAADAVNRD
FT                   LFSVGAAPLVYPDSDTYGFLVVTVEVLQGKRLFNCGGNPQEQQRQLSAAEGHISRYFPA
FT                   GALRLPRPPISTVVITGPFATPDMKTLTGLFFFGILDSDTRFRLLKALYDGLTKGDFCE
FT                   AVILSDIVPLMVQESKADAMLRFVLPILLLCANTLSAGSFDRALREYFVSLLTAIIRAP
FT                   SLQPAAVYAEQVLQKREGIHKHFASVKDTATLIVPLILKLMSSEGNERLLKGSLEWFRD
FT                   VLTQTPTIKLGLPKDIAARLLNVASSNADFFALAFQCLEKILTFSATETNMEVEVNLTR
FT                   NIANTSISFTSVQLDYMLGLLRGIQEKMTPEHRAVKSIPLLCPLLLHANGTVRQFAVAS
FT                   IVRYAQLLGSSSAPATVPPPPPPPPSSGGSFSPSAANSGAPAAPDGSWTQPALFPSATP
FT                   PPARASDDVFASLFP"
FT   CDS_pept        complement(48882..50339)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0150"
FT                   /old_locus_tag="LmjF36_0150"
FT                   /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
FT                   os phatase-likeprotein"
FT                   /EC_number="2.7.1.105"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0150:mRNA"
FT                   /db_xref="GOA:Q4Q263"
FT                   /db_xref="GeneDB:LmjF.36.0150"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q263"
FT                   /protein_id="CAJ08966.1"
FT                   /translation="MVLVHLRASNVYDVGGMNEANTIDFKHMVGVEYHTQREVVRSPPS
FT                   LTDTKVNHVAMVSMGLYRFSNATSPVVIFVSSEERCSMPARFFCTRFVHYFRWIGESVQ
FT                   LFVASKSFQDHRPTPYATQRDTWLQENRRCVSAALDYFDSNPKLGFVATPVAVIFTDCD
FT                   CADARAALVSLLPPERSFLIRHVRFAEEWESHKHNSYRFIDVSLQRQALRASRSSGSVV
FT                   CSSLTSFLNSMLPTLYQLYSAEPLEGAPGETLKSFPPIFFTRHGQSEYNVEDRLGGDPD
FT                   LTETGRIDAEDIAHFFERQVKTNVNLFDHRTTVWEEDGDFEVWCSQLRRTQRTAQPTAD
FT                   ILSHGVLKPFKSLNEIHAGICEDMTNEEVKSLYPFIQRFRHTDKVGFRYPDGESYVDLV
FT                   RRLTPLLNDLNNCTKCVVVVAHQAVLRTMLSFFGGRPVEEAVHVPCPQRTIWACTMNRL
FT                   GEPQLAEIALSPRQSQDKRPDVHWQGW"
FT   CDS_pept        complement(50883..51740)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0160"
FT                   /old_locus_tag="LmjF36_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0160:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0160"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q262"
FT                   /protein_id="CAJ08967.1"
FT                   /translation="MQQLQVSACVLLLALLCVTTVRSSGNLQLGTWDVSTLVPGRGAVP
FT                   PNYELTVQPGKWTVKERDTGRVGRLFDYAAARIGLVYAGVPSDEHALCRMPPSLILKLA
FT                   AVRTDDGVRLECQTVWFSPSMLRSFENDGLLHRRFDPAEPLYSADSGRCLATPWRVREL
FT                   YVAKLGDGLLLLTGVLVGGASGTQESCSVHLEVRYRPIASGKESSSSSSLFSIAMLLMV
FT                   VAVRLLPRYILTRKGQLDKTSYRGRNPTSLTPTQRLHLLRQQKEVIEKMKAEDSANAAK
FT                   RTAV"
FT   CDS_pept        complement(53654..54310)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0170"
FT                   /old_locus_tag="LmjF36_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0170:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q261"
FT                   /protein_id="CAJ08968.1"
FT                   /translation="MSCSSPALARVSFFCSWSLFIAPSPGAEIAARLAGRGGVEIFLRA
FT                   ALSAFAYPNRAEAHERVEMDGTSHFTRIKDTPETLNPITGRSIYYGMRPWRCDDRFQDW
FT                   LKSFTCFDSVSVQYNLLKLFVQCARSEEGQEPIDNYHRLGRAEVMYYVERYRSGMMRTG
FT                   VLETYPYDQNELRRIAEEDGLKMRVWRHQRELEMEAKEGKIDEVMHMNVMRRGKP"
FT   CDS_pept        complement(54717..57254)
FT                   /transl_table=1
FT                   /gene="EF2-1"
FT                   /locus_tag="LMJF_36_0180"
FT                   /old_locus_tag="LmjF36_0180"
FT                   /product="elongation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0180"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0180:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0190:mRNA"
FT                   /db_xref="GOA:Q4Q259"
FT                   /db_xref="GeneDB:LmjF.36.0180"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q259"
FT                   /protein_id="CAJ08969.1"
FT                   /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAGI
FT                   IKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLIDSP
FT                   GHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDRAIL
FT                   ELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAFSLTR
FT                   FANMYAAKFGVDELKMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCLDPIYQ
FT                   IFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQMIVAHL
FT                   PSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRGRFFAFGR
FT                   IFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMPCGNVVGLV
FT                   GVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLAKSD
FT                   PLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSFRETVTDVSSQ
FT                   QCLSKSANKHNRLFCRGAPLTEELALAMEEGTAGPEADPKVRARFLADNYEWDVQEARK
FT                   IWCYGPDNRGPNVVVDVTKGVQNMAEMKDSFVAAWQWATREGVLCDENMRGVRVNVEDV
FT                   TMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVEHAMGGIYGVLTRR
FT                   RGVIIGEENRPGTPIYNVRAYLPVAESFGFTADLRAGTGGQAFPQCVFDHWQEYPGDPL
FT                   EPKSLANTTTLGIRTRKGLKPDIPGLDQFMDKL"
FT   CDS_pept        complement(58232..60769)
FT                   /transl_table=1
FT                   /gene="EF2-2"
FT                   /locus_tag="LMJF_36_0190"
FT                   /old_locus_tag="LmjF36_0190"
FT                   /product="elongation factor 2"
FT                   /db_xref="GOA:Q4Q259"
FT                   /db_xref="GeneDB:LmjF.36.0190"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q259"
FT                   /protein_id="CAJ08970.1"
FT                   /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAGI
FT                   IKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLIDSP
FT                   GHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDRAIL
FT                   ELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAFSLTR
FT                   FANMYAAKFGVDELKMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCLDPIYQ
FT                   IFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQMIVAHL
FT                   PSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRGRFFAFGR
FT                   IFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMPCGNVVGLV
FT                   GVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLAKSD
FT                   PLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSFRETVTDVSSQ
FT                   QCLSKSANKHNRLFCRGAPLTEELALAMEEGTAGPEADPKVRARFLADNYEWDVQEARK
FT                   IWCYGPDNRGPNVVVDVTKGVQNMAEMKDSFVAAWQWATREGVLCDENMRGVRVNVEDV
FT                   TMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVEHAMGGIYGVLTRR
FT                   RGVIIGEENRPGTPIYNVRAYLPVAESFGFTADLRAGTGGQAFPQCVFDHWQEYPGDPL
FT                   EPKSLANTTTLGIRTRKGLKPDIPGLDQFMDKL"
FT   CDS_pept        complement(61341..62018)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0200"
FT                   /old_locus_tag="LmjF36_0200"
FT                   /product="putative serine peptidase clan SF, family S26B"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0200:mRNA"
FT                   /db_xref="GOA:Q4Q258"
FT                   /db_xref="GeneDB:LmjF.36.0200"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR026730"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q258"
FT                   /protein_id="CAJ08971.1"
FT                   /translation="MPWRQWWSAIRCSQYGDVPFVLLGVFIGWNSDVSCAVKGVSMVPT
FT                   LHPGEYIVFVPYTMLQVRRWFNAPLVNLSDVVVVKVSDDLSVCKRVVKCTSSRTQAEEW
FT                   GKEHYVEVMPALYSPPAAQHTNGDDEDSTEIDSVANSERAYFDYVARNTVRSKDWDSCI
FT                   DRIPNPSQWVWLEGDNKSESFDSRRCGPVPIECIRGLVLASIWPSPHTLQRPPPPPRAS
FT                   QLH"
FT   CDS_pept        complement(64829..66250)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0210"
FT                   /old_locus_tag="LmjF36_0210"
FT                   /product="putative SET domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0210"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0210:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0210"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q257"
FT                   /protein_id="CAJ08972.1"
FT                   /translation="MSISQRVAVVHDAATTPEQLAAFQRECPNSCDFFPVKDAAQLQCV
FT                   VQHIHAASPSVYGAVANLYTDRSGDANGGVTSALATLFFQHASLSYTGCRAATLSYPFD
FT                   VLLMMLFYAGVPLPPFALVDSVEAARRAAHRLKAPVQIRNTCGLLGLCRNCCTVQDAME
FT                   ETLISAFHEHGKIVAWEVNASKAHAVRVLVAGGSVKGAAAAIPVESCAAAPLWAADAEE
FT                   AAQRFGAAVSRYVLYDCGVASLTLNTLKENPGKWCFEDLVLNPALPHLVLQEAAPNLLS
FT                   GAPTAAELVASLLEEARKLHPTPTFELKLHEDTRKGYHLCATKALRKGDVVFEDECRSF
FT                   AVVTRPHVERHWDGPLKKTFTEYAWPLDSEGHVYAIWEEDPQRWRPINHSCDPNCIFAA
FT                   PHSLNVIAARDIAAGEDLSMDYATFCDGTMKPFECLCGAACCRGVISADACSLAKYGGH
FT                   SWLRRVPSAVKPLLP"
FT   CDS_pept        complement(67853..68641)
FT                   /transl_table=1
FT                   /gene="DPMS"
FT                   /locus_tag="LMJF_36_0220"
FT                   /old_locus_tag="LmjF36_0220"
FT                   /product="dolicholphosphate-mannose synthase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0220:mRNA"
FT                   /db_xref="GOA:Q4Q256"
FT                   /db_xref="GeneDB:LmjF.36.0220"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q256"
FT                   /protein_id="CAJ08973.1"
FT                   /translation="MQYSIIVPAYKECGNLEPLIRRVFAAVTEQGFPTQNVEMLIVDDN
FT                   SRDGSKEVVDRLHEEGFNVHMDVRTTERGLSSAVIHGLRHTSGAYKLVMDADLQHPPEC
FT                   VPALFKALGRDGVEFVCGTRYGVGIEVDKNWPAHRRLISWGARLLARPLTTLSDPMSGF
FT                   FAIRDGVFKRHAGEVNSIGYKIALELFVKCRVQCFEEVGFNFATRTYGESKLTGKVILH
FT                   YLEHLYALYLFKLGRLFYVFVVVAVLFAIYLLAFLYHSLF"
FT   CDS_pept        complement(70055..70384)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0230"
FT                   /old_locus_tag="LmjF36_0230"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0230:mRNA"
FT                   /db_xref="GOA:Q4Q255"
FT                   /db_xref="GeneDB:LmjF.36.0230"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q255"
FT                   /protein_id="CAJ08974.1"
FT                   /translation="MGVIRTVMKAGSGATPKPGQTITVHCTGYLADGKKKFWSTHDDKN
FT                   PFTFNVGVGQVIRGWDEGMMQMQLGETAELLMTADYAYGDRGFPAWNIPSNAALLFEIE
FT                   LLKIQ"
FT   CDS_pept        complement(71351..72025)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0240"
FT                   /old_locus_tag="LmjF36_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0240:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0240"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q254"
FT                   /protein_id="CAJ08975.1"
FT                   /translation="MLFDGDDDNLPEVPTIRSNTLMPLTTSDAQAQRLQQLEAEYRASR
FT                   AETAAFRPRAAHRCSSSRPVSPPEPVKAASHVWEERDEAAFYELHSLVPHLSPQFACSY
FT                   SDAVLLIAAIQSGGAASGNRHTLADKCQSLEADRRQLEQRLEKFRVQCEELKREVAEVK
FT                   QKLRVVQEESRNSVNALAQRREEMRKQLLLEETRAEKLMVRNKKLEQENDSLKGRVREQ
FT                   FR"
FT   CDS_pept        complement(73427..75328)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0250"
FT                   /old_locus_tag="LmjF36_0250"
FT                   /product="EIF3-interacting protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0250"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0250:mRNA"
FT                   /db_xref="GOA:Q4Q253"
FT                   /db_xref="GeneDB:LmjF.36.0250"
FT                   /db_xref="InterPro:IPR019382"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q253"
FT                   /protein_id="CAJ08976.1"
FT                   /translation="MGLYQHHRCPPPQLLPPQKHGCAVIHSYPPYTPSFPVYQVCLCVH
FT                   LLLVIVSDCAIFIFLLASESSLSRPLSSPKTRTTQRTLTHVFAKMATNPDIETDIPRDV
FT                   YQFFRGLNRAVERRDAAAMHDLYESQFDALTKNYYMAGHGQFRSWPALRLEQVSSCFRG
FT                   NHMAELVYSFLFYKHLFMDNRSVRAPDAEGAWKTYSELLPMLKSYELPNWMLWDIFDEF
FT                   LYQMTVVYQKVFVTEGIWAVPEVSRLLNEVIDNSRLLELVKQPDFLEDIHRGPNTGALS
FT                   GFYAIVTKSKLNVLLGDYYSALTDLEPLDVYNKGRAVLTRVSPCAVSVFYHIGFSYLMI
FT                   HRFEDASNAFRRCVTVKLNGRRFSERVQQDAAYMYVCARVLGGMPINNLTSYLDSRKVA
FT                   AFEDDRESLRTGDEERFRDVFDRCSPKFLTVPPSDGSPVKGSEGRELQARMFRRAVQQQ
FT                   QDIIKLRGYFKVYQNTKMNLLETLLEVDDGYAPLFALKMRSRQLVHDGVTADLLQGVFT
FT                   SSSEFDCIVQDDNVEVVPSMTFGGIEQKLLNKIKNTQRDIEVAKRKFNQTRNRDEGGNK
FT                   RKDQRDQKRRPNQQQLHGGVGNNAGSANRSSNNVNRHPRQKMAAQPMTSNLFNRNDN"
FT   CDS_pept        complement(78299..79762)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0260"
FT                   /old_locus_tag="LmjF36_0260"
FT                   /product="putative xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0260:mRNA"
FT                   /db_xref="GOA:Q4Q252"
FT                   /db_xref="GeneDB:LmjF.36.0260"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q252"
FT                   /protein_id="CAJ08977.1"
FT                   /translation="MYAGIDIGTSGIKIALMRSDGQIADSASAPLTVSSPHPLWNEQDP
FT                   DSWWMAINSAMNVLKKRQDMSSVRAIGLSGQMHGATLLDKNHKVLRPCILWCDGRCYRE
FT                   CEELEKAVPKSREITGNLMMPGFTAGKLLWVKKHEPEIFAKVNKVLLPKDYVRFLMTGD
FT                   FASEMSDSSGSMWMDTGKRDWNDDILRATGLSRANMPKLYEGSEITGKLSADVAKRWNM
FT                   NCVPVVGGGGDNEAGAVGAGLFKPGQAMLSLGTSGVYFVVSDGFHYNTKEAVHSFCHAL
FT                   PERWHLMSVILSCAVCLEWAAKLTRCRSVDEFVGEAMTAKNFDERPLYFLPHLAGERTP
FT                   HNNPNAKGVFFGLTSHHSRPELARAVLEGVSFAMSQGMDAVHRCGVEPSNIALIGGGSR
FT                   SRFWRQMLADVSGYPMDYCIGSEVGPALGACRLAQIAVEKRPLEELLPCLPLKETHMPD
FT                   MKKHEQYKKRRVIYDELYKQLKPIMNAKL"
FT   CDS_pept        complement(80648..83101)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0270"
FT                   /old_locus_tag="LmjF36_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0270"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0270:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0270"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q251"
FT                   /protein_id="CAJ08978.1"
FT                   /translation="MVHARQCDTMADIYAVAQNLIEELRTNLAELRRSPDVQARLQRTA
FT                   ARKIGAERARCHSHYPGFQSTAEKPRLCFLPLTTAPTTHVAFSHDFCRSEEAAIEPDGN
FT                   GALTTVTATPCTRSCSRSTVTKATPSSGTSLLSGNTTGVALTTRPQILASQSVKAVKGQ
FT                   NSPAREPAGHVKHVAAAGEPRAGDGTTAANAASSEAHTDSATTAWCMPFSGVSRPLVDL
FT                   RRLTPLARQLYTDMQRRAAAMPAASPSAEWRRRTAGPQDAEVRRAVRDYLYRMNIISVM
FT                   EAEDTSVTAPHVFRDAVLNGTALCQLVATLREGGEPSLSDPVLCRCPRTLNEVRVNYAV
FT                   ALGALRSTPSTAQELMPRAAWTMTPEEVYLRASPTALLSLFVHLISTYLPAPEELPVWK
FT                   QHMCWQPPADAADYAPVPPTELAAMEAGCCRFLHTWGVLPDGSVYQLPGDECLLPIATA
FT                   APYMAKWSRFVVRSVAPSSISVPSVWPFLCNGVLLVLLARRSGVEAAAKEAASSPALQP
FT                   FFANPRTAACCVANITSALHSFQTASTKKLPLSLISEESVAAVIRGDRVHILHLLLHVR
FT                   AAVEGTPQPPGVRSALLSKDAVAEAGCTPAKVSGRAPDGEGVAASSTSSWPSASLAQTP
FT                   STVAKAALRRSAPPSPAHRSLSPRRVPAIASSSSGILRREAVPADEPQGRRGLCRWLRQ
FT                   QLGTEYRYTAADESFVFDAATFSWRHPCLLFSDGVVLAYLIRRLERRRCSFLDCVHPTS
FT                   KKSAKLFNVRRCLEFLRFNAGVVFDVLLLDEALTEGRVEGVVSVLQGMRRHYCLTNVRR
FT                   SHHDA"
FT   CDS_pept        complement(84141..84899)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0280"
FT                   /old_locus_tag="LmjF36_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0280:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0280"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q250"
FT                   /protein_id="CAJ08979.1"
FT                   /translation="MALPFSGFVGTASLSLSLFRRCCLLLSQQLQERAHAHTHTHTQSL
FT                   TFCHRTMASSATSSSSPDDKIVNLLAIALQKMDDFKGKSADARRYASQVVAAVRANNNT
FT                   EEEFRDQIICIVANVKNLSGELGAGSQERKAGISAAELATMDANAMRSQLQKRTMAATF
FT                   RKRAREQTNVDKTSLHCTKCGLVRRDRLNINELALDSEESGSHFDYNFDNSCACSHSSD
FT                   DERSSSGDEEDDETAMSKGSCATASDKHSD"
FT   CDS_pept        complement(85213..86163)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0290"
FT                   /old_locus_tag="LmjF36_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0290:mRNA"
FT                   /db_xref="GOA:Q4Q249"
FT                   /db_xref="GeneDB:LmjF.36.0290"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q249"
FT                   /protein_id="CAJ08980.1"
FT                   /translation="MRRREAESAARFYMAGMLVVLLGLLLSCGYSFGLFHSPDEVEQLN
FT                   AAIRAVEGRRVALLLDSVVSNGTRFDGKGHMHPLYALTCVQEEETEEARRMIRNVARRF
FT                   RTEPIDIGYAHHPLTAAYRHRRYAVAQALIEEWRRPVPDASDEEAVMDEVYASSLTVSE
FT                   LQRVDPSVHVYCRDVDAVRCRALDPERIRDASNSHLEAAYRRRFGQTQELPAVTPYRDT
FT                   DMPSKIVAPASTLRAAFWDDPFRPVVPDLLPPRTAMVMNPGYFDNVLDQLSYTLLGHME
FT                   GSSTAVAFGLFAMCTICLFLGTWCAGVSYWLLHCT"
FT   CDS_pept        complement(86913..87911)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0300"
FT                   /old_locus_tag="LmjF36_0300"
FT                   /product="conserved NUDIX hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0300:mRNA"
FT                   /db_xref="GOA:Q4Q248"
FT                   /db_xref="GeneDB:LmjF.36.0300"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q248"
FT                   /protein_id="CAJ08981.1"
FT                   /translation="MCCHTSPLRFSYPNTVLRSNRRRRHMIRTTAAAARLPQSTQGWVP
FT                   LMRRALEFPIDSVTFPSHFYLHTVTNGTASTVGFSPQKEPVGLTALRQCAVLVLLSPAA
FT                   TGNGFQDMCITLTKRTATMGSHKSEMSFPGGHVDDDETLRNAAQRETLEEVGLPPSEYE
FT                   IIGSLTPITTNALSARVTPFVAVATSPAQPYRASPVEVDSIHYLHMSMLLLSASTGHAR
FT                   VIKYRSFTSDRPCFFPCFFASPAQTVVSSAVCRSPKATGVADDCGFDPMLPEDFPGELV
FT                   WGLTSFVTCELVARVAKAIMDGPEANSAAAVNALLTPSNVVARDPLAGSLQ"
FT   CDS_pept        complement(88908..89600)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0310"
FT                   /old_locus_tag="LmjF36_0310"
FT                   /product="putative dolicholphosphate-mannose synthase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0310"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0310:mRNA"
FT                   /db_xref="GOA:Q4Q247"
FT                   /db_xref="GeneDB:LmjF.36.0310"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q247"
FT                   /protein_id="CAJ08982.1"
FT                   /translation="MSSEHWVFFGLPPFFTEQHSSATLDRQCTLWSNLLLDHAIYHAQR
FT                   TAGGDTNALLRFYTTQSDIFYNPAINKRLSPEGAHTMLQSLVARHPNHVVIVSDGGPRD
FT                   FSVLVCTTEDGFKGMEETLLRYILDHGEVQTTAMLSKKGTVMTFDELASGAALGYGQTR
FT                   SAYLARFSSAAVPVADVGRLSEEQAIRMYLHALNRRPVSAMRPFKVTLFNLDGTATQPY
FT                   QGVKFGGE"
FT   CDS_pept        complement(90862..91482)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0320"
FT                   /old_locus_tag="LmjF36_0320"
FT                   /product="putative proteasome beta 2 subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0320:mRNA"
FT                   /db_xref="GOA:Q4Q246"
FT                   /db_xref="GeneDB:LmjF.36.0320"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q246"
FT                   /protein_id="CAJ08983.1"
FT                   /translation="MAETAIAFRCQDYVMVAAAGLNAFYYIKITDAEDKITQLDTHQLV
FT                   ACTGENGPRVNFTEYVKRNLMLNRMRQHGRHSSCDSTANFMRNCLASAIRSREGAYQVS
FT                   CLFAGYDMPVSEDDNGAVGPQLFYLDYLGTLQAVPYGCHGYGACFVTALLDCLWRPDLT
FT                   QQEGLELMQKCCDEVKRRVVISNSHFFVKAVTKNGVEVITAVH"
FT   CDS_pept        complement(join(92031..92675,92677..93312))
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0325"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(94379..95803)
FT                   /transl_table=1
FT                   /gene="RNHii"
FT                   /locus_tag="LMJF_36_0330"
FT                   /old_locus_tag="LmjF36_0330"
FT                   /product="putative ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="GOA:Q8WSZ0"
FT                   /db_xref="GeneDB:LmjF.36.0330"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WSZ0"
FT                   /protein_id="CAJ08984.1"
FT                   /translation="MLHAWRFVPLARSTSALGSGLLRPSRVLRQKRLAYSPFRPPPTWN
FT                   ALQKVEVGHRQTDTGEPTLDGTLDLVGYQLSRDGLLPQTNILGRTLPVPDTSGISAATR
FT                   RKLERERDVAVAHMKRHGVRLRRSIKETAVTIGCDEAGRGPLAGPVVGAAVSRIPVSSF
FT                   NNEFDQLYEAPEQFQIFDSKSVSERQRDLVFAMITGHVDFFDIASCKKFVVHHCAGDEA
FT                   TSLTLSSKKLDSHVKLSKLPFKKLLSMQTPYLITYHGYNSAGNYVYFWSIGIANHTYID
FT                   EYNIYNASMNTMHRSAQSIWHMLSDARFSHEAAPRPRSSSIAQYLFSRFCTAANHDNEK
FT                   RYQVPHHLELLKGATEYFDFEPIQPPLVLIDGHAVPGPSYDYFTSVRIGGDVQPIIEGD
FT                   KRSLSIAAASCLAKVTRDELMNYIDALYPGYGFRDNKGYPVEQHMKYVAKNGLCPIHRK
FT                   TYRPCRTVLEKGLQRK"
FT   CDS_pept        complement(97083..97274)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0340"
FT                   /old_locus_tag="LmjF36_0340"
FT                   /product="putative nuclear protein family a (nop10p)"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0340:mRNA"
FT                   /db_xref="GOA:Q4Q244"
FT                   /db_xref="GeneDB:LmjF.36.0340"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q244"
FT                   /protein_id="CAJ08985.1"
FT                   /translation="MHLRVYMVDGKRVYTLKKVDPEGKPTLSAHPARFSPDDKLSRHRV
FT                   TIKRRFKVLPSERRLQPL"
FT   CDS_pept        complement(99323..100834)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0350"
FT                   /old_locus_tag="LmjF36_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0350"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0350:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0350"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q243"
FT                   /protein_id="CAJ08986.1"
FT                   /translation="MQKPRTVSATPLPQVAAVPRPRMSGAAAAAPHDRSYHVAVTASSR
FT                   QRRVSLNAPRHVPKYIFTEPASVPWSRSLRGAHDICATVSHSRQRKLSKTSEGSVLQAR
FT                   PRTFSAADSEKVLATRGVPFAADKLGTGKDEALLQLNDGFDGGLSTSTLTTCSPKGSRH
FT                   RPSQPGRMLKLQLDATAIEDELKLSANSKSANTVSSKTPRPDKFAAYHTLRLLFVPIWK
FT                   RYRFHKQMVWATAIVAKHVLLKVHWRRQRRSERATDTFLHVLRIPRTKLRCAAHLLEGQ
FT                   VVRIQRAFRRHRARVQAVVELNYRKVRRDVEEAYWEAVVTQHEAELAVQQRPFSPVPKA
FT                   VREVFGARAEARARFGSIQRRTSLLSSAGNSSYDTAVPSNELDVYNFHMIGRLPGSLLR
FT                   FEMTSAVFAQLRRSAARAHLMDDFSETRARRAGMGGFMEHGDIAPTNTAFVRSRGKCRA
FT                   QLPCFLPESVYAAILNNTCYLTSLMRDDRKLRAHLRQREHHLESY"
FT   CDS_pept        complement(102102..102881)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0360"
FT                   /old_locus_tag="LmjF36_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0360"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0360:mRNA"
FT                   /db_xref="GOA:Q4Q242"
FT                   /db_xref="GeneDB:LmjF.36.0360"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q242"
FT                   /protein_id="CAJ08987.1"
FT                   /translation="MTAEQNILLDPSIRDWVLLPLIVIVLFMGVLRHYVTILMNSPSKP
FT                   NMARICNVNIQNYGRILLSSGAALSPEPFKHRAERMLNGMLKKEVDPVNPMEMMNDPNV
FT                   MMGLLKNQFMMMVPNIGMMMLVSYFFSGFVVAKFPFPLSHRFREMMQRGLEIDVLNCNY
FT                   VTSLSLYFLIMSGNQGLLQLLLGEDVESENHSAMMMQQMPQASAQPVDFAKVFKQISDE
FT                   LAFAKDHHRWGYENAPDVLLKKWRSQKRAKGTAAKRR"
FT   CDS_pept        complement(103919..105286)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0370"
FT                   /old_locus_tag="LmjF36_0370"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0370"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0370:mRNA"
FT                   /db_xref="GOA:Q4Q241"
FT                   /db_xref="GeneDB:LmjF.36.0370"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q241"
FT                   /protein_id="CAJ08988.1"
FT                   /translation="MGQVGGTATSGRGLTALQVAAALRVTAAARLKQAEAAVSSSQAMH
FT                   SAHCSIAEQSKAIKPEDCSAVQRLTVPSTDHKGKHVEVRVTEYAPDVFSFLRQLKGVTD
FT                   PQFADEWSLPENRLKMEMGEGRSQALFLKSKTMLLMCKTISVEEVHALLHVLRAYTLHI
FT                   TAHPSSLLMRFYMLLKVSVRSEEGYILCFNDVFGTASVLHEKWDIKGRVPKNGKHLHYP
FT                   HLIGSGYEPDPHATKPPPKRHVLANPAIDASQQHPGRESAVVVRGTKDAQGLPTLHDKD
FT                   LTRLFWVPRTARKRLVEELLRDYDFLKNAGMMDYSLLIGVAYQDDKTRPSDKHCGIEST
FT                   NVTSSSAVAPASTSAEARPASLAQDSHPSGTRTMLTTVPEFANGVRSFDGQEMYYIGVI
FT                   DVLTTYTLKKKSANFFKSLLWKQKTLSTIPPDRYAQRIASFTELIFPDVKEEANGG"
FT   CDS_pept        complement(105857..106411)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0380"
FT                   /old_locus_tag="LmjF36_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0380"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0380:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0380"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q240"
FT                   /protein_id="CAJ08989.1"
FT                   /translation="MEVVAPSALPSRDLFFFCSALCTLHIAPIVAMADCDGDLSNVHPE
FT                   LLKLCADPEDWREQRRRAMKAKIFGTGAQAGASPAAETYLPTDRTFGPSPSSAQQPSAS
FT                   SYSGQQGSVSQQAAESYILQQILSHKRRREEANTEKASALASTPQPHPQPLLTQPQQNP
FT                   PASQAQELSLKEKLMRKYRKG"
FT   CDS_pept        complement(109983..111974)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0390"
FT                   /old_locus_tag="LmjF36_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0390"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0390:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q239"
FT                   /protein_id="CAJ08990.1"
FT                   /translation="MSSKRTEGTAADEERRRTSAASSGSSSVSSTDSDEASSSVSDSSS
FT                   SGSGSSSDSESSDSERPSSTPQRQSAAAAERATSTQQLQQQRHVQLNPELRFERPDKEY
FT                   IPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQA
FT                   QRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQ
FT                   SRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRSGAGYK
FT                   IEAVQVGSTPAAPAAVPAAVAPRPSLAAAAAPMQALETRAPFAGRLPGTGSAKVPVAPG
FT                   VGGPRPPVKVPMKHVGGGVAHGSVTTAAAPPLASTSVKQMPPEMKHLFWLSVLAHVKGG
FT                   EASRAFPDDRLEALPGLLRLCEMTEHTEEMCILMDVLAASSSGVQTVFERLGGLLSFRR
FT                   FASHFIQSEEAEPLMQLVEQLARWRVAAWGSTSQQAWQTDMNQRRTRDLMWLRTLPLIP
FT                   EAKRAAWGALLLVMEQRYIFKAPRPDDTTAVDNPLKRRRSEVELGDLHAVLSDNVDMQR
FT                   WVVPRVNVFSAVRLPVELRVPPLCTKLEENTVRFLNAKREYAEKMQVTWRERLEKILSA
FT                   QPRAPGPAVPVPLWYDPYALLRVASPQP"
FT   CDS_pept        complement(114379..115719)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0400"
FT                   /old_locus_tag="LmjF36_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0400"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0400:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0400"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q238"
FT                   /protein_id="CAJ08991.1"
FT                   /translation="MTTVLNRRFDVLCHSGTCPSYLIDVLSLLVAHANDTELFKTELRK
FT                   GDGGEFGAAATGAGSAHATSSTGPASRTDRAVGEARERQAADRRTQLMYKQVEDPEVLD
FT                   DALRASHETVLIAAERSLQTYTEDLKHINDIAMATSAKQLRAMRVETQQQMEAFRDRVC
FT                   GSVVAQTKEELEVMRSELAASVRADVSDMVRQLHQVSFSTQQQLQQLTSSYTDFVAQAH
FT                   DALTLAPLADAYEAVKTVEYMQEQLKCIEAAATTRSDVETLEERLKDLESIVTTLGSVA
FT                   KTPDVGAAAAAREGFSVNVPPPLSLSQQKPVLSNRSASHRSQTPKCTSPLPLHLHVSRS
FT                   ASAKGRPSSPPPASPGPPAQRTLAERLGVAVEAAEDGVVLAEVLPGSAAAAHRLGVGHI
FT                   ISHVGRTAVKTPAAFEEALRGIEGQAVKITAYDPFNGRVRVLTAQPL"
FT   CDS_pept        complement(117283..117879)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0410"
FT                   /old_locus_tag="LmjF36_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0410"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0410:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0410"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q237"
FT                   /protein_id="CAJ08992.1"
FT                   /translation="MYSDGERKTVSELQREAEATRKEIIEEAQRLERIKKATAKTQFSI
FT                   DQLFRFFAREVETEGEKKMLIDLLSSNPPDLHIECVPVLPVVIAIANGRMTNARRIYAT
FT                   DNAFLDDSAFIFLVHTLRFLPQACKIDFLDISGTRVTERGMCFVLEMMIERNTPFTLVA
FT                   KRLSIPSPEAEAMRARYASLMSALRDKKCCRFIQE"
FT   CDS_pept        complement(119037..120521)
FT                   /transl_table=1
FT                   /gene="AAT28"
FT                   /locus_tag="LMJF_36_0420"
FT                   /old_locus_tag="LmjF36_0420"
FT                   /product="amino acid permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0420"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0420:mRNA"
FT                   /db_xref="GOA:Q4Q236"
FT                   /db_xref="GeneDB:LmjF.36.0420"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q236"
FT                   /protein_id="CAJ08993.1"
FT                   /translation="MRAHQHTTACAGMVGGNDSNLSELSPMLLHGTWLRMSHSHAALDT
FT                   ESNCSIGRNLRRVNSVPVLTRRDRHLMTVSPMLFDRYYMAEGGGLISSAFNLASATCGA
FT                   GVLALPYAMQHCGTVTGTLTLIFVCNLTIYSVFLLAKVSALTRLMTYEELAIDLVGPIT
FT                   EKVTATIIVVFCWGVAVMYIVMMGDFIVPLFEALGLSHKVHRRTAMVLFWALVMFPLSM
FT                   ARKVQTLRYASIVGTVSTLLLAGALVDRFAQDRREHSNRTGLDPGRHTPPRAPLARWDS
FT                   EMSGALTTFVFSYCCQPVAPRIYEELKDRSVKRMCVCTVSSMTAATLVYILTGVFGAMS
FT                   FGDSVKPNVLVNFSNHLDSHTAQLAYFGIVVSLTMAFPMTIFPTRDSIVMGMGYHAEEN
FT                   PAPVWLSRTVAGLLALLALLIGSALPNIRVLFDVLGGVCGGSLSFVLPALFALRSGYWT
FT                   TAEVGWRHMALTWLTLVFGVVMCGLGTYNSVKSNFF"
FT   CDS_pept        complement(122627..123499)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0430"
FT                   /old_locus_tag="LmjF36_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0430"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0430:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q235"
FT                   /protein_id="CAJ08994.1"
FT                   /translation="MVVMLPALYARECVACSGAFRSCSRSGHRVPCLSCAAPAREFLLC
FT                   RVSTTVSVSPPSFTCTLFRFRHPSPRTCRTCFRVTVFSSALACSLFACVGCRLPSSPSR
FT                   YTLWRILMYRQSIAGLALAAALAEIQPALTPRQEEEIWRVFDAAMQAAVADAPLMSHIS
FT                   VQTPPPSSVGGGGYAAVTSTASELYVPADAEDGSGIDAEERAFGKPAAASQDGETPFED
FT                   SHIAFPVYRLVDDEWTLLLKDPTVVVRNELGVSEKIQLDYLRVRLKDIGAQSGATQPKQ
FT                   VRAVRERRA"
FT   CDS_pept        complement(125300..126748)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0440"
FT                   /old_locus_tag="LmjF36_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0440"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0440:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0440"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q234"
FT                   /protein_id="CAJ08995.1"
FT                   /translation="MRRRLACWPTAALAVARAITTNSFVSSIEQVQQQLQTAQDRRVEL
FT                   LRYGRQLYEVEMLDDLKTAYTPAVASKICYVASQLRIDATKGQPYTAVLEATMTAEGEQ
FT                   AMEVASLARIVHSCLVLRSGHLHEVLFTFIPFLREKAGTMDAVTTAVLINAYGRSGVHH
FT                   PGLYKALCDNGATVLKDPRVPLAHIANVAYAVSRVKFLHPALMLTLRDHALRKVAEASP
FT                   IISLTVLDAFTELRQIDDDLFNAYEQRLLGQLNELQAPLMASLVSCVVRAGRGKAEVME
FT                   SLGARTVAIADTFDAASIAKVTNAYYEADVASEDVLGALAERACKVAADFRADEIATVL
FT                   NALSAFDLFDAELFPLLASRLVALHRQGGYVDVADAAVILSSFAAVQERNDELIYVCTQ
FT                   LFAAYPGVAMDPAVRVNALWACASLNVHNEAQTKMLEEVRATPSLVMWESKTDTLPKAK
FT                   ATLEERTRFLAKVYGITISSSGAR"
FT   CDS_pept        complement(128968..131427)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0450"
FT                   /old_locus_tag="LmjF36_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0450"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0450:mRNA"
FT                   /db_xref="GOA:Q4Q233"
FT                   /db_xref="GeneDB:LmjF.36.0450"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q233"
FT                   /protein_id="CAJ08996.1"
FT                   /translation="MPCMCLTRYGTGASEATTLQRGRVSPVRVSLKDVIRHISHTRTHA
FT                   HTLRLHSRTEAGGKHEKGDNIASPPIPLHFIGVRITQAHSLTALFSLPLVSVFGSLPCT
FT                   CTVNSCISRTFPCDIPPPLPPPFSPLHPSLSLSLLSAVRTCVCLLRTDTRRTHPNTLTQ
FT                   DVHTQVHIYTHIYASIGKPFCTSKRLLVFALSLVCVCVCVCVCALVRERDGFSVSGFLF
FT                   SIYFLCAPRNGVHPSYRFRFLCFPASLLPPSPTPLPKEYTWFVLCLVLSLWSRDDDNES
FT                   AAAPSKAQAQLMIPGGAGSGLEPAHPRGGLAHPYMDSVPTSSVPGMFSSYTGRSTFSAG
FT                   IGEGGIAGGRGGARAASAESSPSEGEAFTKEDRMLLRLLYHQQQAIQVQLNTMTEWMQQ
FT                   VNYRIASLERLSRHTRPVTAVGATSSLTASAAPLPSRSTSAAEGYGTLAGQIQGAPLYS
FT                   SSPALSARDAPRPQTGSAPASVYSGQGLHQRATSSAPPLSSVQESSRACTPPSEQTRHQ
FT                   TGGAGGGSAVPSTTRSFESAMAQPWDPHNTSLQSASGAGVHSRTSSHTSALGRRANPLL
FT                   SSSTTMNKLPTSTSRPNWGDPKQLSRLDASVPSGTAQTSLSSGLTSLDTQQPPPSQQQQ
FT                   QSRQPPVVSPPTAAAVPYASSPLYTSADAVVPPYRRMPPEPTTRRPHSRAAAAVTASPS
FT                   TVSCAPPVFSGTVDASLAASGREGTLPPAKSSSMATSSNHGDARGRAATETTAVEGSRE
FT                   VRATYSAAAVSPENPRAATDPAGGAGRAARPHDGGTRLPSASNDDSLSDGYGSYESRMY
FT                   MKNLGLL"
FT   CDS_pept        complement(132378..134231)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0460"
FT                   /old_locus_tag="LmjF36_0460"
FT                   /product="putative vacuolar protein sorting-associated
FT                   protein 45"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0460"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0460:mRNA"
FT                   /db_xref="GOA:Q4Q232"
FT                   /db_xref="GeneDB:LmjF.36.0460"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q232"
FT                   /protein_id="CAJ08997.1"
FT                   /translation="MSSVSSSKVNRGRRNCLEQAWNYLNTAFSATAGLKVLLCDDATRE
FT                   ILSVAYSQHQLLQHNVVLVDMLANQERYPMKHFSCVIVCRPSAASLAAVYQELAEGNFA
FT                   SYDIYFTYMLDSTLVHSLANADVLNLVSRVGELYINSIPVTEWVCLMQLKPSLLSKGPS
FT                   PFMNPITYSQWDPKSLERMSEGIISMLLSTNRRAVIRYREGSKVSEKLAVEVAARMRSV
FT                   HATFPDLKATESVLVILDRRDDPVTPLLMPWTYEAMIHELIGFQHGNEVVIDDPDAKPE
FT                   DRVHVVTPQTDGFFGQHRYDDWGQVCVAVSEMVKAYKEMNNFDRNTVSLDEIKSFMNRF
FT                   PAARKQSVQVTRHCAITSELVAEINGRNLTRLSVLEQDIISNNNVTEHSRLVLEVVQDP
FT                   KTDVDDALRIVMLYHLHYERVAGSIIMQLKQELMQRQCPREKVQLIDRLIEYAGQDQRC
FT                   HEIFRSSTGHMLKTVAKAVGQFGKDVQNVLTQHVPLVKKIINRVYNGTLSVEKYPVQGV
FT                   PGCPIPAGQAPFVHAKDIIVVYIGGYTFSEAMLLAQINEGNVDNNQETLMNFGKQVSRK
FT                   LGTDGVTGPSTEPYTAKIEAHVSLITTSMLNSKDFIHSLPS"
FT   CDS_pept        complement(135198..136565)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0470"
FT                   /old_locus_tag="LmjF36_0470"
FT                   /product="dihydrouridine synthase domain protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0470"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0470:mRNA"
FT                   /db_xref="GOA:Q4Q231"
FT                   /db_xref="GeneDB:LmjF.36.0470"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q231"
FT                   /protein_id="CAJ08998.1"
FT                   /translation="MEFRRRRVPLTLASAMKVEESMFYQTTILAPMVRVCSPGFRALCG
FT                   AHGADVVFTEEVVAAKLATCQREVVRYPTVDTPMAEYVSYDPFKHTYKRTVVLSTPVLP
FT                   DTTYGGQKADRISAPRTVLQLGVADPARGAAAALVCSNDIDGIDINMGCPKKFSVHNGF
FT                   GAALMKRPEVGGAIVRAVHGAVNSDSNVEARGGKRVAVSLKTRLQDTAEATVGMLRAIL
FT                   AASQHTPANPVLHAITIHARTPDQRPEQAPLYDRAAEVVRACRADAAFEGICWVLNGSV
FT                   LSRQDGEAKCARYGFDAAMIARAALEDARCFHRKGSELPASSAAHDGEAQSTEDAEEYA
FT                   MAIMKELFFYSVRYRTLFNNFKYHLTRAFPVVRALKPFMEEVQLELRSYADCYEFFHLT
FT                   VEEKALADSCAHTVELLAEKPASTRKRAAVTAAASEEDGEQAHKLARVETTTKASI"
FT   CDS_pept        complement(138176..138853)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0480"
FT                   /old_locus_tag="LmjF36_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0480"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0480:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q230"
FT                   /protein_id="CAJ08999.1"
FT                   /translation="MLRKTNLFLFAASRALMSGGSSHGPTPYQDKSYPVQPHNLNELQQ
FT                   PPDSWRKSPIMSKLMDQSLPVYDDVVTGVGRLYWQEPARVWHLFEADDTLMLEEHDREE
FT                   WNDRPYVAVNHLYEPPIGSEERPIRVEGTGNPGDQQIVLCFGNCAPHVPQSNYYMMMKG
FT                   YSKTKCPMCQQWFYVHNRPWLVMHPDWTDEPAADEGPAYTFAEIEAEFDRDFHEFGVYL
FT                   NAE"
FT   CDS_pept        complement(140714..141760)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0490"
FT                   /old_locus_tag="LmjF36_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0490"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0490:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0490"
FT                   /db_xref="InterPro:IPR026319"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q229"
FT                   /protein_id="CAJ09000.1"
FT                   /translation="MPRPQFITCQLCGKGFGSASINIHIPQCYEKAIKRWQLNPQGPRP
FT                   VMPPLHGKPAAKASNGGPSGIAFAGQPCGAGMSAVRSLQMQSMPPESVEPESTNLHPCS
FT                   KCGRTFNFDRIAYHESVCKGDQKRRVFDSSKQRCAGSEGDDAYAGGAFGAPSGVRRGRT
FT                   KKLGTANTTSRYTPAPATQTNWRQQHEEFIAAIRSAKRADAEAQNMWGTGPAAPSFSTS
FT                   RGPARGGLFGATPSGYGDGAGMSARVSASTRRIPPLMAKQNETLKQGIATGGRAARAKE
FT                   GGGIPAPRTGRPLGRPTPPSGRDSFGGRGDRFSSRGGGGGMGGGGGGGRILNDNTTSVG
FT                   MLQAMGRA"
FT   CDS_pept        complement(143095..144627)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0500"
FT                   /old_locus_tag="LmjF36_0500"
FT                   /product="putative DNAJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0500"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0500:mRNA"
FT                   /db_xref="GOA:Q4Q228"
FT                   /db_xref="GeneDB:LmjF.36.0500"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q228"
FT                   /protein_id="CAJ09001.1"
FT                   /translation="MTQDEAPAASSSGKGNWEALKEQGNQAFKSNAFEEAIQHYSAAIE
FT                   AHPDEPVLYSNRSAAYLKRGQYQEAAHDAEKAVAMDRAFVKAYSRLHSALCNLGLFDRA
FT                   SEALRAGLTAVSTSPKATPQDVKHLRELLNSAEQASKVVPRGRQLIETGCFAEASRALA
FT                   GPYRDFPGSSTLAFLYAEAHVPSSPDEASRVLSPFAYTHGSDPYYLYLRALVLYYRGQE
FT                   GFSSAQNILRETLQMDPDNTKARILLKRIRAVESHKDAGNAAFKNKNAKVAVDEYTRAV
FT                   ECDQTNARMNATLRSNRAAAKMNLNDYKGALLDCDYAISNGATSAKIYARRSRIQEQLE
FT                   NFDEAVRDMQQAAEEDNQFVAELRQLKARAKRAKRKDYYKILGLPQHESNQDAIKRAYK
FT                   KACLQWHPDKWAHASEEEKSHAETQFKEVGEAFGVLSDPKKKRMYDSGQMDNDVEGANM
FT                   PSGFGGGASQEDIVTVMNMMFGGGGFQAGGFPGAFGGAGNGRRRPRGGPGFF"
FT   CDS_pept        complement(147982..150249)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0510"
FT                   /old_locus_tag="LmjF36_0510"
FT                   /product="putative mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0510"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0510:mRNA"
FT                   /db_xref="GOA:Q4Q227"
FT                   /db_xref="GeneDB:LmjF.36.0510"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q227"
FT                   /protein_id="CAJ09002.1"
FT                   /translation="MLSTTSSSFSTSATETTGNLFASPSNASSSRVMSDTADDLSASSS
FT                   REEILVIPVHTIVEKVTPLCGLSVPELHALVLRYDTDGVGGLTEPQWSLFCHEHRHAFS
FT                   SLGEELLDFDRSGEYSVLVVKHGYEGTSNTNAPRSFTKEVIRFIESFAAGGIAGAVSKT
FT                   VIAPGDRVKIIFQVEPTRHFSLREAVYLGVETVQKFGITGLWIGNGATMLRVVPYAAIT
FT                   YASFDFYHSKLRFMFSRSNPDGSPDEARAVTLRFISGSLAGATSTTCTYPLDLMRARFA
FT                   ARSSSGKRRFPSYSAAFKEATSRQGILSLYGGLFPTLVGIVPYAGCSFACFETLKHYIV
FT                   KVSNLKSDKDIPTYQRLVAGGFAGLLAQSATYPLDIVRRRMQVTPRRYSSVIDALRTVY
FT                   REEGIRQGLYKGLAMNWIKGPIATATSFTVNDLVKRRTRNYYETTVVYSSRHNIVTLPE
FT                   AFLCGGVAAATAKFLSLPFDRLKILYQVDMTEKTSAKKGAQLLYQVVKQSPNMWTSGHV
FT                   TMLRVVPYGALTYCFFDMFQLLAERLMYSHVATPYTNFAAGAAAASLGTTIVYPLDLLR
FT                   TRVAVNAVPSFQSYFWLLRAMARRHGIGSLWKGCYLSMMGVGVLGGIGFALYDYLKERF
FT                   GCHTFLQYMAAGATSGLAGSVITYPLNVMKRNRQAERVVYAQLGTSSVQSLLKSPKTVA
FT                   FLYRKMPFSFTVSSLTFGISFAVNDWCRDVIAATRNDMLREMLFLPSFAVSKSMLSRGD
FT                   TP"
FT   CDS_pept        complement(150996..152330)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0520"
FT                   /old_locus_tag="LmjF36_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0520"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0520:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q226"
FT                   /protein_id="CAJ09003.1"
FT                   /translation="MENIKEEICLVANIIDRLLEANGSLRADVLEPLIQRLRVAAGELS
FT                   RIDQQSKSDPVLSSFSRNADGIEGTGGGSRHGSSKLQLSKSLTPLTATRKQIRGCRTVS
FT                   ATCKKIGDPKVFVSSEISQSVCCSLYNLLEGTTRLLRGSHGHIFVKRGVDMFSIANVSR
FT                   KLAFPPPQVYHRCLGSADAEVLGSSIALNRNVDEVGRKSAVLIFPVHKLLPEGGPGEPI
FT                   ATIHVERREHAFFPFSESDEYTLYFASLFCGELMSRIPQINFLETFYDPSTQLIVAPFE
FT                   PYCPVVLPPIERGVVSMLGETGKQPSENPEYAARAVSWLTRKISARAPEILIRRESRPT
FT                   HNTKPFAPGVTHMPSLLEIKAYVENLQSCWKKNMLENVDLLELDRGAQQDLKVARSELT
FT                   ATRRELAATADKLRLYELDAWDYKREYGAMKSELDAYMDSLERLH"
FT   CDS_pept        complement(153258..154154)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0530"
FT                   /old_locus_tag="LmjF36_0530"
FT                   /product="protein phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0530"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0530:mRNA"
FT                   /db_xref="GOA:Q4Q225"
FT                   /db_xref="GeneDB:LmjF.36.0530"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q225"
FT                   /protein_id="CAJ09004.1"
FT                   /translation="MGDMLAKPETQKFSTVFETSHLRVGCCSMQGWRKSMEDAHVAQLN
FT                   LNGNRDQAFFGVFDGHQSDEASRYCRAHMLDELLKNIAIYKDDVAKAFEVSFQEIDKQI
FT                   CKKFVSSGTTANCVYLADQQIVCANAGDSRAVLYRGGKVVPLSVDHKPSVPAEEARIVA
FT                   AGCHVENGRVNMTLAVSRALGDVDFKSCAAKGWVDQAVTACPDITVTPSRSDDEFIVIG
FT                   CDGIWDVLSNEECCDLVKTLIQNSDIDKNGHSVAVDISLVCEQVLDRCLAQSNSVKAGT
FT                   DNMTIIVVEFKPPFFKC"
FT   CDS_pept        complement(154765..155190)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0535"
FT                   /old_locus_tag="LmjF36_0535"
FT                   /product="putative small nuclear ribonucleaoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0535"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0535:mRNA"
FT                   /db_xref="GOA:Q4Q224"
FT                   /db_xref="GeneDB:LmjF.36.0535"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q224"
FT                   /protein_id="CAJ09005.1"
FT                   /translation="MADTSNATKDIPSSLVFEAMHSRVTIETVEGDVYKGTLAAFDISR
FT                   GNIELVEVRHQAKDSTFGFYERVTVRGSKIRIVLLPPEMKAAPSLQWRRESVQEELKKS
FT                   LKHVPVLRPIVPSSRPLRTKKAQPKNDKSKQLRRKLR"
FT   CDS_pept        156279..156911
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0537"
FT                   /old_locus_tag="LmjF36_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0537"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0537:mRNA"
FT                   /db_xref="GOA:Q4Q223"
FT                   /db_xref="GeneDB:LmjF.36.0537"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q223"
FT                   /protein_id="CAJ09006.1"
FT                   /translation="MSLFDISPSSSESSSQSDNSSKVDDRIQLTYAETVVSLATAVGLV
FT                   IIVLLDLLYRSTSRHAMLLRVQRETRFDGAYILGKPEGNRARIILENGLKTHEFRIRHP
FT                   PQYSRVIPAVVSDSRDAKQDCVEMLSKVRSILSTSHGRCAELMSMRCCLACVTGALPGE
FT                   QSERFLRIYERVMFCSHRVNGDEKLVTSDDIRYMHAFYYNNVLKVLQ"
FT   CDS_pept        157618..158571
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0540"
FT                   /old_locus_tag="LmjF36_0540"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0540"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0540:mRNA"
FT                   /db_xref="GOA:Q4Q222"
FT                   /db_xref="GeneDB:LmjF.36.0540"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q222"
FT                   /protein_id="CAJ09007.1"
FT                   /translation="MAVTIKLANGSQHTVEVPDFSITVAEFKKQIAEALEIPASEQRII
FT                   MRGKVLKDDGVLSAIGMEDGNVIHVVRSKKNVAVPSSTNASSTLAASDPTSSPNVQPST
FT                   TTPAQPVPAPAAANPYAALMSNFGAPQTQQPAPGAPGFPAAGNPFAGMGMRMGMGGGMG
FT                   GAVNPTPQQAMELMQNPMMQQMMQQALNNPQFMQYIIQNSPQLAGLPQDQQQAIIEMMQ
FT                   NPYMMQQAMAMMGGLGGAGGVPPATSQAASTPAVGAGFNPAMFAPLAPQGNPREVYREQ
FT                   LQLLRDMGFPNEEANIAALQQAQGNVQFALERLLGA"
FT   CDS_pept        159355..160290
FT                   /transl_table=1
FT                   /gene="CRK3"
FT                   /locus_tag="LMJF_36_0550"
FT                   /old_locus_tag="LmjF36_0550"
FT                   /product="cell division related protein kinase 2"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="GOA:O96526"
FT                   /db_xref="GeneDB:LmjF.36.0550"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:O96526"
FT                   /protein_id="CAJ09008.1"
FT                   /translation="MSSFGRVTARSGDAGTRDSLDRYNRLDVLGEGTYGVVYRAVDKIT
FT                   GQYVALKKVRLDRTEEGIPQTALREVSILQEFDHPNIVNLLDVICSDGKLYLVFEYVEA
FT                   DLKKAIEKQEGGYSGMDLKRLIYQLLDGLYFCHRHRIIHRDLKPANILLTSGNVLKLAD
FT                   FGLARAFQVPMHTYTHEVVTLWYRAPEILLGEKHYTPAVDMWSVGCIFAELTRRKVLFR
FT                   GDSEIGQLFEIFQVLGTPTDTEGSWPGVSRLPDYRDVFPKWTAKRLGQVLPELHPDAID
FT                   LLSKMLKYDPRERISAKEALQHPWFSDLRW"
FT   CDS_pept        160849..161766
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0560"
FT                   /old_locus_tag="LmjF36_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0560"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0560:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0560"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q220"
FT                   /protein_id="CAJ09009.1"
FT                   /translation="MQSGAALLEPPLSMHCKYTLRILPFSLPPVVSPQLCRNSWFCTHI
FT                   LAAALAFSVAISSNMAATSYDRDAAVKVADENYSLRKRLARMEWEEKQRRAAEYESRFE
FT                   GAVDTSANDRMRSRNSALQDEIAGLESQLKELQMINVTDLQHEYTRLDNRRAYLLNEIA
FT                   GLRRILANQSKEVKRATRSVNSQHELRRQNNEQHAASIEDIQMFRKKRESLAEETQHLI
FT                   AKERQLMSELETLPAPGEDEEFVASRLREDNEKKDHIIAQLEATLKEQMKAGAQLPEAN
FT                   SAVDIQHLREEYVRLNDQLKRIKQ"
FT   CDS_pept        162644..164884
FT                   /transl_table=1
FT                   /gene="MEFG"
FT                   /locus_tag="LMJF_36_0570"
FT                   /old_locus_tag="LmjF36_0570"
FT                   /product="putative Mitochondrial elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0570"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0570:mRNA"
FT                   /db_xref="GOA:Q4Q219"
FT                   /db_xref="GeneDB:LmjF.36.0570"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q219"
FT                   /protein_id="CAJ09010.1"
FT                   /translation="MRRSGLAYMLRSSVPLLATPAFLANVKHMRNIGISAHIDSGKTTL
FT                   SERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWKNSTINIIDT
FT                   PGHVDFTIEVERALRVLDGAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDN
FT                   ANPQRAVKQAQERLGINAVFIQLNMGTAQDFEGVVDLIEEKAVYFDGPFGEAIRYEPVP
FT                   SYIKEDVVAARKELVSRLAECDEEMEFIFLNDQEPTVEQIHSAIRRATIANKFVPVMVG
FT                   SAYRNKGVQLLLDAVERYLPSPVERHNSGYQVRRVKDEDGNVSNVKEGEVALMTDDEKP
FT                   LVALIFKIEETKKSGLSNYVRVYQGKMRKEHLMNIRTGKNFLPPKLVRMHADSAEVVDE
FT                   VRAGDICAIQGEVDASSGDTLMKSGPQSGSQLFSCEDMYVPPRVISASLKTKDDKEQSR
FT                   VRERMLAFMREDPTFVYYRNSETNEDIVEGMGELHLDIYVERLKREYGLHVELGKPTVN
FT                   YREIITERQEFDFVFKRQSGGAGQWAHLKGYAEPLPIDMSVEKGVKNKATTRCSNGDIR
FT                   ESLQKTVVKHLERKIFVKGELMHAPVWGVHFHLNGGAMHEVDSNDQAFKNATQELWETL
FT                   LPKLKPTLVEPFMDVEMTVPAANMTDVATEFSKREGVVTETAVDGPDAVIRGETALDTM
FT                   FGFISDLRRLTKGQGDFSMQFKEYRPMQQYKAQMRMDERNNDLGRKPFKLSD"
FT   CDS_pept        166720..167460
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0580"
FT                   /old_locus_tag="LmjF36_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0580"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0580:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q218"
FT                   /protein_id="CAJ09011.1"
FT                   /translation="MRRGRLQEWHRTAAAVAGQAHRGSHRMPHHDYLTDFGTHHVATAG
FT                   ELSRCVASVSDKSWIECFTNTVSETPLSSLTTSCSAVHANHPSTHFDLQAPLFLSEGSL
FT                   ARASVIDLGGRSSRSFLHGMSSCSATPSCSKARRFQSYSLHPCNCGHAHRAKLVLFAVQ
FT                   ADILLSCPTKDRHMTAYHISLGAEVDQLVGHDDLILGGAVNPDDTLVATTSRDCTAIVW
FT                   GLPSCKQRRSLTHPQLVHACRFSS"
FT   CDS_pept        170445..171104
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0590"
FT                   /old_locus_tag="LmjF36_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0590"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0590:mRNA"
FT                   /db_xref="GOA:Q4Q217"
FT                   /db_xref="GeneDB:LmjF.36.0590"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q217"
FT                   /protein_id="CAJ09012.1"
FT                   /translation="MKSATMSATHALRDKWFVSFLPLLTADMVNTDYKGNWQLAAQERT
FT                   QKLDWITSVEELWSTMNSLPKVHQLGMGSTLIFARNNKEPPSYEAYPNGSRIMINLLKP
FT                   PTTDAGLELVLAVVMGETAAEKASDGKPVCDVLRIAARPSREHSEQIRVEVWLSDSTRS
FT                   HAVAEFLAEAMRAKGLAANSYNIAEASFDAAAPGKDKKVLAASTMPSPSSPPMVKD"
FT   CDS_pept        173326..173784
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0600"
FT                   /old_locus_tag="LmjF36_0600"
FT                   /product="putative ubiquitin/ribosomal protein S27a"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0600"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0600:mRNA"
FT                   /db_xref="GOA:Q4Q216"
FT                   /db_xref="GeneDB:LmjF.36.0600"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q216"
FT                   /protein_id="CAJ09013.1"
FT                   /translation="MQIFVKTAAGRSVAVRVSAEDTVGFLKAQANVTQGNLFFAGMCLA
FT                   EEEPLAAYGLSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVT
FT                   ENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLTYKAESK"
FT   CDS_pept        174967..175752
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0610"
FT                   /old_locus_tag="LmjF36_0610"
FT                   /product="DNAJ protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0610"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0610:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0610"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q215"
FT                   /protein_id="CAJ09014.1"
FT                   /translation="MTTFKQNSTSGNTSVLDDLFSSSINVSAPASTAGASAQPMYFSSS
FT                   ASATQNATPSAAAANHSSVLTDLFSAPDVASSEKDDKYGSVGETHAMIYVDGNSGSAEH
FT                   GVTNLFDLSKPVKKDKYNSAESLLEAFERQGKKSGSGGGRPDERKTLADLTRNKDDNKV
FT                   RARLLPLMNYYDVLGVAPTASEEEIKRSYKKKALQLHPDRAGRDQMQEEAELFKVITKA
FT                   NEVLSDAEQRRMYDASLASGAGQPAMAPSAADWWCHMQN"
FT   CDS_pept        177841..178404
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0620"
FT                   /old_locus_tag="LmjF36_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0620"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0620:mRNA"
FT                   /db_xref="GOA:Q4Q214"
FT                   /db_xref="GeneDB:LmjF.36.0620"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q214"
FT                   /protein_id="CAJ09015.1"
FT                   /translation="MVFSARRALAQLLFGGAMALMHLLAMGAGAHMHASLSVSRLASPL
FT                   QCTFPSPLCLIRFCLPPPTLPRPQHTEAIASRRTCRSTHSYRTIFRHRFSWFHLRRLFV
FT                   LPYRGSHSPTMFRRSLMALNWRDQGISYVKYLNVTTEALHMATKDKVRAKYSRFSAPNY
FT                   VAVKNDGTGVMEEVKKVPAFTKDY"
FT   CDS_pept        180098..180664
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0630"
FT                   /old_locus_tag="LmjF36_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0630"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0630:mRNA"
FT                   /db_xref="GOA:Q4Q213"
FT                   /db_xref="GeneDB:LmjF.36.0630"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q213"
FT                   /protein_id="CAJ09016.1"
FT                   /translation="MPWYLSTFRVGFCAIYAYFGYVQVRWLLETEDRYRRSSTWKPAVG
FT                   TIFDHKVVMTRGGSSYVQYKFNVDGVEYIGDRFRSGGIHKEEMVSNPTLLGAGTQLVVY
FT                   YNPADPSESAIKLQADRGAESVFVIGSLLSFLIAFRAVRCETILPNMFYRFLGVNRRVG
FT                   GISGLRQARSHAKQRMKYGKHSGSL"
FT   CDS_pept        181551..182456
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0640"
FT                   /old_locus_tag="LmjF36_0640"
FT                   /product="putative ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="GOA:Q8ISS8"
FT                   /db_xref="GeneDB:LmjF.36.0640"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ISS8"
FT                   /protein_id="CAJ09017.1"
FT                   /translation="MTDTPSALSARLSTRLSGTKRPRESLIEFRVKDIMESLGVSEDYL
FT                   VLGIDEAGRGPVIGPMVYTGAVISLGEHDDLVRLCHVADSKMLNERRRLASLQQLRQLK
FT                   TFRSFTVCVSPEEISKTMTGRSGRNSNTLSHETAIQIISEATLASAGKLCAAYVDTVGP
FT                   PETYQARLAGRFPHLRVTVAKKADSIFPIVSAASIVAKTVRDTAIEALGENIGSGYPSD
FT                   PRTMEWLRSHVHRFFSFPHAYDFARHSWGPLVQLANDPAVRVPVVCEQDLEGARQQGRG
FT                   GDSRQQKLSFAKPSPKRHMV"
FT   CDS_pept        183872..185356
FT                   /transl_table=1
FT                   /gene="TTA2"
FT                   /locus_tag="LMJF_36_0650"
FT                   /old_locus_tag="LmjF36_0650"
FT                   /product="putative GPI transamidase component Tta2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0650"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0650:mRNA"
FT                   /db_xref="GOA:Q4Q211"
FT                   /db_xref="GeneDB:LmjF.36.0650"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q211"
FT                   /protein_id="CAJ09018.1"
FT                   /translation="MPTATAAKAAARPPVRTSVERLLLHPFVVFLVTFSVRAALFTSRY
FT                   SVEPYISSPVIPHPSLEDIVGKAAAGAWHDAAQSAYVSGGRSQAERIVTPPPVHFSMSI
FT                   SMTEASTWREVVYWRESGFAEVEPYYLQELALWYVRFIPAVLAKPPVTGLVLSAMDGLT
FT                   AALISRWSSATAALLYAFFVLNPIMVLTTTSQSLTSFELLLLTVTVDLCARRAKSALAY
FT                   AGALVGAFTLGSHFIAVPVVLLAPLGTQSYRIAFAVAAALAACVGAYAVLYLYTTEVSH
FT                   RFASLYAPPDNGVLWYVRQLVLPSFARCLEVFMLQLAPMLLIPATVAFPASYLRQPLSS
FT                   TAHPHLFTDGRVFLLLMAEGLSVLFRNQLTLPYCFLIILHFYSSLNPTASKTVTLEDQR
FT                   VVTYSPYTRVRLLVPIFIQLTSIPLEASFYAGWVLRETANANWKFFSDVAFMIGATAFF
FT                   VMWYTEVVEDAVLCENDGGADAVTCSASPFRATKRD"
FT   CDS_pept        186844..186975
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="GeneDB:LmjF.36.0655"
FT                   /db_xref="UniProtKB/TrEMBL:E9AG13"
FT                   /protein_id="CBZ05897.1"
FT                   /translation="MLYLCKFPVSRPYRHPQDLSVRCLTWPSSLSQAYAHTHRHPTR"
FT   CDS_pept        190205..190813
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0660"
FT                   /old_locus_tag="LmjF36_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0660"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0660:mRNA"
FT                   /db_xref="GOA:Q4Q210"
FT                   /db_xref="GeneDB:LmjF.36.0660"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q210"
FT                   /protein_id="CAJ09019.1"
FT                   /translation="MPGLGKFAFHVSFHLSRYFFAAVVAALLLLSLSGGSLAGTRTRDG
FT                   STSGGAKNGTTRTVTTTTTPPTTAAPVSLQEACHTEMKLYCSDHPISPLRCLVEQYDRT
FT                   TKSNSEEPRRRTSVLYSDVCGSWLAAREACLGFVHQRGRELCGSFVGDVRECLRQIPPL
FT                   VLPHACVTSAYYESVRLVGKLRQHQNEDARLRLLREKLP"
FT   CDS_pept        195591..196982
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0670"
FT                   /old_locus_tag="LmjF36_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0670"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0670:mRNA"
FT                   /db_xref="GOA:Q4Q209"
FT                   /db_xref="GeneDB:LmjF.36.0670"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q209"
FT                   /protein_id="CAJ09020.1"
FT                   /translation="MADALPSALFIALAILFLFWGTVQTLSLKWADTIEASDGFTGPTS
FT                   GQGGSHAVHFRLLYSFAHPFTQAFFMFCAETSCLVLLVCTLVWKKYVAPRLRDSRRGAA
FT                   AAPTGELVAGEDYALPCSPSLWLLPSGADFLASIVQNVGLTLTYASVYQMLCGSTVVWI
FT                   ALISYFWLGHRFTKVELWGMGCVVLGIFLVGLSNLLERGLNFESTSHGRHKSPVLGNLL
FT                   VLMAQILHAYQGVCEERLIRLYKVPSLQMVGTEGIYGIGMSLSLLAFLQLVPMATWGHN
FT                   LASVEEFSASGGPGVLHANITWVQQLQPALKVPYDDVVLAFAQIRESWECKVFILVYLL
FT                   SGFFYNACHMSVIKYVSAMATVMIGSLRNVTVWLVCLLIPSIFEEHFNVVQLTGFVFLV
FT                   LGNVLFHRIWIARFDAVLPAQVINACPVLFHDARKDREDMVKVEKRSRDTSLEPQAREM
FT                   RPKEG"
FT   CDS_pept        199117..202221
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0680"
FT                   /old_locus_tag="LmjF36_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0680"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0680:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q208"
FT                   /protein_id="CAJ09021.1"
FT                   /translation="MLDCLSLWPFFCLDGDAYVKRCSCRLKRSYRLPGDAYACAVIFDH
FT                   KKGNQKALLPETATALPPLPPPNRSKAVPSVQAADWHFQFQFAKMFADLLAAPSYHAGD
FT                   RSSDAGVAPVSPSFSPRCISASSSAGSRSGCHLRQLSAGGDDGSYPRVSPLVGTAHPSA
FT                   HTDGRARRPGFSECLSPLSIPEGCASSTTAMVSPSSGHPEGRSLSLGGSSEAPPRRSSG
FT                   GTLGNSLEGYIPMSGSSSFSSHHGDSARSPPSSTRTLSLYHHGQKALGVAFSTPSRGAT
FT                   ALLPEGAASPALDSAESSADDANFVVMRSGTREGGQQSPQSIASSKSSSPSAMPCAPPL
FT                   AQPKAGAVVVEKYAPMLPAPPSPLRFSVFYTEEEHRVLLETRETEERRCLYQAHKAVLS
FT                   VYRMWAAAGADADYGDGDRPLLTSSRMGDGASTRLLEDYRGPKTPNTLKAKAADTRAQP
FT                   FPLATATAANAVAAERVRCFLKSSIDSARGRCCLGAGQEGGAAIGVLPHRSTTPRITYA
FT                   GSDAETRRGSPGHVPHPQASHSSSPAASRMLDYSSVQMPETASSLMHDTSEPPSSVHQA
FT                   RLLSPWRATHTDHHDAAARRAEGKADVHLEFRSSRDDSRGRSQRRPRTSLVPHLVSTSP
FT                   AAVRLSSASLSLGASSVALGRRSLLESRLRAETAAPREDLSRSAVLPPARAAAAARAPS
FT                   PSLRPVLSAGVRCLSSLSAAQTEGPGASQATWSPVWNASVNLVPASTAICQMSPSAEDD
FT                   KTCDHVPGGAVRYASNEAFRRRQRAPLPGTSSGGLLSSLPHGIDTDRRTWLAVDRLQDH
FT                   HRERLSSYVHYKRFFDAVYGEQSGSPLVSREPDGRHSSAGRTSPVPPCAVRTCSSMSFD
FT                   VGDGNRHASTWPWRSSLSSSLYPRVRSPELVACRDLRHFSPSGSTAARRAPAPPSKEPT
FT                   TFCARLTGGAASLTVPADGTLFAARLTRLSTLEKLCRAELQRRCMEDQSLLLHHFIVEG
FT                   TATLQRVGRTTALLHRHRQRAAGGTTKAYRMPSAWTFIPNEVDGL"
FT   CDS_pept        203107..203913
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0690"
FT                   /old_locus_tag="LmjF36_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0690"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0690:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q207"
FT                   /protein_id="CAJ09022.1"
FT                   /translation="MRRCCRLFAGSGNSTTASSSGAMISLREATRLAKIAGCFDSANGS
FT                   SSSLLRRCTDSACAQGRNVTSSSSSWEEIKRRQHQVFNERHLTAENTIAVTVSCVNMAH
FT                   LSVYVHSVQCGYPASHAPGPSGEGVPGKRTITTATLTNQSCAVLLLWVSMGSPELLAVR
FT                   CALSPGAVETCWRAAPAAASSDTTKAGSTIQTAAPSSTLSEKDKLRRIKSWAEELVLHR
FT                   WVVVSGQLRMEDVYDGDLHKVVAVPVLEVARDHFKGSVLALPPGFL"
FT   CDS_pept        204695..205384
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0700"
FT                   /old_locus_tag="LmjF36_0700"
FT                   /product="putative MP18 RNA editing complex protein"
FT                   /db_xref="GOA:Q6T456"
FT                   /db_xref="GeneDB:LmjF.36.0700"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6T456"
FT                   /protein_id="CAJ09023.1"
FT                   /translation="MFRRLSPAAATRSMATMTHPLTSATQSQSVTSTRAAVSRVAMRGC
FT                   SSSSGTSSGDVSSTKGAAFSVSRSGQRAPSINCVTLVGVVHDIQTGYVFEDAVTQFTLT
FT                   TTSLDAANQAQECVVEKDHHTVRCYGDVFSREVRAKLSEGNVVCVNGRLRLNPQMEPSC
FT                   NKYYYFPYIQVQPPHGQVSVVYGDRRSPPSPVNAATGELNNGNGDPTNSAAPAEDGDPS
FT                   ATTQKTP"
FT   CDS_pept        207740..208519
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0710"
FT                   /old_locus_tag="LmjF36_0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0710"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0710:mRNA"
FT                   /db_xref="GOA:Q4Q205"
FT                   /db_xref="GeneDB:LmjF.36.0710"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q205"
FT                   /protein_id="CAJ09024.1"
FT                   /translation="MGTDKVMSEKLVLEKTKVKSLSDVQRLDMWGEGLTDISLVAKLPR
FT                   LEVLALAANNVSSLKALQGCELLQELYLRKNKVANLREVTALRVLPTLSVLWLRDNPCA
FT                   QHPYYREFVLHCCPGLRQLDGVEVTADERKAAAKRLTTKTLDEILGRSACADAASSPRP
FT                   KKSSGAGSSPAKATDVTPSSTPGGVSDSTATIEERNASSRSVLFTTVAAQRAMLLSIVS
FT                   LLSELTVESLELLQREVQERVEKQKEKLTKYVQENSQ"
FT   CDS_pept        211089..212384
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0720"
FT                   /old_locus_tag="LmjF36_0720"
FT                   /product="putative mitogen-activated protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0720"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0720:mRNA"
FT                   /db_xref="GOA:Q4Q204"
FT                   /db_xref="GeneDB:LmjF.36.0720"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q204"
FT                   /protein_id="CAJ09025.1"
FT                   /translation="MSAEIESHILKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKIY
FT                   DAFQNSTDAQRTFREIMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVIRA
FT                   NILEEIHKQFIIYQLLKTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSL
FT                   EGEQASRPVLTDYIATRWYRPPEILLGSTRYTKGVDMWSVGCILAELMLGKPIFPGRST
FT                   TNQLELICSVTGMPSAADVAATNSQFAHAMLRDIHCAHRRTFAELLPSASADALDLIER
FT                   FMRFNPNRRISAAEALEHPYVAAFHRPDEEAVAPEPITVSLPDSQRLPLAKYRDAIYEQ
FT                   IAALRRSSTSADQRQRAERQTAGSTASRKTSVSSTAARAAPQRSAVKPTSTSAVSEASS
FT                   SKAYARPAFRSATSAASGLESRPVAREAAVRK"
FT   CDS_pept        221343..223007
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0730"
FT                   /old_locus_tag="LmjF36_0730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0730"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0730:mRNA"
FT                   /db_xref="GOA:Q4Q203"
FT                   /db_xref="GeneDB:LmjF.36.0730"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q203"
FT                   /protein_id="CAJ09026.1"
FT                   /translation="MGVLLFPPGHGFRLFVHFSRLSFFVCIFLRLCCSLLPSLALQTMP
FT                   SGNTQHRNWSSSNSGEVGSRQSPASTSEGRRSPNGRRSYQERITTVRFIQPSTGETMCT
FT                   KLNRVQRTKTKPENDAELCESFLKGHCDSGNGCQYVHVPKQYLWRLLSPHVDPKTLFYY
FT                   PGFNVRCYTPDMNVYYDIPSEFIYQTKGSDRYVELFNDNGDNFKDKCRLCPNLQSHGIC
FT                   DNNEQCDDIHCAVADLDQFPHIATHRATKEAVARYEHMPPELIVRVYQPNTPGDGMDFN
FT                   GDDVLRTAGATQYEDAYKQTGGIPALKMQHCAHFQTKKLCRMGDGCRFLHVVSVALASP
FT                   SPDEEASMRSSPAPATITASATSAPNAATPTPTAAKMHTATTMTATVTAGRQLREEDVA
FT                   MNAAAEMAAIAMAAGEPRYIGSHLDNTVPQVSRNGRPHTYGTQAVVPQQLQPHQQLQPY
FT                   QSQQQPSSIYPYGPVSMGAVKERVSPVQYRSSGRLSPIKVVVTPGQMEGAPAQRLSPVS
FT                   LPSGGSSGTPTQQPHSRTSPLRRNNPYSLSPSSTSLN"
FT   CDS_pept        239818..241449
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0740"
FT                   /old_locus_tag="LmjF36_0740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0740"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0740:mRNA"
FT                   /db_xref="GOA:Q4Q202"
FT                   /db_xref="GeneDB:LmjF.36.0740"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q202"
FT                   /protein_id="CAJ09027.1"
FT                   /translation="MFPMDIANTGNQQMLYRNNQPPQQRQQHQMPQHHLQQQHHQMPQQ
FT                   QMFPSQYGYQQQQPYLAYPSTAGPNAGKGAMDFIPSQQYMPQQQMFQYGYTQQHQSPLN
FT                   QQFFHSVMAPQTQPPPPPMRYNQQGNSNSTNQYMGGHAGGHPRYHGGRGRGGMHSGYGG
FT                   QFHRQVHNSYFYNQQHHYSSNNAVPEKTPTVHLIHPETKKIISIKLNRIYSTMADIRPQ
FT                   LHQQSHSNGASASNVPSVTEDSKSEKASKNERPKEKSDSSPAPKFDPKTTKLVLCTSFL
FT                   SPKGCMHGSGCDKVHIAGLEYTWPQVEAKEVKKEGKKAYSAGFFVHCYDPTLTRYYKVP
FT                   SGSVYVTKGSADYVNMFNDHGDNFKMKFKLCAPMLEGAECEKGEECEDIHCSVADLEAV
FT                   RENSANATHINNIEAMADVPRLPADMTVRVFNQNSFDTWRDYPGGNLLITEGAKAYQKQ
FT                   YEQEMNSVPTRKRMQHCAHFRLKDMCRLGESCRFLHVLPTEQELKERKDAEVAEAAAQA
FT                   AAKATEGVAGEGIMKSDTKDAGATIE"
FT   CDS_pept        259145..263017
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0750"
FT                   /old_locus_tag="LmjF36_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0750"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0750:mRNA"
FT                   /db_xref="GOA:Q4Q201"
FT                   /db_xref="GeneDB:LmjF.36.0750"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q201"
FT                   /protein_id="CAJ09028.1"
FT                   /translation="MSALTPSVTPVTLRSVSGKSLLLTPPVTLATVLTVATAPPFSFAP
FT                   ESVKILLHGRVVRLLQYQKQHGSDVLKLPLDASAYTPLRTTAKWAHSVALASSSSPGAE
FT                   LKAEPRSVIVYGVPQHIQATASAPRTSAQEPAALPTPFAETHGKSLPMSTSLRAGQQEC
FT                   SDSTCTTVAATPTTPKASRHASLMRLPMSSPTARVAPIKGPLPYPHSPDGLHELGKICA
FT                   EFDSDDDEDFITLLQGAPPSIYNHPTVLYMSNKVKGDLVILQAAMEQIARVSPVFFDWI
FT                   VENPQRFLSALNRGGERSLQQVKDQLRMLAMRAMADQMSGETPSRHVMMLEVNTRDGSP
FT                   DVYQVEVQVGDFSDASTPSDSLTPNSLADNNSAEEEKGDGEDNVSTDEGLEENDTAASS
FT                   VDASAEDGGVAGGTEEAEEEDERHRGAILLSSPPGPLEEPRSSHPPSDTVPSPGRAVTG
FT                   AMLSQRGSVATAEERASAEERELPLTPSTPADAVAAGVARRSFPPLPSTSSAAARSASL
FT                   DVAASPASPAVSPHEDSNAEDVQLSGLRKELQHVDSLTQQWAHQATNDAAHRAHTAITK
FT                   LRRDLFTMLNDLITTSSTPASLLRSFGNVRRLALLACDFFSTAEEFYVQLDEQGVRSSV
FT                   FGETPQDSVAAFAVVAALSRLLVRDVDAAVERQLQQGAAGLSRVGALRSLRRIHSIWES
FT                   PALRWTTTEGPEKLLMALLQLCRQQRAVVLWYSSHYVLKEVGKTIQTIAYLLGGRGEAQ
FT                   RTVSLQRLKVSSKAHKQDEVADCITALSDALTETGTLSDAMRCQWFTLMHSRYQRLVLP
FT                   IEKDLPAPHMTSDPLYVCDTRHVLPPTGSSARPDTLRGTMVSAARWWAGYCDDRHTCCA
FT                   DKWCLALTERLWNVVTAMENAAAAATAENVALVLTGDGTEESAANSPSLEAAARDWLGD
FT                   IAWIPVDSVVASSVATASTSLSRSVARHSAVLFEQVWPPAEAKDGIAAADPSSSVAGVH
FT                   GMLPLFSGDVHMVDVAAVAAGHRPVLQVAGGAALPTYLATVARSFVLPASAREQIFVRH
FT                   LFGMFAKHPRIPVAAAVRDAALANARCQDSPWLVSEYVLYDYGGALSTFTDAAEKADTV
FT                   AAVGAAVTTKPAPSTAAAALPPPMTDPSAECVSDNFVRMPSVPLSKRLSTPRPLPPTQR
FT                   RPVRATVCSQLARAQAAAGAMAKRQYARSHAVDELYEMMLGSLLEHRPTGEAEVLDHLV
FT                   HYVESSQDAMRGRVYERQAEAAAAAAAKKVAPSTKPSHSAVGGGSSCTQPQPPSGKPNS
FT                   FARRRQ"
FT   CDS_pept        267135..269702
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0760"
FT                   /old_locus_tag="LmjF36_0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0760"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0760:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0760"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q200"
FT                   /protein_id="CAJ09029.1"
FT                   /translation="MTRSSTLNRPVLLTKDASRSHPGAAYDTSSGARAAAAAAARASPL
FT                   PSPSVSSSDLCDTKGVSSSENRTCPAAATVQSVYLSRPSPPAPPPRPAGHRRSRRNSLT
FT                   SVKTNSSASFLPHEQNFSPDEEATATLRFFSTMPDLSAAKEEAEEEPWCSSPDEDLTMG
FT                   TSSSVLGGTGNIPFAAQSGGSEAAATPACGARKGGSDGGGAGAHSHDATSFAGPPPSPH
FT                   TSKGSVHAGGTAGVVARLKERGNAFLLREEFELAIATYTEAIRLDPAHEALWGNRACAF
FT                   LLSFRYLPAVADCLYVLHIYPGHTKACWRAAKAYAAAYRLAEAKKYYQLAQQACERDSM
FT                   WRGSASASRRTASLSLMRSDRGGDETPDGLFARGAAGSSSAEAAGAFCRRDSRLLKSER
FT                   ERQVLATEEAALGMVETYWQHLRHERWADALAAMDKVLTLPSYTGPTAVSWQALRIEAL
FT                   LHLHPKKALSEAEALYRTYPDSLELYPVLAKTIFYDVHDAAATKRCLGLLDEAAEKRCA
FT                   QNHLLKVHVRYCATQLRERLPADAGKASAVHMEAWVKLHYLREDSRTAELRHTIEKFAR
FT                   HRDAGNAAYEAGDWDAAASAYTRCLETDRLNHALLAAVYCNRTAVYMQAGRWRDALGDA
FT                   DSAVALSPQYATAHARRGRVKLYLLSQEYRGQRAVLASCSAAPWTAAIRERLQGYADAA
FT                   VIDLTRAVELSPTTEHKTQLQQALAQRRAIKASLKPTCETPKSSMPFSAASASEGERHR
FT                   GQSAHSPHPQADARRAESAAICELTDQLKLLGLSILAPLAPGEFGRLPEPKVIAKAYRE
FT                   AALRWHPDKWVTATPHEKQRAEQQFKSICVAYQALRERSGVVF"
FT   CDS_pept        271472..272785
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0770"
FT                   /old_locus_tag="LmjF36_0770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0770"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0770:mRNA"
FT                   /db_xref="GOA:Q4Q1Z9"
FT                   /db_xref="GeneDB:LmjF.36.0770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z9"
FT                   /protein_id="CAJ09030.1"
FT                   /translation="MATDLDSFSTYIDHLILLLAARFHAPLEVSVEELLPSSMNLSAEA
FT                   QCPWELVACSVQQALRTPQTAQERLLMRHLDVHHFSASVCRERARYMQWKLQECRRRRG
FT                   DKQQLVQSPAVPSAARANTSSTVAASATAAGQPCDVACTSLHNDVCSLYKLVLQSLPST
FT                   LGGTESDDDEEDAQAPTTSVQSLASASEPSSFERVHEVFMRTPAEQERDELVARARDEF
FT                   LSQVQALQSVYYEKYHRWMDVPASVLDPPPASSKQPASTDGAAAALESAAPQRGSESER
FT                   AALLEALGAAAAPPPRHRKQANHASSSGAADWTEKPHTLASMLHQVQLRRPLRPSAVSD
FT                   DVLESLYRARAETEEAPKNLCVASGLRSCPPAASTSATPSFAGGCADTITAEAVAVAPS
FT                   SSQPSSSVAAVRKDTVPPASRRGRWQIVEYDDDDDGEG"
FT   CDS_pept        274803..278018
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0780"
FT                   /old_locus_tag="LmjF36_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0780"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0780:mRNA"
FT                   /db_xref="GOA:Q4Q1Z8"
FT                   /db_xref="GeneDB:LmjF.36.0780"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z8"
FT                   /protein_id="CAJ09031.1"
FT                   /translation="MSTLSLAPPSLSTPVIGDADSGDGDGAQRRMQKQRVLQRREEEVA
FT                   RLEATLARERVANANSLNTLRASLQRERLLRTTAEKGRQAAQAEGRHLRTALRALLAQP
FT                   PSNSNTEPLSSTVPVSLYEEARRLLLRCEKTFAELKALQLRSTDAAGLEVLRRYDIPVL
FT                   DEIPPAWPPVTPQRSGKEEDDHARCRARAGGGPNSTSAAREKAASGTTPLPMEDTVTGL
FT                   EISELTALSPDTPCSPSSATRQVRAATAACEATGTWRGKGRVPPVHTSSNGTANPDVGE
FT                   ETLSADGRRRPRPAVPSFPLPSSETSAAKVVQPWMGPMHEFAGSTPFLDATPLQELSAE
FT                   HHTRLSELGREDTIRDTDHLLRSLAEEIATLATSQGLRTASEVAALCRRRGLHYVDAAF
FT                   PPVSETLGFDSSGGCRGYDVDRRTSFVVEWRPRDAVVPRGRKAELLTSAGIDPDSLRCG
FT                   RLGDAGVVAALAALAESAGAVMSVLASTTSEDEDNGIYVVWLCVHGWWTRVTVDAYLPC
FT                   VIEENRPIDLYGCSSTTTYDLWAPVCEKALAKVLCGYHPLCSLTAETAMGNFTGGPVEC
FT                   WDWWHRRSSTALEEMEAALNTSARGAGVVLLSTFSTAVLRDTSSRSVAVAGAYAAYQRL
FT                   GLRPGTSYRVLAVADNAEGEPMVLLRNWTRRREQRESGQACCRFDGDSAFRGGDRRNLS
FT                   PRRDSNDGTAAAKGWLAKPPSQSSAASSQCDSCVWLNYTKEVLPYFDGCHVCFDCRRYH
FT                   DLRVPIAFTGSRPAIPTQLVRVRVQEGFARPLYGVTRCPTRLWIGLHQPFSRVDTSDAA
FT                   PACFPWGLKMTLVGQEEAPVPFGGGGGCARPARRSYILSESFLGEPKELPAVWMYLELE
FT                   PVADSAPHPATDLQDEDAAATTTSTEFFVVPHMEWIVRKDRAHTSQDDDGLGSLGCDVP
FT                   SVQHRRSVGQEGQHRRLHKGAAPHSDQSGCASDAERAVWHQCSNHHPTSLAELSLGNAT
FT                   TAIVAVLAERRESVLVDVVDAPEELRAAVYHDVLDRIDFSDCSVAGGSGHRHTSHLSQA
FT                   SAATALGEVRCQLNGRCMLTFSW"
FT   CDS_pept        281035..282720
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0790"
FT                   /old_locus_tag="LmjF36_0790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0790"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0790:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0790"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z7"
FT                   /protein_id="CAJ09032.1"
FT                   /translation="MERDKPPPALRFARQWTLPSSSAGDAGFATLDYPSRHTESPSPFS
FT                   RSHVPLTPSPDRAGRRQPLEGSLAPGSPSPLPPLELSALTSGGAARHADASLERTSLPV
FT                   PAASSASNVAARCVQPMMSASDADGKSFWRRQAQRLEATCTALEEELRTVYRVFGKEAD
FT                   GIPRVLEASSHTSLLAVGSVDPTYETVARERDMARLELAREREKNFLLRHRLREMDAEV
FT                   HGLQIRHARVVGQQRVGDASKRALPSFDSVSNVGVRSAKHRRASTRCCSSSRSSAQSTR
FT                   DVRRSPTYSHSRSITRPYTSSSAKREESPRPTPAPVSTCSAHYSDDSKVARSSTASTSS
FT                   SACRESGRRAANMSVADPAAFRKPHGLSTHSPVKPSRQATDAYEAEARDLLTWLLSARP
FT                   SSSSPSRRQLFLWQKGGAGSRGPESVRHSNLESPPRRVFHNGFFSAAVAISEGEGDGGR
FT                   WARGTAHGAAKARPAIRDSRLLTPIPPQQERGAAHDEKARGHPTGAVRSFCAMPLWMRA
FT                   TQSAADPSRDALSGKGAPTGHAGDGEWIAWQPHVIAPRQQSGEA"
FT   CDS_pept        283379..285259
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0800"
FT                   /old_locus_tag="LmjF36_0800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0800"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0800:mRNA"
FT                   /db_xref="GOA:Q4Q1Z6"
FT                   /db_xref="GeneDB:LmjF.36.0800"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z6"
FT                   /protein_id="CAJ09033.1"
FT                   /translation="MHTLLFLSALGDPTTASEVGAEGVRRRVVFSEAHPPLLLTTIGTS
FT                   GHTALSKEHAEALAVISGNMSSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYEHV
FT                   VAELQAGRRAVDVFRGTSRQDHLSELLAVRSLSELFERLYPLSQSCILDESTASSQFWR
FT                   QARVTLEAAWAAPHDAKGRALLTQVRGQPRFHFCGPRDVETPGEGYPLHPVSLERALAT
FT                   SKRFLRTAMTCALDGSTDALAGRQPELRAVLQLAHLVPLTPSTGAPPRKEVTPEGLSFC
FT                   MVSLQQRWWILVNAALERVLLLTRAAVNGNGNTSGSSGVTKPLLWQLLAVLSVLDTTQY
FT                   VFAFPERQQDLAAHHLLARLSEVGLVYPLLSNDRKCFVLSPDFLHAIHWHASAPLSLTF
FT                   NHHLLRSASGVSGAGIGDLRREDTDTIITETNFRLFAYTNDADLLNILNQFAELEEIVN
FT                   GNLHCYRVTRASFAAAMRKGITAAQVLRFLSLRAHPSMLRRHGEREENGDTASPSSAGG
FT                   ASSSFTFSASPRRGAVAGTCGSTTSIDAVSTLVVPQSFCDQMRMWESECRRVVFEHHVV
FT                   LLRNMSTQQQKAVTAYLTDAGEVDAVVHAERGYMVIREEVFERLVAPLLG"
FT   CDS_pept        286130..287509
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0810"
FT                   /old_locus_tag="LmjF36_0810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0810"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0810:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0810"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z5"
FT                   /protein_id="CAJ09034.1"
FT                   /translation="MMRRGAPEWFTQGKARERFHRYWPWALSSICAGLYLYNGEPFEDA
FT                   AGAIVTKIRRPLLKTMEWVELHDVDPETMSLELPPDMLFGPLEFPKQMRFLLAALRADN
FT                   ELADGYLARVIIDRMDLSLDPPILSEGDFLAAGGKELLDFSVEDFTGTKSRAQRKHIFF
FT                   QPDQFLQFINIIAAYPTLTEYFVNEKDGVELVFQAYRHSKNPYACVMAMRSLTLFSFTQ
FT                   AVDGTVERRILQSNGVKTIVDAYKQSTGDPTETRFPTLLLSSIMRHYPKEGGKEFIDAD
FT                   GVEAVVNNLNIARYKGIPQHIRVLHDAQRLPKQSIGKKSVDARLEEADFLGVAMGLLDT
FT                   FPEFYEATGDLLKLLTRVVPAHADPLELLEYRAMPILSKYYVRWREDQSFQTDGTRTLV
FT                   AKLFELMLNDKTCQRCYDPSVASYELLECLRTAKLAVKDEQEKRVMRFPDPQRQPASAA
FT                   A"
FT   CDS_pept        288511..289416
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0820"
FT                   /old_locus_tag="LmjF36_0820"
FT                   /product="ADP-ribosylation factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0820"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0820:mRNA"
FT                   /db_xref="GOA:Q4Q1Z4"
FT                   /db_xref="GeneDB:LmjF.36.0820"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z4"
FT                   /protein_id="CAJ09035.1"
FT                   /translation="MSTEDASIAYAKKHKIHHLFELMATKVLLNRPENPFAYLRNLLKD
FT                   VEESEKNRVPYDPTEVHFNNDVGAAAPAAGNSGGSGAAAPAAALTSAKKEKRTVTLATF
FT                   GLDRAGKTCALSVLESGEADKKYTPTVGFAPIKFPLDDYNLCVFDLGGAANFRGIWVHY
FT                   YHDCFGIVYVIDSAASDERVAESLKVLHETLQHPYVKGKPLLVLANKKDLPESRGVGVV
FT                   PQGFLEEAMGEPGAPHRVLATCAIEDDPVLVEGIEWLLEAVSKEYDTLAKRVAKDSNEV
FT                   KSEKARQRAARLAAIRGEDR"
FT   CDS_pept        292454..297937
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0830"
FT                   /old_locus_tag="LmjF36_0830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0830"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0830:mRNA"
FT                   /db_xref="GOA:Q4Q1Z3"
FT                   /db_xref="GeneDB:LmjF.36.0830"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z3"
FT                   /protein_id="CAJ09036.1"
FT                   /translation="MNRLRRLFLPVMMRVILRFRRRSRWKDGQPPRQYTPESVVAAIMS
FT                   TKLLLADCPQRMVESLAAGATFMSLTPKEIIVYANESHVSCGIVVLLYGQLEERRPEPG
FT                   GKKSKAGGGGGSTRPICTQPHRLHKAMSVLCLMPVMCEDRATSFLATRESEEADVAIIS
FT                   SRWFWEVTYSMVQASLTTADVMGRTLREVVLPHRRDLLLADYFPTSVVLLRSWMWSMLT
FT                   ASDRVKLSRSMEVRVLSVGDVLFDEGDYCPYIYVVRRGALAAIVKGETLTVLEAGAAVG
FT                   EESVLFHDRRNCRVVAVTVCELYALHAHHLLRRFLKYPESARRIIPAAIERQLWWMEEG
FT                   RTRDVFGLVSILSGVPCLGHTTDAMREEIARCASVLILPQGHTVVSTNTPCTFFCVIGR
FT                   GFVTLISSMKTAAVAETPSSANGIDRRSESQPVRRRFSAVKPMGIPATEMRRESRSAGD
FT                   FFGELCLKPHLWPYDVVCDSTVSLWQFDREAVLRVLERNRADAQALEVCRQGIVLYRTQ
FT                   RGETSIIDGFEPPATPNASANGWRSCVGGQRSRAQSTDFATAPPGARSSSAGSRSGRRL
FT                   SLSHAAAPEWFSRGSPSEGPTPRGGRRAGVDWTPEQWTTYAMTRLQDGLRAEDAKETPP
FT                   APSRELRGVDKEVEKTMNEKVLQLVAVQPETPPNPADCDISGDSSELQSIIVGQLFLIV
FT                   TEKQSRFLRQVNDSNVRLITEDEDTQLVGVLNDSLDDMSGMDALHNSEALVEVTEVMQL
FT                   ENISASPLEGSHFLPQRAMPSLSAHDSTDVTDYINLHRVDDVLTVEASGGALAGWPMPN
FT                   ASIGRTRRSTSVGALGEASGVMGASLNPRTSLSRSHFVRPSSAVPPSPRCASGRDDLVS
FT                   PGAIGAMRPASSSEPRVMPPARTRPTSVDFNQLNNKLSVDRSASMLDRYVKIEDQNYFD
FT                   NFVKVLPLQRDEMWAPDGVNTDSEMGTGSMVLLLLHVCRCDYLSAEVMQRCARPIVKVT
FT                   LGERVLVRTSVMGNCTAPRWPIEHSSFISFVRRGTNIVFSVCDADDESRIVYQASFSTA
FT                   SIHENGGVEQRAMSLSELSVAGSPVNAEMDADAKSAESGARIQRGAKRPRMTMTMLAVT
FT                   ASKYKALRQYLETREKVAEDLPGTPENTKLFLQVMSVEGLKHRIEAAVTAFLYNGAAST
FT                   TVLKTERVIPKTRSPAWPGETSFVIISGEGGILSFDLQHRDAVIGTTEITIDELIFGGV
FT                   GLRRLPLLQAQTGRLVIGHLVVGVLGARLGDSVESRNRDWVTHLAVEKLSLAREGFSIN
FT                   PDPFIVLRSGTGAELMRTPLAFSAFEASWSMSEASCLLQCPRLCGSTVSYQLEVCDSDA
FT                   KEVIGRATILLSDRGLGPDHVHNLSLDPPGRGVVRLRSLCLPVLELPARSAAGKASAAA
FT                   ALCPPFSSQLHLSEPATLLLLHMSGCAGLPGGATVELQIDAIGTLSIDAQRYLRTAVQE
FT                   ATTALQWPLSKASVLLRIPSQGDVDDRAAEAVGLRQWQCHHQCHFAVYDGVVDDVSQIG
FT                   QVAVPLSQLLNTALHTYPLFPRCMDADGGGLDQQPSVGTTTRPRVAAERTLGSLQIFTL
FT                   LGSLDRQASGTAEQGADALLTSMPAVGGNAPPDQLPYYNPESADIAAARPASALPTTVV
FT                   LSVSNICDVLPSASEKYVQLVVRHGATVVLSVERQMGVLSHAEWSPTEASAVVSCGALP
FT                   ADAALVVELVAMDVVEGVNGEEEDGITSSAAGAKAQSTARDKARHRTITNGSASVADLP
FT                   LGHAELPVSRLSSVKAGEVRVVTLMLSRSQCSSSLPDTAGRLPRVAPSMRALEDAQVVW
FT                   PTVSFCIFGNRA"
FT   CDS_pept        302089..304443
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0840"
FT                   /old_locus_tag="LmjF36_0840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0840"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0840:mRNA"
FT                   /db_xref="GOA:Q4Q1Z2"
FT                   /db_xref="GeneDB:LmjF.36.0840"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z2"
FT                   /protein_id="CAJ09037.1"
FT                   /translation="MIYKAYGSPENNSGNTHMYSMYAPPNAYVQGQGGSRTMYGYAGTG
FT                   GHGSGHPFGYHANPSMGVTYEYNGGINVHHNGSAYRVGGGTNGRDRGGDVVSLRNLHGY
FT                   DQQATSDYEVHDNQLKAPVVVTPATVVSTLGSARLFSKPPKPIVYGSRCVVRICDAFQE
FT                   GRCAAGDRCHDIHVRPEYLAETRMEMSSWLFDRECEFRQTMEMDSEKTFSIFVADLKEV
FT                   VEVPINSLVFTKGLYVDPATRAKRARGAGNHAHVHAMMQVPTSCGLYSTDPLQCKWERW
FT                   CNQVHIDHRWMQVKKAEFDQWFIELQNRYFSLAPDDTFTVHDPQLKSSISLPKFSIAGF
FT                   SRGLFQGSMKKLASVCLLFQRGKCTAGSCCNQIHVFPQYLSLAREFAAMEQSPDALPEE
FT                   KQRLRREMELLRGPLMKQEKQETAAMESASLPNVVSSANEGTHSDAMDIKAAAEEDLAS
FT                   CGALFEHVQVDEDVEPVSHLVSANTSLTRRMNASAPDISLSVARHMNSDGSYSFNPYGS
FT                   VTSLPDGSTSFNRFPGTRGSGQPMDGNGSVQYTPGSVQLLSTDTKGMRRLVALVSPESG
FT                   NGAVELHRNGDDMGIGGNAGDGGTATVAHDRAPPFAAGHRSNGGYRAVAHPLGDEGGRY
FT                   DSGTQGEQSCSLHPLDFDASWHFSPTPLLGFDASTTSTHRNGSIRDEDPAMHAHLRLTA
FT                   SNSSYIYPGSSTTSQQNLLSTPMHRGVTSNATTAARVRLAASAASSRTHAHRSATSLPD
FT                   SSTTNPAMGGSVSSMPTARPTFVGEQLTGTR"
FT   CDS_pept        310531..313197
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0850"
FT                   /old_locus_tag="LmjF36_0850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0850"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0850:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z1"
FT                   /protein_id="CAJ09038.1"
FT                   /translation="MWSTAVDVGGREVQVRLSPGVYRAAYSAPPANTDTGTDCASTAAM
FT                   PPKDVTKALSDARSRFHQLRDLRRELSGRPLPNTDGLSAAAGPAVHASSAFSSTLPTAT
FT                   LAQASLPVTCMPSAASFGLPLDRLSADDPVTRSVLRTAAAERALRLQQAENDELKRVVV
FT                   TQQQEAAQMQCLVDRLSSELTEMRRTVLRQTATMKSLAAEMERRDVYHLIKEKHRSQAA
FT                   ASALATANASSGTLPSQSSLTHQQRLAQLEQQVGQLTTQKAELQQQVSHLSSHHGGKQW
FT                   STPAIEDIDKDDDVMGEGSGADGWVSSARVELQRLVQALGAILQAGASPLARIGADSEP
FT                   VYELELSCVTRLASARTRRNPDDDAPAPGKVNSVVCICGPYSVRDVLLRVQLGTENTGS
FT                   LMRRSRRLEGVPQQSPRRCVLYAMRDTCSVVRICLYEGVANTEVKTGERCSTESPAPAA
FT                   TATVAVHTLIATALASGNELETRHAAYSVHTVHLADDKGAPRDTVTFRVRVTEVQHRRY
FT                   SGYRENSCIDSDLDGRRRASPFPSLRTREPGGVRICERSATPLSSADAGSAEGESVTKN
FT                   LQRGQRRGPMLSPSRNDDTTLMKGQRLFAHSSFSSSTAPPAPTDEADSRGTAEDAKGIL
FT                   EHVEPQTKPLPALLTLSEDSKEEVTRAAAAIFGSGSTTSTTFDGTSEPEVKDDSPSAAA
FT                   KTKKLLPLRDAPVPMSSRVAVSSDPPSTVGVHPTPNASDLSWPPPPPVAVVPTPRLSST
FT                   PTTTPPAAAACLMRMHIKEVRSLHEGCDDDLVEDMLEHCSLQVAVRVDGETVFTAPTRR
FT                   NSSHAVWGAEEGSFTRTLTAGQEVRFEVLHDDKARSQAVLPVSEILNASGAKDLTLLSV
FT                   GGGRPCGLLTMFFEGSV"
FT   CDS_pept        315279..316823
FT                   /transl_table=1
FT                   /gene="MKK5"
FT                   /locus_tag="LMJF_36_0860"
FT                   /old_locus_tag="LmjF36_0860"
FT                   /product="putative mitogen-activated protein kinase kinase
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0860"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0860:mRNA"
FT                   /db_xref="GOA:Q4Q1Z0"
FT                   /db_xref="GeneDB:LmjF.36.0860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Z0"
FT                   /protein_id="CAJ09039.1"
FT                   /translation="MSRLKINLDAIERDGASATEGFCADGVRIGSLLVSSEGVRDNQGN
FT                   SCVLSLSDLEVVPETAGGFLGKGSSGSVRRAVHRGSKKMVAVKEIKVTGQTHINEIRRE
FT                   LETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPVLASITRLMLK
FT                   GLTYLHRTRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTVTYMS
FT                   PERLRGEHYSYGADIWSLGLVVAELAVGVCPYAGLRGGSSEARFWALLQHLNGDGAALE
FT                   LPPEMDSDLADFISACVVKSPDRRPTCTELLRHPFIVRHTAAVPEAEARPFAPTTPTVH
FT                   APGELFSPLNSASPAARSAVPRASEGSTLRATSPSPLERHDGETDADVADRTVVARWIH
FT                   AVMVREVLHGARGHGRKDLHQEPLAAVSASTATDSGEGGGAAAVSAVSLEDVQVAQLRE
FT                   FRAERNLDQQSGDGGSAPVEQDCTAGVRSLTCEDLRWTSTGEPSVNLDDELNRLLF"
FT   CDS_pept        320082..322910
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0870"
FT                   /old_locus_tag="LmjF36_0870"
FT                   /product="putative DEAH-box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0870"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0870:mRNA"
FT                   /db_xref="GOA:Q4Q1Y9"
FT                   /db_xref="GeneDB:LmjF.36.0870"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y9"
FT                   /protein_id="CAJ09040.1"
FT                   /translation="MDKEALRRAQQASRAAFLRKEASERQKAANTVVEQKLRDIEQGVV
FT                   PASVAEADFLLHRSAEVNTASELFDVARRRQALGGEGEAFDRWSELAAELPSHPHSSTF
FT                   PIDASQVIEKMRNVHDAGVVSAPASAVVMDATSRPLSSAGYVAMSEAEVAERVAKHAYV
FT                   REKTFAELQEDRAAALQGQKERLQLQRRSLPMYQTREELVKLIRDNRVVIIVGETGSGK
FT                   TTQLLQYLYEEGFHLGPRQRKRLLTTPAGAADSSKVKADADGEGDRAIVDEEQDELRLI
FT                   CTQPRRIAAISVAERVAQEVGCPCGSVVGYKVRFDDKTGPLTRILFVTDGMMLKEFTND
FT                   PDLSSVRAIMVDEAHERSLSTDILLGLLRDVIRRNTNLKVIVASATINAEKFSDFFDKA
FT                   PVFTVSGRTYPVELFYSDEPVADYVTESAQTVLGLHLSKPLPGDILVFLPGQDAIEACA
FT                   ETLQSYMDEAKGQLRPLLILPIYSSLPPKEQARIYERTPPGTRKVVIATNIAETSITID
FT                   GVVYVVDCGLCKQDYYNPQAMVEELRVVPTSQASATQRAGRAGRTQPGECYRLFTAYTF
FT                   HNELPPETIPEILRCSMSAVVLQLKALGIHNLLQFDFLDAPSTASLERALDHLFLLGAM
FT                   KADGRLTVTGRRMAEFPLEPSLSKCLIRACALGCGRHMAMAAAMITLDSIFINTRDAKE
FT                   RQHIKSAREHLFGFGNGDVTGYIRLMEEWLRAGPRAGEFCRANCINARSMLRARDVLDQ
FT                   ILKTFDRIGLDVERVPSKSSSDGKDLDEDDALAKALSAAANQIDVEAVTRALLSGFFFN
FT                   VAKLEADKWSYLVVRPMDTSVPTGARRSESAGAAEASVAEIHPTSFLFGAGRKSNAHRT
FT                   PSITTDAAAGVPPVLRERPGLVVFLQLRRSTKRFMTHVTAIGSAEWVLQSAPVNYFRPE
FT                   ELETGLRKRQRA"
FT   CDS_pept        323430..324365
FT                   /transl_table=1
FT                   /gene="NU1"
FT                   /locus_tag="LMJF_36_0880"
FT                   /old_locus_tag="LmjF36_0880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0880"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0880:mRNA"
FT                   /db_xref="GOA:Q4Q1Y8"
FT                   /db_xref="GeneDB:LmjF.36.0880"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y8"
FT                   /protein_id="CAJ09041.1"
FT                   /translation="MHRAHTYLLCIAAHLLLSPPPPSSPSRFVFASSSLSCPGCAFSWV
FT                   TRFVSSMLRRTLCCGMMQLHALPTPNPLCHTFTIPADSFESFVPQGQSCEVAHRGLAWV
FT                   HPLSQGLFEQYPQELMSVFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISP
FT                   AKEYTLMEDDLELKDTDTEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAM
FT                   LGACKTCPSSQNTLKDGIERVMKHFVPEVTEVIEDKEHQFYEDYGLLFDSEKALFKEAA
FT                   RLDRERQAKLRHNLTPMVLSYEVLNEPDGD"
FT   CDS_pept        325528..326277
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0890"
FT                   /old_locus_tag="LmjF36_0890"
FT                   /product="putative eukaryotic translation initiation factor
FT                   6 (eIF-6)"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0890"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0890:mRNA"
FT                   /db_xref="GOA:Q4Q1Y7"
FT                   /db_xref="GeneDB:LmjF.36.0890"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y7"
FT                   /protein_id="CAJ09042.1"
FT                   /translation="MTLRTRFESSDDIGVFSRLTNAYCLVAAGASQNFYSVFEQELANH
FT                   ICVVYTSIGDARVIGRLTIGNRHGLIVPSITTDQELQHLRNSLPDSVKVQRVEERLSAL
FT                   GNCVVCNDHVALIHTDLSRETEEVIRDTLQVQTFRTSIAENALVGSYAVATNKGCMVHP
FT                   KTPAQDMDEISSLLQVPVVAGTINRGNAAIGSGLVVNDWAAFCGLNTTATEITVVERIF
FT                   QLRRETAGGDEGNLLQNVRETLVDELA"
FT   CDS_pept        329981..332362
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0900"
FT                   /old_locus_tag="LmjF36_0900"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0900"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0900:mRNA"
FT                   /db_xref="GOA:Q4Q1Y6"
FT                   /db_xref="GeneDB:LmjF.36.0900"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y6"
FT                   /protein_id="CAJ09043.1"
FT                   /translation="MADGYHNNPVVPKVGQRFGPYQVGDTIGRGTFAKVKIGYHETTKV
FT                   RVALKIISRKLMDGDARSALKIKREIKIMRVLRHPHITRLYDVVKTKHDIVLVMEYVSG
FT                   GELFDYVTLKGRLEEPTARALFQQLTAAVAYCHRYRVTHRDIKPENIMMERGCHSVKLS
FT                   DFGLSSITHDGRFFETSCGTPNYASPEVVSGRLYGGPEADVWSCGVVLYAMLCGTLPFD
FT                   DSNIALLFKKIQTADYAIPSHVSAQAQDLLHRVLVVNPLERATMEQVMQHPWLRPDFPR
FT                   YLLSLHYAAIVETTRFASTYYLTEDMLDEEVVRVVASRFRVSPQEVASIIMSEEERIPS
FT                   MRAVISDEDNPNSMARRYPAANYFEMYSNVLDSKLWPTPVEIAAAEVALRDQTHDIYVS
FT                   YVILTQKKQNKLTPQEHAANPSFGESANSLLQSQAHQGYGSLNANSLQQLTGNSSFTGL
FT                   SFKETSSRSHAQASSSPASKKSNHHSGKTLQHLSPPLQHIMSSTVPVAPPGDPWQSGYN
FT                   VVTAPFLPLHAKGATSTVLGQILRVQELPVQLLMSRRITVKPVKREASSTMFLSPGLQK
FT                   STPSFDCISDTGAAPTSMSTALQGNLLQPQRSPTTRTCSAAPTLLHLHSKVEVGLSSSC
FT                   SPIPTGRPMRSNGADVRHNLATAGGETALDTLYHAETVTRFGNDFIRNGVAFVNSTSHE
FT                   TLQEVYEAMKEEGLLWKVIYDYYFSVVRYPNIKLQVKVYKTKSDEQLVDVKVSAQSGMA
FT                   AYDVALSLLERLRTRAVNKRNTQIRERNASALKTLTPDTT"
FT   CDS_pept        341252..345940
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0910"
FT                   /old_locus_tag="LmjF36_0910"
FT                   /product="mitogen-activated protein kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0910"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0910:mRNA"
FT                   /db_xref="GOA:Q4Q1Y5"
FT                   /db_xref="GeneDB:LmjF.36.0910"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y5"
FT                   /protein_id="CAJ09044.2"
FT                   /translation="MHSSSSVMQPEPEATQGMELPTCACKPQHPDLEAPASLHAQSKEI
FT                   NPLVLGPPPCTILCTEHERKTRRSSKSCIASSPGQHQRMGDGVGFKVLNLVTGWNLPRR
FT                   SSTHRCFCAADGDVTVEPQPLSLAGASTKCPVHTPASASSPTWGPRDENGVLVVSPDDR
FT                   PEGLVNSRRRYSRESKPAVTGEDGVLLSEYEEDPADAAVRQTLARVRSKNCVLLIVLLV
FT                   IIIVLAVAGGVGVGFVNKHYTTLTHRMYLESGERIVLNSSIMLLRNYHETLRADVRNLL
FT                   SFVRSLMVSRPPESVAMVQNTLYLPFFEAWSTWLFSPSVPSTHSIYVSMCGEPPINTVD
FT                   CPIMALAIVCMPNSPQVTCFYMHSDEVNRSRMTVNRIEVNEFGIPRIGAFYKYEPLKVS
FT                   YLHNQTSNDYGYFLDQGCSGSLPQKVHTTLTIRRQIVMGDLLIICDASSFFERWFQRFE
FT                   RGLQKKKDSHSVLFASDGAVLAYECGAAPRSRELVSPCNTGLVPDNGRDCRVDKTAMMH
FT                   RIVDTFTEAMQRNKLLKRGRQQKSHVALTRRIDDYIVAYQDFLSFRVGDDKLETVFIAA
FT                   YAAPLDTSLGRDGFVQISICVVIIIICMFLLGVVAMVAVNQMMRVVEVISQLSTHAATY
FT                   DTKRMRSVLDRQKPGMLARVITSADIINCEFQHILTNLNAYRPFLPQSLLTKSSYSFSD
FT                   EALERPSSHRIDVALGGNAAGDVVVDKDGAPAKPLPRFHLRNTLEGSVANPVENWRLLQ
FT                   RGFHRTKSTILVVSLSNVALDAGDSVDAVNLFVQTVLNHAAIANGVVEVIEFQKIVVSF
FT                   NSHFPVPRHQEKACLCALAIREGFRDSGCSISIGIASGYNYVGTTGTEQQKARVIMGES
FT                   LVVAQSLTSLKNYLGCSILATDQVVFEALVTAVAVDVVQLYYEHNHQWVQYGVSEIIGN
FT                   RYAVLSPDMQLVKSVFKLVRYRQAEEALEAVRRYMDAAAERHEAPSWPARRIHALVERQ
FT                   QLLIKSGYRRKRLQWQALEGDEIIMSHLSEENQSYNSKRQPRLMATVSTATVDSLVTLS
FT                   THAKATPCEFGFVSGDMLNAGREAELARALVGEQSKLSMSRRQLAPIPSSYFSEDALFP
FT                   VFTVKSSDGDDEERSPVSSMLSSQRDCGTDGNAEASGADSEEMRPVLLVEPQRLRSEGR
FT                   HDVRVDALLPPSTVTTSPFRPAHGMKYPCITPGISSMLSSSRHRSALDRQRQIAPAPLR
FT                   GDTCHASAYATSSALGGGGGGKPSISASLATTSAGNLGRTADSALKQSNENAAGLAKMH
FT                   CSYKLPQRIVSVNGQVFHRTSQLVGRGSFGEVYVAVSETGSLGAMKVFPLNDNNAPQLI
FT                   REVETLSLMRHENIVGYDCCAVQDNFFFIICEYLAAGTLGSLIQKLGVIPERAARKYAC
FT                   DVLFGLGYLHQHSWLHCDIKPENILVTSDGTCKLTDFGAASLGRSLMDAVSVRGTPRFS
FT                   APEAILGTWNQQADIYSFGITVAQMVTGVHSWHKYTEPDHLFVAHYAGEIRHSLQTGMP
FT                   CAMQPDLPTNLQDKELESAIHRCCEFDPARRPTAEELVTLLS"
FT   CDS_pept        348784..350532
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0920"
FT                   /old_locus_tag="LmjF36_0920"
FT                   /product="RNA editing complex protein MP67"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0920"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0920:mRNA"
FT                   /db_xref="GOA:Q4Q1Y4"
FT                   /db_xref="GeneDB:LmjF.36.0920"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y4"
FT                   /protein_id="CAJ09045.1"
FT                   /translation="MVQEWWVSAAQEAVISRKATSRAERIVTEADDPRSGTSHFYDSDA
FT                   RLCLVCNARLEGSYSAHSHSVDHKPRVALLKRTIGMILTFLEQAGSSPSLPPPPESDSP
FT                   YSLPGSKRFLVSVSTHTGTPAAPAPSCFHALYAESPLFAEDGVPSRALLYHRPCTLREF
FT                   DLVDVIMRRWWNTLHNPPPRRGSISFDRLLSLSSAELQMRRWRVRYLLHFLKSRGVLRS
FT                   CLTLRSDQVNAAPSPNERIHRGEAFERLEMVGDFFFKSLTPDRMHTVFPADEGGLTAEL
FT                   QCFERALDSNHGLLAIYDYLGLDDIVGCFLANNKAKADVVEAVIGELKVLLWSTEVVWG
FT                   MEYYAVPGERATHVYLRALVAHTIAELGHTVLMWQLESTLRNCRDFLLKHTVEEYLGAE
FT                   KGNERRASRGGDGCDVPADLPKYSPLPPLLAWNRRRLGVSMRRGEVPLASKQSRSSIPP
FT                   SPQDPLRRLAPTASCIPEAIRDHYAVGRKKWSSYACKTAIQALCASLTQTALQHDSGHT
FT                   ADALSLNSSSASLPLSPEPQPSPTTPAYACVPRSVLRALVTANCVVIRNSAPPLARSTS
FT                   TRRVAG"
FT   CDS_pept        355499..356155
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0930"
FT                   /old_locus_tag="LmjF36_0930"
FT                   /product="putative 40S ribosomal protein S18"
FT                   /db_xref="GOA:Q4Q1Y3"
FT                   /db_xref="GeneDB:LmjF.36.0930"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y3"
FT                   /protein_id="CAJ09046.1"
FT                   /translation="MFTKVFPPCSPRFSFLQNATVCDNFAHPQLHLPPCPLPLHTTRDA
FT                   VLFSALPCNPPPKPLAEYPRMSLTLIPDHFQHIVRLLNTNVEGKRKVPFALRMVKGVGI
FT                   RFAYLVCKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGKTEH
FT                   LSSSMVDTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK"
FT   CDS_pept        357155..357616
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0940"
FT                   /old_locus_tag="LmjF36_0940"
FT                   /product="putative 40S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0930"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0940"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0930:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0940:mRNA"
FT                   /db_xref="GOA:Q4Q1Y2"
FT                   /db_xref="GeneDB:LmjF.36.0940"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y2"
FT                   /protein_id="CAJ09047.1"
FT                   /translation="MSLTLIPDHFQHIVRLLNTNVEGKRKVPFALRMVKGVGIRFAYLV
FT                   CKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGKTEHLSSSMV
FT                   DTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK"
FT   CDS_pept        359363..371881
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0950"
FT                   /old_locus_tag="LmjF36_0950"
FT                   /product="putative dynein heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0950"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0950:mRNA"
FT                   /db_xref="GOA:Q4Q1Y1"
FT                   /db_xref="GeneDB:LmjF.36.0950"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR024317"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026975"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR035706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y1"
FT                   /protein_id="CAJ09048.1"
FT                   /translation="MAANLSVRGEVPRAELLQRKRQRIDTGPALSELLIARGMHAGAAN
FT                   DLEGIAEGGGAGIAPCAEAGDYATWLPVEAFDDAFRFEELSPGDWAARVAAAPSGLPCL
FT                   FWKLDHRQHQRGGIWASGRVVEVDADKQLYHVLPDDGRDLRSSQKQKADLNGSAEDTRP
FT                   LVLPRVFVCFAAEDPVNFADRFAAAHKRRTIAEAALRTELYVDSIPLDEYAALDPLVIR
FT                   RVLDAAVSTPALVESESNLNVAGVLEEVRAGYSRVMNADLFHSITQGGGLSQLMGPSAT
FT                   SSTMLSASPLFVSDTARPVPLYGVPSHQAERFAATVAAFRQQCFWNTSPVLAALTRAVC
FT                   QADDALLSGCVFVLYSTTKMKRPLSLMELEEIETTAMRDSFLHARDHWLTPTADMVKRT
FT                   LSTFPSTDPVHLHHYDVNTYTGCSTERYLRQIQLHMQDTLQHYLISSLEALIRFFEHAG
FT                   DNHVTVHGMAEVEVTRGAHPAPRTPFGADERITAGFLVPPPHPLPPLLSVVLLCTKHVS
FT                   DAGAKPAQGASETPATEVQAPKPSAGDVPKEDESSEKAEKPSAACLSYSCSVESIRVSL
FT                   QGLLKRCLTQHRTLRTVERVLFDFLYDPATAFLNVPSESSMLMESWMQRIDVILDRVAV
FT                   AMKSYRETYAPFTAVIELDLNAYMATFDERFPSMRGVEAEVQRFLTLQLQVLDGIPVAA
FT                   DLGFVRVDCSELRRELSKKCAMGAAKVLDVMAARALRKEIEVNDRYSELYATLLKLTET
FT                   PEEVVAAKDFIKTIPERVVDLETAIEESKEIHELLKSFKRPLSEEEFNKKWKAIGWPSQ
FT                   LDNAVTERVEELEETKRRLLASMNRAQDLFEQEVERVQKIVEHYGQHRNAHRMTEIAED
FT                   VVRVQEKIRQLRSQASTFNTHESLFNMEQTDYSAVHQLATDFEPYEALWITSASWSAAL
FT                   EKWHELPFMSIDADEVERIVTDTLRIMNTCVRNPQLRPELVQVAERTRENVQQFRPLVP
FT                   TIKYLRMEGMQERHWSQLSKELGQAVEPAVTLQSLDDVVRMNLTQQNDVLMRISEIASR
FT                   EYHIETSLAKMKAGWADMRMSVTAYKETGCSVISKDVVDQMQEKLDDQMLLTQSLSFSP
FT                   FKQLFEDEIANWEASLKLVQDVLDEWLRCQKSWLYLEPIFQSEDISRQLPGEHKRFQVV
FT                   NKNWKFLTNKAQEVDLTLEFCTTTERCLELLKENNDTLEVVERGLNQYLENKRASFARF
FT                   YFLSDDELLAILSEARDPQKIQPQFRKLFENIARLDMRNADNEMFGMYSQMEEYIPFAQ
FT                   SVLPRKYVENWLTEVEHMMKISIRLQLEAGVKNAAAMKRQAFVLQSPGQVAIAVSQIMW
FT                   THECEMSLKEQGSLSPYMETAQRNLMVLVETVRLPLTNLQRMNLSGLITIEVHARDIVE
FT                   QLAKAGVDSVYAFEWVSQLRSYWENNDCVLRQVEAQFRYGGEYLGNTTRLVITPLTDRI
FT                   YLTLTGAMHMFLGGAPAGPAGTGKTETVKDLAKAVAKQCVVFNCQEGMTYASMAKFFKG
FT                   LAQAGAWACFDEFNRIDVEVLSVVAQQVSSLQEAARTRQFRIPFEGTEIVVDPSYSVFI
FT                   TMNPGYAGRTELPDNLKVLFRPVACMVPDYAMIAEIRLFSFGYSDSRKLAQKMVATFRL
FT                   SSEQLSSQDHYDFGMRAVNTVISAAGLMKREHPDEAEDVLLLRALRDSNAPKFLEEDLL
FT                   LFDGITSDLFPGVQLTPTGYGDFLAALETKASSMRLQPTEMFVKKCVQLYEMSVLRHGQ
FT                   MAVGPTMGGKTSATRVLQAAMTHLRKELKNTRFAEVKTYCLNPKSIMMAQLYGGFDEAT
FT                   GEWRDGIIGEVFRIAARDTTDARQWIIFDGPVDALWIESMNTVLDDNKKLCLISGEIIA
FT                   MTPYMNCWFEVEDLAVASPATVSRAGMIYLEPNTCIGVRNFILSWQQYRLPVTMDPYKE
FT                   YLQELCEQLFPSLIHFVQTEVTEYSPSSWPNLLVSCFNLLDCFMSPYTPTRTYEVPQDK
FT                   LDLLREIHLHLLIFSIVWSFGATGDRLSRQRFDKFLRDELRLRNVNIELPVIGCLQDYQ
FT                   FIPEERRWIAWAERLPPFTTQVTQSNFSDIIVLTADVAQYKYVNRILLEHSYHTLCCGP
FT                   TGTGKTVLMRQLLMHDMPKECTPIFFTFSARTSANETQNLIFSKFEVRKRASPQVWGAP
FT                   LNRKFIILVDDMNMPLKEQYGAQPPIELLRQFMDYKGWYDRRTREFFSIVDVVLAGTMG
FT                   PPGGGRHFITQRFLRHFHQIAFPEIEDDSMSCIFLSLLESYFSLFAEDVRGKLSAIVMA
FT                   SIEVFNAAVKELKPTPARPHYLFNLRDLAKVMDGLTNATPTTVKTVPALVRLWLHEEMR
FT                   TFQDRLTNDADRAWFQELLGKQLHKHLKLSVNNVTQRHRGDGGAAADSTNPQTLAADMN
FT                   ALMFVDFMGGNSEQRIYQEAPDFEAVVKTLEQQLRDYNQQCVGGRQLDLVMFADAAQHV
FT                   CRIARVLRKPNGHALLLGVGGSGRQSLSRLAAHLNEYELFQVEIAKGYTMNAWREDLKA
FT                   VLQRVALQKKQVLFLFADTQIVHEAMLEDVNNLLNSGEVPNLFVGQELDDLLSSMRHVC
FT                   VAEGLPVDKVTIFARFVRSCRSQLHISLCMSPLGEVFRSRLRMFPALVNCCTVDWFSAW
FT                   PQQALRSVARNYFAMVPLLAQQATAVEACTEVCVRVHVSVDAASVRFLAETQRHNYVTP
FT                   TSFLELLHTFRALMETQTEKNQTTKDRFINGLAKLRETEDAVAELQQTLSQSQPVLLEK
FT                   NESIKALVAEMELQTTEAEKTKKEAQKEREAVATMQAECAAIEGAAQEQLAEALPELDR
FT                   ALESLKNLKSSQITEVAGYKAPTAGVVMTMQGICILFQIKPQMRAAGLMEKKADFWATA
FT                   KEQLLNNPNLLLQRLIQYDKENIPEKLIQAVMPLVTSDDFTPKKIAGASQACAAMCQWT
FT                   HAMVRFHEVNKKVAPLRQELAVAQQANQKAQQKLKEAETQLSDVAERLADMQRRKEEAE
FT                   RELEELGQTVKRTALRLERAAMLIDGLAGEKRSWMQSLERIDESAQYLMGDMLVAAGQI
FT                   AYCGPFTSVYREELLELWGKELDQRSILHRAQYSIYHTLQDAVETREWILNGLPMDTLS
FT                   IENALFAKSARRWPLLIDPQTQGNRWIRRTYKDSLEVVRPSQKDLIKRIEYCIRAGRPV
FT                   LLENIGEDIDASLNPLLERRTFMEGGTEMLRISDTPIPWNPKFKFFMTTKLPNPHYIPE
FT                   VMVRVTLLNFFITPRGLEDQLLGVVVGQERRELEMRRSDLIQKNAAMKADLVNTQESIL
FT                   CKLKEVQGDVLDDVELIAYLNESKEKTLEITTRVDEAEAAEVELTASREEYRPIAHHSS
FT                   CLYFCCSTLSNVDPMYQYSLQWFVQLFIASIEQARRADDVAQRLENLKEYFTYSFYQNV
FT                   SRSLFEKHKLMFSVYLCVRLMDQRGQVDAAEFRFLLQGPTLVADAKDNPDPSWITPATW
FT                   NEWCYLDQNFAPFKGLKAHLCAHLPHYKELFISSAAHRQPMSADWADKLTPMQHLMFLR
FT                   CVRPDKLMERLQDFVLAEMGEKFIRPPPFDLLTSFKDSGPAVPLIFILSQGADPYDDWK
FT                   RFADAQNMSKKLYDVSLGQGQGPRAERMVQEGMESGSWVLLQNCHLATSWMPTLERLVE
FT                   AITPNTHPSFRLWLTSMPNAHFPVAVLQNGVKMTNEPPKGLQANVSRSIGAYSGEFLES
FT                   CQKSVELKKLFFSMCFFHALLQERRKFGPLGWNIAYEFTSGDLSCCAAQIKMFLDKYAE
FT                   VPYTVIRELSGNIHYGGRVTDEWDRRTLNTLLERFVTPDVMSDGYLFCPRLQEYQSIPV
FT                   TNRQGYLDYVASWPLNTNPETFGLHENADITCARTETFETLQAIVLLHGDEARRGDGVP
FT                   SSSAAASTPDDMVKTFAEAIHRKVAAPFDVDQFRRKYPTKYEDSMNTVLVQEAIRFNRL
FT                   VTLLHQTLEQLPMAISGEVVMSKELEEVYLALYNNQVPALWSDKAYPSLKSLGAWVDDL
FT                   VRRLAMVQSWYAHGHPKAYWISGFFFPQAFLTSVLQNYARTMHISIDTISYEFEWMSTD
FT                   PASVATPPEVGCYIHGMFIEGARFDPATLTLAESLPKVLYEQAPLLWLKPVINRVPPAS
FT                   GIYECPLYKTVRRAGTLSTTGHSTNYVLAVEIRTPPRADPKHWIRRGVALVCALSV"
FT   CDS_pept        375357..377912
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0960"
FT                   /old_locus_tag="LmjF36_0960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0960"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0960:mRNA"
FT                   /db_xref="GOA:Q4Q1Y0"
FT                   /db_xref="GeneDB:LmjF.36.0960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Y0"
FT                   /protein_id="CAJ09049.1"
FT                   /translation="MFVHCNQHHDTCSLLLLPTPPPTEPLPMIGCRKLQCRGSWKQAFC
FT                   SLPVKATAGMTYLCALAAVLACFSTVSAMLYICILGLDDVYSVQNSQNVYYSNESLAVA
FT                   SGALGDTANTAESPTLLFPQLRASVGLHTVCLGYNCFLRSRLSGVSALVANAAQGTTRR
FT                   RLPRELAAAYEEATYQYIFGFDIGAHCGTPRTKIQSLSTFGVAASALSLVLLFGLLAVS
FT                   MGLCFVAGTTDFLASDTTADGDFHLTNVDALDVPASYGMRQIHRHLRMKTPLLLSAGIL
FT                   SFFVLCTSACTMGVTVALNRSKSKCGQSVCGAFKQGMEHFYELADSLHVNVSTPRTYSC
FT                   QPGTSYILVFVTFCSSAVCLTMSSAIFFCYRHSRHHEQMLEMRDQLRRITEVQGLAGGR
FT                   SVARAESRRGTALASKSSLIVSVSSRSQAYSDMHHSDFCADGELARRRYFGNPVEGAQR
FT                   RSRSVGAGIEQYRLLKQFMAEEEHCRRYIKVMESGHFQVFLVLRETVWLTEKLCRLHKF
FT                   TLNCFVGPALEICVRETQCRQQLIREHDAGVTEVLASLREDARVASSQPRQPRVGGAVL
FT                   QEQERAVWDERVRRWQQVRADMSRSFQRTASHAAAEAPLRRRPSSPAHLRTASCAGPNM
FT                   VEWFQKLEQLDATSVDELFLAGSLAELPPRRNGRHQEACTSTSFSSPTRTRAGLLFSGG
FT                   DSFAACDVARPNVCTDGASATGTAEPHDPPYEQQGRLNEGLSERPDKLSRQSDVSDARL
FT                   ECSGSACAKVAEKGKQNKSFELLTSPSATFTYSLRGSVSLAPSPTHAASESQSLRPAVS
FT                   MSNSSSKVDLINVAGGGIRLQTVSHRTDNASAAAEWHKV"
FT   CDS_pept        381549..382235
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0970"
FT                   /old_locus_tag="LmjF36_0970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0970"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0970:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.0970"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X9"
FT                   /protein_id="CAJ09050.1"
FT                   /translation="MCAPTPTITQNTHRGAYTGALLFLVPSKAKMSSKSIDVFNVSQNR
FT                   LRAASFQDEEERQNAEYAERHNLQALFSEFAAQLREKDPKTEHEAERVLLDLLSHRKAE
FT                   RDRAALRLHFVTSFEVNLDNGRKILKLTSGSETSTLHIVQKTRSVAVDETFTVSLEEAE
FT                   ELTEMFYELGRFVVESGKGELNGFISIDDRDVFLLAGGKDCSDIGDELFNMTFLMKASS
FT                   KSRGTE"
FT   CDS_pept        383234..383740
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0980"
FT                   /old_locus_tag="LmjF36_0980"
FT                   /product="putative 40S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0980"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.0990"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0980:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.0990:mRNA"
FT                   /db_xref="GOA:Q4Q1X7"
FT                   /db_xref="GeneDB:LmjF.36.0980"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X7"
FT                   /protein_id="CAJ09051.1"
FT                   /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTVP
FT                   CIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVN
FT                   FEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERMNYRAAAATSDGEAAP
FT                   APAAE"
FT   CDS_pept        384425..384931
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_0990"
FT                   /old_locus_tag="LmjF36_0990"
FT                   /product="putative 40S ribosomal protein S10"
FT                   /db_xref="GOA:Q4Q1X7"
FT                   /db_xref="GeneDB:LmjF.36.0990"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X7"
FT                   /protein_id="CAJ09052.1"
FT                   /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTVP
FT                   CIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVN
FT                   FEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERMNYRAAAATSDGEAAP
FT                   APAAE"
FT   CDS_pept        385855..389745
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1000"
FT                   /old_locus_tag="LmjF36_1000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1000"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1000:mRNA"
FT                   /db_xref="GOA:Q4Q1X6"
FT                   /db_xref="GeneDB:LmjF.36.1000"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039857"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X6"
FT                   /protein_id="CAJ09053.1"
FT                   /translation="MRTSVRWSETADAVKGIRPPINSLCYSPSGDYVVAACGVRVLVYA
FT                   ASTGTLLHSLKGHQNTIYCVDYASDGKCFASGGADRTVIVWSNKGEGVVKYQHKESIQA
FT                   LAHNPSSSHLASVSSTDWGIWSPDKPKVSKYSLPSKGLCAAWTPSGKTLAIGLLNGTIM
FT                   LMDKNGDETVLICRPAPVWTLAFTPLREKGIDVLAVGSWDQRLSFYNLSGTPVGREREL
FT                   DFDPCSLSYFNDGEYILLSGSDHKVTLFTNDGNRLIEVAGAGDWIWSARQRPRHKQLCY
FT                   GTNDGTISCIDIAITTVHAIHDDQYVCRKDMTNLVVHQLLLDRKMVIPCNEYVHKIATF
FT                   LDRLAVQLQERVIVFEFFYDDERNMRYQDIAQIRRRLECSLLCVTTRAIVVCNDRRITM
FT                   YDFQGSKRREWSMGSAVQFMKVAGGMEGREILLVGLKGGQVMKVFVDNPFPTLLHKGSA
FT                   PVKSADFSSSRSRLAVIDSTNTLQVLRLGEKNELLFSEDNVTAVAFNVDLEDSIAFTTG
FT                   DNMLHIKTGSLPAYQQAVRGLVVGFKANRVFNLHYSNVMVLDVPHAHALYKYVEMRDLD
FT                   LAYNVACLGVADADWKMLGLHAMSQLRLDIARKAFTHIQDVKLVELLKSLELRRRQSRV
FT                   EDGVSPTARNGSATSATVAAATDKGDVGPGGESAEARAAAKDSVLYGSILAFQGKYHDA
FT                   ARQFMKAGCELKAVEMYCDLKMWDNAKKICTNEKVLKDLIRQQARWAEDSQNFIEAASL
FT                   YESCGDYAKAIGMMGQAGQVKKLMKMCRSLPKSEVTLITECANFFRKHNAIPFAIEAYE
FT                   KVQDHQALIGIYVARADWRNAFTILEKAPTLAREVYVPWASWLAENDKFDEALEAFRAA
FT                   KWPKEAMRLMETLATNSVTCRKFRDAAFYYIHLAEEYGRFEDGETPTDVEKAARIRRGK
FT                   ECVRRADIYYAFSSVYAHTTQPLPYNELSLFRAAKYLFGMCAECAIPMNVGKGAILYTL
FT                   SRIANRLEMVRTARAVFEKLQGVILPVSMMEQVDIETLIVRSKPVKDREELLDRCFRCN
FT                   QLLAQLPMAGDRCPNCFHQCVRSFVNFECLPLVEFILADDLADEEAERIIVSGVGRRKS
FT                   ADDEHNNGQRDAADAKALPKAKEWQSDSGANVISFDDGNIDYEIDQQLVAMGRSKAAAN
FT                   KGNDPFFTQLQYVLRPGRPTAVYQPFVASADILKGFRRDEVFIVRPRYGTLPVPNRYYR
FT                   LMRSDVNVCLCNGCQHFFIAEDYEAECTKGSGCPLCRYRPGKQVSRSMKQILFDMEAAA
FT                   AVATTSSSPAAL"
FT   CDS_pept        390983..395917
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1010"
FT                   /old_locus_tag="LmjF36_1010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1010"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1010:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1010"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X5"
FT                   /protein_id="CAJ09054.1"
FT                   /translation="MARRGHASQPRRCWLGPLLIFFILLVSAKGVRLEKGTFLMDEDVE
FT                   WPWLPQLDLPLPPDFMSGQRILSAPEQWMVLAHVGAPLRVVTDTKMDLMRVLEVVKFMR
FT                   PADAGVCPSYRTTRRIVHYWFHPEQLSLLFGEERWSALQRLQRPAAWSLVLKDDAGPAV
FT                   RAAEHFIAKLQALDPPGQITLISRRQGSRLTTTHVSLADFKVLSRVTRRTSTIEYRLTH
FT                   LTVDAEAPLHRRQTQRLLRAKLQYHEHIKAFDEAVAEAQRDLHASLRELLESEQAAYTD
FT                   HMHFKRSYQHFLVERQSRLWAKNEVKDAADEADGRPSMGRNAGSRQTAAMCIHPAAGTS
FT                   LASPLDDGRDVSCRKVLAAWSTLRATGVCREAEMRVAQLRRLHSRHRCKEPLPELPVAS
FT                   STARGEAGLSQAAAHVWRDGVAEMKAQRRKSGASPTPAQVFAILYGVWEEEKAATQAAG
FT                   HAQEATSAAGAAATAVAVNEDFNASAFAAFVEHLVQSGDALTAAPNSRLPRWIRAELHY
FT                   TLALLQLIRPKTRPPEKHPATASSSVRAVVHLHESLSAGSHHAAGALATLREHGIFARQ
FT                   QSKAAMMLLVQSMEQAPTHLWRELLLRRSPCRSLEAASAASSRADPSRLLRFEQFYAVD
FT                   HTFSEVDDPFMTRQSIATLVAVTNENIYTGDEEPELEDVYREAEVGRGDDEYEGRLTAR
FT                   LNRRLLKANMLFSGFKGVQRDAREAQCELLVILRRLGYVCDLDLRRFFSTDAPPHVPDS
FT                   PPASSAAPMTILGVPLPDSCPEHESELADVMNNGRHTLLSCPGGAPFPPRRSRRQLDVP
FT                   NSEALFRLLQQTLLALSYVQLIHRQRYDISHLYASLALEMSLRVPRATVKRCAQAANMS
FT                   AFDEAHHHPGGRNGSWARLFVEAVNRVADSDSEVAWAAEVLLDQLQSIKHAPSRARGDG
FT                   AALGRSVQRVLRRFASVADPPFVSTESLLLLGTSRWAARGPLSGAAAEVAAFEKDLAEW
FT                   TMEPFGLFHRLLQKHPRSSTVAATQPTPHPSRSAAVPGSSIGVSLSTTVMDVHALFLVC
FT                   LAAMKRWKSDFPLVHTLDATTYSARRTDPFVLSSFLLRARDTVTGAPLISIKKLRDVAY
FT                   AASPHFLGESPHLLPLVDDTVDSYAARLLRFAARHIHALEPSVELLRSGGYGIRRTDAG
FT                   GAASAGMTMSGHWGSSLDDGPPRKSRLQTLRKVKQHTMENADLQPLLYAADVHDYMNKS
FT                   RWTSVATVLSAVYNTVVHHFTATASEGLIADMEAQMQLVTPEERGAELSSRRQASIKES
FT                   RSKETAEGTARSAGTGVSAFVDAFAKDAALREFFIAGQLLTVALESGMPEGFSLVFLEA
FT                   ANRGNRHLRPIADHLAESVFGRMAPSVWTEHHLTAQWQREEEELVGEGPLFALDTRTPF
FT                   RYASVEARQELFARVSRWNAAKAQQGDSGDVGVSRERQGTRVSQALDQLLWCAGFLTRR
FT                   VYKDTHRVYPYAYEGSVFPASDLECVADMNHLLRAQRPAAETAASVVIEGAPTWTLTEW
FT                   RHAQLNGTALLRDLSERLGYVYDTVEMAPARRFPLSTADFSGSATVEEHALLLAERNQD
FT                   YPSRFARVSTQLVEPWNRLSKDYSEQVVGYGEGFYYNQRLHRISGYRWGAILHMWWLRV
FT                   RNMWPW"
FT   CDS_pept        396996..398636
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1020"
FT                   /old_locus_tag="LmjF36_1020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1020"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1020:mRNA"
FT                   /db_xref="GOA:Q4Q1X4"
FT                   /db_xref="GeneDB:LmjF.36.1020"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X4"
FT                   /protein_id="CAJ09055.1"
FT                   /translation="MLARFVCVFAIVAAFGLLSPVSADTAHPHHSRSHTVTIESGTLPE
FT                   AKAFAPLRLGAGEWVYNFNPGEEALFFEPEDAGNRQWQQWKADLRLLQASQEKQRLRNY
FT                   PAGGEKTDTPDRPANTERQEPGALPIAEYFSDRNVQRRYTERLKEQSLHNVSDAQGAAD
FT                   ALVLVEGEIAAMWHLVRLAGSSDSLNDQQFLGLVERHFSHTIANASAAAADATSSSFPF
FT                   ALLRVPLVLEAEVLPFMEREVAHVRELWKSRRAGAATPAVSSVAAESQLQLLSSAVENS
FT                   KTVGAEVAALAEPLADAAISWVASTLATTREAIVANDESTEAKRSELKQLLKMQSRLRK
FT                   VRPILEKHSKVYQSVLQRGQLPNAEATLFALQLIVKQRLGNDVSGLVEAVPLLSTTAPL
FT                   TGLLEQEWRAHVLAPYGMCVLVTAAFVWVCEDIKERFMTRVRARRLCMPLGMPALASGC
FT                   TRQILMLVSLLELVVPPLLPVIALAVHLRGARVWVWGMIALMRPSQRAVCLASVSFLMF
FT                   SAHLVATMVQRVFQIIHPSVYRRRLAKKK"
FT   CDS_pept        400068..405086
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1030"
FT                   /old_locus_tag="LmjF36_1030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1030:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X3"
FT                   /protein_id="CAJ09056.1"
FT                   /translation="MRSLRFRAVASLHPSQRASAHHDTASSTHCAWRCLSTATENSQEN
FT                   AAKGCTPPPLEQAFASPLPGPVAAHSVLRSPVDSAILCSRLSQRQMRQRQRKWGALWRY
FT                   RWESHSPRAVPTPLLVTSASISGSPRTSVCALRTDVSEDTDAKTVSSDAERGALVSTSS
FT                   PSHSRSLSMPPAECEAKEGTRPSAHRGTAGAATVDSVALSSTRNAAAGASSVEDPLLSF
FT                   LDSHEEDAALLLAMWTSLHRSCVFGSALSESLALQVRYFLHSLLRHRAIAAAVNFYYRL
FT                   MGIGVQLRDSDLLLLFSSLTYESAASTEEAQLRKAAETAAMENDRKMWTQRRRQFRESA
FT                   ARTRTGDAPGQNLRTRGGEGRDKVCAGQMGVMNAVAERTGAPAFCEEGPTRVNATATES
FT                   VQDTASHTRIARATHIAEGGSVAVSSASRWDRGEACDDVHPPRSIARRVAFHQQPEWVK
FT                   RWILYEASMGTLDDLDEVEDASPPSTPSTSSSADALFSASDVQADTAAQSEQAMRGMEV
FT                   ATIVEHLHLLTLGAMQRDHLSATEASIPQPSPRRPQRCTSKLSRSRSAEQAYWTEALDL
FT                   VRSAYAAAPRHMALSECDGTSSPRPAEGLLLPTGVVFALQSMLREVQSWEGTLSLLRLS
FT                   APEAKHRDAAPPRALAMSPDCFLRGAVLFMALAAPAQPWKTQAKVEAWMHRVMLPRLAR
FT                   DARAPTQAASTVTAATAALHALWLSHLCSVKASRPDEFVALSDEAAAYLTSPSVQRAIH
FT                   GDLALMMEEVCVNAERAVDALHQTVQRAVQHCRASEVLAKSIRSGAYRVENGKGKHELS
FT                   RDPESDHMTDPLSMTSVAAPATVVDEMRCSLFSEYATKSPLSPSALPSSDLADTFALCC
FT                   AAVKETVWLRFTTAASTSPAAVAVEVLQFVEQSVHGPTGLLNTFQLLYGSPASRMARNG
FT                   KGATLTPTVNTPAAPECAYVSCVLAITLLQLVQLLCAPPGQQQRRFGCQVWSGAELVLL
FT                   VELAAKVLEGIAAAQVQQAPWRWAVEKRLKELATVTARTVRLVVRHLDIHRMNEKVMFG
FT                   AVADQDVELFALLARMLNTSSELMVASRGSDASRASSHSPVWRILTATCSPRVLQGVHL
FT                   CFRSSSALGKRVRYRLCRRDADSLDHWIPPPRSHQRTSARLRGARGATLSSSKGSMKAI
FT                   AASGASAGGRDTGRDFPLMLSLRESVYKIMSRERTSAGVGQALQRLAASTANWKASLLL
FT                   CELVTKDVSLARGTCTVDFFATTLDRMAQDVARSSAAARAEARASRLQGGGLVPSRKSC
FT                   RTLAAPRALGPPNLWLSAIDVFWSAVDHVGRVEAAAEQHSDSSALATSARTPPSKPVSV
FT                   DAQERAVLARLLLPLLRFSRAVQKLEVGRQWRRTWAAMYAMQEKKDPQWRRLNIEALSV
FT                   LGDAAALTHCVADYHICGSEALLCSVAVRHGDWHAALQTVLQTSGAVEERHATVTTYSL
FT                   VVARTILTLLTKSPMNLSNTAMRLRTVQRETWDEECSLAVVRLLLRGRRWRLAITHVDE
FT                   ALGLPDMQRVRALVLVNPAGRLGQGASSTAPTAATLVRYAQLLTAALQATAIGGDSERA
FT                   PVYYDAFKALVRYVFGEVVDMDTLHTAEDTSQSGNDALDAALDMTHFTERDEKHASGSE
FT                   DQVHEAVRELAPRARILFFRAMTKKMLGTHAGRG"
FT   CDS_pept        406528..407388
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1040"
FT                   /old_locus_tag="LmjF36_1040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1040:mRNA"
FT                   /db_xref="GOA:Q4Q1X2"
FT                   /db_xref="GeneDB:LmjF.36.1040"
FT                   /db_xref="InterPro:IPR032727"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X2"
FT                   /protein_id="CAJ09057.1"
FT                   /translation="MAQCLTWQVLDQRQTGECLDAVDLEALRAVIKRIDDDRDGALLHS
FT                   SERTATQVNVLLDLYGHLVLFAKASQFSPFKTSTLFGIVHRVHEASIADRLSRFHSYDL
FT                   LRELVVRHSVHRPPYSTMVFSVREVQDIDTYMMSTYYRHYKMYVYCFVPREVASLRTVM
FT                   LNDTAEAPPAQLPPLSAAIREDAWKEKMQEKVRTLEEAEMEEQLIVSDAVSEAQKNAAT
FT                   LDNSRFMAGISAQLEAIRDAVSTKSSERLDLIEEKLTAIEAKVNEAQSSGNRSRQGSRG
FT                   SSKRK"
FT   CDS_pept        408600..410363
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1050"
FT                   /old_locus_tag="LmjF36_1050"
FT                   /product="RNA editing complex protein MP61"
FT                   /db_xref="GOA:Q6T449"
FT                   /db_xref="GeneDB:LmjF.36.1050"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q6T449"
FT                   /protein_id="CAJ09058.1"
FT                   /translation="MNRCGVKRRLSLRLPVVSIAGLRRRARRAAGTRSGSVALCVSAAS
FT                   IGSSTSLASTPGRKAPVYYNFATPVSVLRDAAGSESVSHRRPRREAPAREGGLLLVAPR
FT                   TPNPNDPLQRLNIFRREFSDFSSAAKLNPNIMVSVDTSTRRFLEMFCDFDAKRCKLCNE
FT                   TFLQWHIHANGIPHAGREGMLLELVRPYCGTPDELIEMWWQRLNSCAAFHRIPGLSHDN
FT                   PHERKRRLLYLLKVLKDRGILVETFNVSDNQSTNSARSWEFERLEFVGDNVVKYVLNNI
FT                   ISCAFPPHEGGTKGKMTCFQFVMDGNDGLARGYDHLDLQQLASSPRVVSKFKSDIVETL
FT                   FAELQMYLWSTQHDIGTCPLVFPFTKDIYTLRALVQHVLYELGIELFLYHIRHINGMLQ
FT                   RVMRENHLQFVKADSALKPRAGARTGSLGVSTRRGDWSDDDDDYDCPQSYGTPAVSAPT
FT                   AALMKVRSQRTHVQGTGAALFFASTNYDNFKRVVPIGGLLPRPFARQDLSVIPNHMPHL
FT                   RSDGAMTRRMRRVGNAGWSTLHATATALTTLESVADGLALSAETTPRVGSEPVRLSVPR
FT                   LKDEELIPELI"
FT   CDS_pept        411601..414630
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1060"
FT                   /old_locus_tag="LmjF36_1060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1060:mRNA"
FT                   /db_xref="GOA:Q4Q1X0"
FT                   /db_xref="GeneDB:LmjF.36.1060"
FT                   /db_xref="InterPro:IPR028941"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1X0"
FT                   /protein_id="CAJ09059.1"
FT                   /translation="MITARSPYQVYKAADVNGTVAVFNSLPSEELLPYKILSSEETLVA
FT                   SLSVVEGNEEQRERYAVSTLHAARVYISHLISYIPLSTRSQTAKKVQINIDAVVRTVML
FT                   FAANAESLQSVKNMALTNASGEQVSLKDLSDLEGALNAMEKVYRQKAKGAGEKVDMLRK
FT                   VAPEPVIVSSSPEKSQGTASLRAGEDSGDAASNSTGCSRQLRRRSESTDGPAAHADLHG
FT                   DAAALKVAKIEGDTDNAPLAAVFAPKMPGGPKSTRTGGRGGLVCGRLRGLTNSEKKVVA
FT                   MLHAMIQVLGHIFATKFNDLVPIFDLLDERLRAVQAIVDAERAQYKAKEDKRIPEPFHE
FT                   VPLDAVQLALQHSSDTFRNDEECRYELDEDLLHPIAHACLRVINHIEGFSTEPFKGPTP
FT                   EEVLKKQQLRDAARAKREEAKRRILEKAEAKAELERKKEEERQLMRRRLGDGSDEHEKD
FT                   LEEDTTLVNPSTLGYVAYAAELPLGTPELFEKALYTWSMLSSVPRALNLSQMHFAAFVK
FT                   GIECVDQDANGLMEEVTKCLLDVSMASLRLRSPETPRIVTRGKNWFDALVEFVGVASGN
FT                   KKKRRQQQRRVSSTEDEEESDSDSDNDSDAASSTSSSPPSSSSKVTGHKTSTEEEDSPR
FT                   EGKPAAAMATRGEGAAEAAAEEEVDTDPFSVELKATMDKVAGLRSLASWGNVDVVDRLN
FT                   LLQFCVLEALGSDDVRNEADRVQKDREEEALNAEKKLREIREEAEKELKALLRTLPSVA
FT                   SIAARKKKAQNRTQKAEPVKTGDNQHTDNAEDEKKGIDEAAGDSETATGKDVREAAERT
FT                   FEAEREAILKEVDRKREEVYARLLSVQDGKDDGAIVEPLGMDRYRRLYWRFPMHRVVYV
FT                   QSVPNLTAVTFPVLAEPPELKQRRAPSRSFLLDDEEETSMLGGRRRGGRSATAAGDAAR
FT                   VKDDMGAGQTRWGIIPHDYLGTFVQTLDRRGKREAPLRHALETLEPYLTALEEPREVRE
FT                   TRARAHMFGYVNLLKVDFTY"
FT   CDS_pept        415158..415532
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1070"
FT                   /old_locus_tag="LmjF36_1070"
FT                   /product="putative ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1070"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1070:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1100:mRNA"
FT                   /db_xref="GOA:Q4Q1W6"
FT                   /db_xref="GeneDB:LmjF.36.1070"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W6"
FT                   /protein_id="CAJ09060.1"
FT                   /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYM
FT                   RKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARKED
FT                   RSAKAKAVRAEVAERKAAKK"
FT   CDS_pept        416293..418032
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1080"
FT                   /old_locus_tag="LmjF36_1080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1080:mRNA"
FT                   /db_xref="GOA:Q4Q1W8"
FT                   /db_xref="GeneDB:LmjF.36.1080"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W8"
FT                   /protein_id="CAJ09061.1"
FT                   /translation="MPPTSTRSTVGGGRRVYHLGNAVLSVVVFVITLVLSMVMLDPERS
FT                   SHLLSARRRTPPIDFTNRALVGGFTPVVVGVNKHTVLVVPAAAIHGTRYVSRALDSFFS
FT                   VGLGSASGTSSAGYHEEKAERHSQGAITLSDVYSAVLLREGVADATQPPDVTAGTVETS
FT                   PLSSRRPSVLHLCSALSCVTPYVAQQWSDRAAAALLLANKTNDGAATVRSRAGPVANFA
FT                   LVFGEARESLAVMRELGEHRVLTAQIPVAHSDHPQSAMPLVGKLESADLQASCSSLKQC
FT                   SYRSLVKHAQLATLLKAQAQQLPAEASRKRLFKEWVRRNNSHSGALAWGAVDVLPFSFV
FT                   TFEKSHTLHRFPLDLVHVDVGSGDSVAVLAYLDALASDTATAENLKPRNLLVSVFTSEW
FT                   VNAIVETLLLLEVGQRYSAIPLRDSCVGLERNFTPHQRWSLSHMRLWMGKHALEGTYLS
FT                   PSLERSRAAQIPLCTVLLSRQVNTLDELLQMASKAIDSYPPAASPVERFFYYSLGLSPK
FT                   DEELLTPLPEAVSGAKAFALARTSDAVRGVVGFLVQYIYFLIPIGVGFSLTRNVCRRRG
FT                   VCG"
FT   CDS_pept        419504..419965
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1090"
FT                   /old_locus_tag="LmjF36_1090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1090:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1090"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W7"
FT                   /protein_id="CAJ09062.1"
FT                   /translation="MVSFLRTFAVLCIIAGVLLQGGTARAPPRAVRAFETKFNSVSQAC
FT                   RGVLETECPSDGLARTDCLMEHIVDNANHECKMWLSWRASCFAYATVFLIPQGKCNFKP
FT                   DQATSQLIRNCLRNTDKSELPAVCSGSPYYKSLTLRSPRRIDSDAAADL"
FT   CDS_pept        420871..421245
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1100"
FT                   /old_locus_tag="LmjF36_1100"
FT                   /product="putative ribosomal protein L24"
FT                   /db_xref="GOA:Q4Q1W6"
FT                   /db_xref="GeneDB:LmjF.36.1100"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W6"
FT                   /protein_id="CAJ09063.1"
FT                   /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYM
FT                   RKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARKED
FT                   RSAKAKAVRAEVAERKAAKK"
FT   CDS_pept        421905..423563
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1110"
FT                   /old_locus_tag="LmjF36_1110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1110:mRNA"
FT                   /db_xref="GOA:Q4Q1W5"
FT                   /db_xref="GeneDB:LmjF.36.1110"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W5"
FT                   /protein_id="CAJ09064.1"
FT                   /translation="MTSTVTAVNQTQSLAAIRNFVRASVSCITYARGLCSDNAYEQRPF
FT                   LGLPLRQLIPSTTESITISEWIEKGAFDALNRNYLKEMSLCVYDAACHELLESYCFGFN
FT                   YTGDGERAQMTLNASQTIADGSKTTAVSQSSGGAVGIPAYRKRRCTKQEVQHLLTSILE
FT                   RLMDVVESLPPLLSERVLTMRLTYYDAVTPASYEPPCFAPASEHMARLYQAEVKHHVNI
FT                   GSMDTSHHLFSVAIRHPLLQQIHRQMTGRTTSAVATKTGGSPLSAGKIAAVSTPSDPLR
FT                   SGWESSFSSDPAVASAVAAAGATVTHGVVASHASCGLLLCADGEGAAFDAENAGEEKAA
FT                   GSSLGEVGGGGACTARTGETLRPCEVAKLDGVYRLMEKSTSGDERRLLRPAELTYLLFA
FT                   AFVFTKAPSARGGRGELKADEVEAYRALRCPFDVSAKTVLLVLQRLSREDFLQPCNARG
FT                   APAPKMPKAEEGSRPTPAIRAWLVPDPPASLLQQLMQVDAVTELLTHESHLVLQELSVY
FT                   LAREEWRRAPRTMTAKATSGRISTTGGSGKRRSSR"
FT   CDS_pept        424974..426065
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1120"
FT                   /old_locus_tag="LmjF36_1120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1120:mRNA"
FT                   /db_xref="GOA:Q4Q1W4"
FT                   /db_xref="GeneDB:LmjF.36.1120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W4"
FT                   /protein_id="CAJ09065.1"
FT                   /translation="MLRCVSTSRPTLAVLPRSAGAAVGSAAASSAAYVAARRGYHGFQF
FT                   ASFHGWTLPYGGKSTRVTKEELENQRVFTERPREKWDYHRVDENINSQSEFRRQEGREQ
FT                   FYQGSREDNSTMSHGSLHTPHKYRLYEYFDEYTKPGVDRKVAAAYAVKEQWDAEEFYYP
FT                   GEAWQRNRPGFRSVPKELLNRQTWYHWSHTLTKWDEIQPTIRTRSWNPDWPPPGYEVPK
FT                   LQCKKEFYFGMEEEGLVSEVERYSWFRSWSDNNMRVGWREIPLFMILLGTLYLFARNAM
FT                   SVTAMRAMSSNMYYPGRSLIRPFGVPKDWEKECFWWQRPLEEFPNQDQVWYWTQARFGY
FT                   MNYIKQRDAREKAMADAEAAAAE"
FT   CDS_pept        427214..428578
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1130"
FT                   /old_locus_tag="LmjF36_1130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1130:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1130"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W3"
FT                   /protein_id="CAJ09066.1"
FT                   /translation="MQTYHRHMTSSSNPVVIFVFDHQGSAVTDFWAPLLQSVSKGLDAF
FT                   GIEVAHAPTSSEIGQQLLAAMNAGSGPIILFFQGVGDTPAEGGKGLKMPIAYDGNIDMA
FT                   HIMSWGLSCISSSVTHRVHNDVDLARFFAQYPQYPALPHVLYFPSTSYTPGGYLALSQH
FT                   FALDAVFGVVPNAFTAPNATHIAQRYNITSKDELPVLLVLHRSTADAGGGAGESDRVVR
FT                   MPAAATSLSYREALAFLSTQITDTVAALVAKAESTQNQHFLEVAESRRVYMMGQLIERQ
FT                   HDIVEEERLQMAREPILVKDQAVWAKECVQLPKKHRCVAAFVDSAQDSAAKDNAVKVLS
FT                   LVSVKLLEIMGREAQKVSLVVVDRQGSDAVREYFDVGHNGFPDVLFLSLDRPAKYYNFV
FT                   GTFSAEGVTQFVASHDAQLTQKDVRGGHTFIPRMVPKLEEAVAVPRSGDEDKDDL"
FT   CDS_pept        429719..430636
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1140"
FT                   /old_locus_tag="LmjF36_1140"
FT                   /product="putative short chain 3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1140:mRNA"
FT                   /db_xref="GOA:Q4Q1W2"
FT                   /db_xref="GeneDB:LmjF.36.1140"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W2"
FT                   /protein_id="CAJ09067.1"
FT                   /translation="MLRCTASALFKSLAVWGGGTMGSGIAQITAQAAVPVTVVEVSQAR
FT                   LDASRKAIETSLLRIANKQCNGDQGKMKAFVDTVLSHVTFTTDEAVAAGGAELIIEAIV
FT                   ENIGAKKELFGRLDKMAPKSTVFCSNTSSLSITEMASATTRKDRFAGMHFFSPVPMMKL
FT                   LEVVRTEEVSPAIIEQLTAFGKKVGKIPVVAKDTEGFIVNRLLVPYQMEACRLVERGVA
FT                   TFQDVDTAMKFGCGYPMGPFELCDSVGIDVIKFIVDGWHAQYPNEPLFKPSPLIDERVA
FT                   AGKLGKKTGEGYYKYDGKGRKIES"
FT   CDS_pept        432165..435233
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1150"
FT                   /old_locus_tag="LmjF36_1150"
FT                   /product="putative endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1150:mRNA"
FT                   /db_xref="GOA:Q4Q1W1"
FT                   /db_xref="GeneDB:LmjF.36.1150"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W1"
FT                   /protein_id="CAJ09068.1"
FT                   /translation="MHLCASSFSLSFSSVLCQLHRALRNTPHTHLSPSSTAFVCLALCA
FT                   ASACCPVPSRASSEETKKVSRAFACLFHCSVIGRLPSHRATHLPLRTEMTEYAGTQTTR
FT                   HAQSLKSTLPASETRGSMPAATALPSMRDIGVYPRALPPLGENEACSNNNTTCSIQHDF
FT                   DSSAAGNVRTTAAMGATVPASSFCSTCTDKDPSGGLPLLRVGNSAPPPLTPTALVTTLP
FT                   ALSGQHALHCPRNATASTGSPRVPVGLTRASLQHHDENDACPHLQSTGQGDEAALRSSQ
FT                   RACSLAPTENYVNQLADQRPALAVEQGPRRGEATPSLHAAPSRSDNTEVDLLARQLVQH
FT                   TVLWSSMCDSVSGCASPARGRRGEVVKSTLRAGSVGTGSGACPHEATATVPVLSTTAAT
FT                   SSPSCVGILNSTNVHSSHHDKTDNATAGSSPLTYADNPTLSTRETFPIPRCCPDDLLRG
FT                   DDKIWIPGKPLRIAYVTWNMASKRPRTGEVSAHCIYPNAHLVVVGTQENGPYVMSNKRQ
FT                   RRWTKIVSHACLGGQYELVGQHHMWAVQMLVFARRRDVAHYISRAHASHVKTGLLNGLG
FT                   GNKGGVAVGLVLSLTPKDAAPPHRAKAHLTITSATRAPPLKSKTSGARGTSIKGSAITP
FT                   QKPDSSMVTGRETSAAFMLSKSSADCGAGAPPPVMRNPYMLHDADDEYGKLLRKRSLPD
FT                   ANSTGNFFCDDGDTVLENDGVFSPAEMMSRNTLSELTTEHADADHSHRHTQRSENGTDR
FT                   QERGGGDDDDASSDGRPDSVTPNYMTLLFITAHLTAHQGAVRNRNKDYRKIVYGLQLGR
FT                   RGPYRKFFKLLLGRKKVLEGDDEEEASDEDDEADCWEDNNPEEGVMPLRLPVVSGVERK
FT                   RKMRRDVTEEFDLTFFGGDLNYRINGTRKAIEYVIQHHSNIRSILINNDQLSLERARGK
FT                   VFQRFQEGDLLFRPTYKYEVSAGGGFTLNEYNFSQKKNRMPAYCDRILYKKRMSSAARR
FT                   ITIRLYTDVPNVRSSDHRPVVALFDIGTRAYTG"
FT   CDS_pept        437001..438113
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1160"
FT                   /old_locus_tag="LmjF36_1160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1160:mRNA"
FT                   /db_xref="GOA:Q4Q1W0"
FT                   /db_xref="GeneDB:LmjF.36.1160"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1W0"
FT                   /protein_id="CAJ09069.1"
FT                   /translation="MKPHKQQCTRSKHPIRPHSKPATTHHSPGPLFQSTGRPSATRMRF
FT                   VRPATHAAPHGRGWYEAIPERLKVTIDDYFSEATHCYSDEEQECARMTGLIAPHAGMSY
FT                   SGRTAAEAFAVFREYLYAKGSKGSELERIFILGPSHTRGFEGCELSAASAYETPFGPLR
FT                   VDTAVVDRVITDLRKAGVGAATASRRTDEAEHSIEMETPYLSHILHYPPTTTGAPVQPA
FT                   AGRVAIVPIIVGWTNRQDEKAICDVLKPYMDDARNFFICSSDFCHWGERFSYTYHYKRS
FT                   EYPNIGDSIIAMDHAAMELLEKRDLERWYAYLQMTKNTICGRAPISIGMQRWASKGNKA
FT                   RVKFVHYSQSNKCKDADDSSVSYAAAIIME"
FT   CDS_pept        439913..441826
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1170"
FT                   /old_locus_tag="LmjF36_1170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1170:mRNA"
FT                   /db_xref="GOA:Q4Q1V9"
FT                   /db_xref="GeneDB:LmjF.36.1170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V9"
FT                   /protein_id="CAJ09070.1"
FT                   /translation="MKTHRRHAPVEEVIDPSPFDYTLLSHLYVHSDGTDVIDFSGLAPG
FT                   KESRCRVNSFLKNRSFAPGMTEAEPEAVGSYLHLRVEENDGSTLDGSECCKIPGAHTSA
FT                   PPRGGSAPASNLVRIEDSAEHWWFMCQAAEDTAPYARLFNGAGDLLSYLEQHNLQLPTG
FT                   RSWMSGSSTDAGLPHCGQPQPHHHSSSSVTGSTAPILPLTKWLDIQIDRSNPRSPERVT
FT                   QLLNRLPISQETKDSCLYLSTVDSIDISVLATSDVSGAMSDYVFLNVMCTPVVENHVNG
FT                   AGATAATTASEEKRFLHGLGGAKFGVSSTDKKKQTAKSGKTGKRGAAHVSSQGGLSTTR
FT                   SVMEMRFEAVRMGAPRSSVPEPVAVAVIVFADWMFTIHEKPFAEMDDMLRMVKVHCAPS
FT                   EVTTSHLHYAAALSPTMQRRFTAPFAMSVLLQIVVGHHLDSITLAKAVDALGDCVFDVR
FT                   ERKRDQDAVLKHITAVRRCFGECGTETARREVLFASLLQPMFADRFFVAEPTIRRELEN
FT                   AQAHLRCFQRDIADCRDTVALSNWHNNVAIQWVLLRRGNRALRMILLLAQMTNIMQPIV
FT                   IVQTLYAMNVPLPFEADGDPPHTTLAPFFVLAAIFLIYCGLTVGSIRHVLVRKSFETRL
FT                   LA"
FT   CDS_pept        443251..444261
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1180"
FT                   /old_locus_tag="LmjF36_1180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1180"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1180:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1180"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V8"
FT                   /protein_id="CAJ09071.1"
FT                   /translation="MLCGSRATFARTAVAFFNMKHFQTKKKYNLTPQNIYETFSTVLLP
FT                   RDRLLRQSVSGGGGSRVLVLDAQQRVKGVYLPVFCMPHPSTVTNGSNSLGVAVADYTRS
FT                   IEATLAMHKAGGGGGTAPTLPTVLVVLSHPQGLAYGTFRADGTPGVPMKNLALAPILAN
FT                   ARTQQASTNIASTPLRTSGLGTVMPLLNVSHRHAEVVRDIYTELNECEHVAELAACSTF
FT                   VWVQRDNMSSMTFEKAQSSERYWERAKNDGDSAAAPPPGAISFLDRRWVLLMDVALHPD
FT                   TGLGLYARDPATGDRIVNATGVQSALCRGLLLLDHVPRTVANTARAANRETGVSG"
FT   CDS_pept        445472..445894
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1190"
FT                   /old_locus_tag="LmjF36_1190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1190:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1190"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V7"
FT                   /protein_id="CAJ09072.1"
FT                   /translation="MRRAKCHVFVRCAQPAAALTPVRTIIAAKGIVENRIVKHYTNRTV
FT                   EESKAERMESVKKTLHPNPRNRKEELSHLCQHCSYEYVPEFQRWANDMMAVYSDPQGYA
FT                   HDMAYHYQRIWKAKSLTRRGVEDGSGAFDVCRVHPH"
FT   CDS_pept        447345..449225
FT                   /transl_table=1
FT                   /gene="GPI10"
FT                   /locus_tag="LMJF_36_1200"
FT                   /old_locus_tag="LmjF36_1200"
FT                   /product="GPI alpha-mannosyltransferase III"
FT                   /EC_number="2.4.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1200:mRNA"
FT                   /db_xref="GOA:Q4Q1V6"
FT                   /db_xref="GeneDB:LmjF.36.1200"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039521"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V6"
FT                   /protein_id="CAJ09073.1"
FT                   /translation="MDVLGAFSRWPRPLRSRRLLLLLLLYRVTLCLTLQTAESPDAWWQ
FT                   SEEVAYKMVFGRGQLTWEWEEAIRSYVFPAIFAAPLLLLKCTGTDTSLTVWASSRCVQA
FT                   LIFFAHDCTMLALAQHLDDLRSGLESRRTGRDAFSAPLSSTVSESTKAKRRAPTIASTT
FT                   LAVVVVQWFLVNTGVRSYSNVPESLFVLLSLYQTSYPLFLLWAGVACAMRVTAAFAAFP
FT                   IFAMHACRLYGQMGVARHLFIALITVGMAVGISAGVCFVDYSFYHRLLFTPYNFLKFNC
FT                   LLGVSKYYGVHAPYWYCLALPAMAAPFVFFLAWMPVCWSYVQEAEKHHMSGSRPHPKST
FT                   LFSGSSSQTLRQEIKRWAFVGAPTLMVYSSLQHKEMRFIYFLLPLLLLISSVVVVLLCT
FT                   GSPSALKQSGGVQRRCWCLAVPSADMVRRLFTLSWVASAVFTIVLLYGYRRGAPTLFRE
FT                   IRGSDWHFGHLETLVRCYGTPGYAQLHGKVDRLEWVDCQMRLDAVSGVPEVTQDRLFTE
FT                   QPKSYALWRYLRLASRVDVEDVGKESVGKLSKDAWWREMRRVMPEGEAPALPDAIILFQ
FT                   KTAILLEADLLRPMGYRRLVVTLHAPHSFEEHEDRYLELWSRETAQNSES"
FT   CDS_pept        450002..450769
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1210"
FT                   /old_locus_tag="LmjF36_1210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1210"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1210:mRNA"
FT                   /db_xref="GOA:Q4Q1V5"
FT                   /db_xref="GeneDB:LmjF.36.1210"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V5"
FT                   /protein_id="CAJ09074.1"
FT                   /translation="MATSSHRTAMSSLSAAMKQYVQQAAEDDVVCAFGPDYFHGARTGA
FT                   CVGSLFSATLCWYTFRLLKEDQREVDFLAGLKHGQRNPHFSTWTLLRGLRTQPMLTTGC
FT                   IALATTSAMKCIKCYLANQRCREFFTDDVQFHMISELSETDLDAAAFLSTVLHNANGCG
FT                   VGARNALSTLREDRSEDQPSMSPAPTASASTSTVNGLLHTHSSRLDSKEFTLTHRAPTY
FT                   YDGVAVAFLGSVLDCYLPQKPVQKYYNMRVGTW"
FT   CDS_pept        451378..452868
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1220"
FT                   /old_locus_tag="LmjF36_1220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1220:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1220"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V4"
FT                   /protein_id="CAJ09075.1"
FT                   /translation="MESLTDRAITTPLGADTAAHATRETHDVDSEDGIFGSPLQLDGST
FT                   MGTAELNSALESLSSATVPNTASCSQNNLSLAKNLLADKDDTTTRSWSADHDNATATLW
FT                   RGCTADGERQDFSVSNVTGKHDGDVRGTENVSVCVKAPAEGQEMLLPGGAPPTTVNFST
FT                   MCNTSQVAASTREFSAMWNPQGMLGGASETLDARPAVGDASSMVAVVLSEEVPDDLPRA
FT                   PSAYTELRSCPSTPLVNTIHLNLQYTRATSVMSISSPFSASVQSISFLRTSVQHLMSNS
FT                   QHSYASSSARATANESPLLGEVGAAEPRPLCASLLETGSVVTQSALEPTKRREVTFART
FT                   PVEADGSSEVVPLIDPSAMSAADNASTAQEASPHNPGAPTLPCTPVAHRTVTTSVEGCL
FT                   LKEEQERRALVDDEASRFKTMVAREVSAYFAMSCQRRMKARQPSENVGVTEQRKSVEEE
FT                   SSQLHDSMRARMRMAEDEHENFMSNYRQMQQAQLHSAR"
FT   CDS_pept        454711..456465
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1230"
FT                   /old_locus_tag="LmjF36_1230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1230:mRNA"
FT                   /db_xref="GOA:Q4Q1V3"
FT                   /db_xref="GeneDB:LmjF.36.1230"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V3"
FT                   /protein_id="CAJ09076.1"
FT                   /translation="MKSFPLQHKMMQRLKLPYIQVGTCEVMNLASSYNMDSFSVFNGKN
FT                   RGLYQSTAAAAAQRASTTPTDDPAAWSLSQCQEPFLGEMVAGGLLDSYTGREASTFVSS
FT                   YLANALSMHTVLPTELRTLRKEDPSNPLLAIMMAALARRRGMHTESGSLVTEWELQQYA
FT                   ISADAAFFRACEAGRRPSYLSSAQKNRDRDAGAEDPRPSPLPPEESGCRGVWFSATVTP
FT                   TWLAEQQRRALTEHKQRLAPSPQRILACAEAADEREVRELLAHTPFCLDVAVGCVGNSR
FT                   AFGVARNALTGGMQSRLDASRERTVPLSIDHNPLRTSEYRRVVQAGGIVDSTVGDMIDG
FT                   NPYYNVARSFGHWSMKKDGRRSPVEQKMIALPTVKTWRMLAGDALVLCNHAVFETRHQD
FT                   DSSMDELAKVVGRGLSLNLPPEAIAASLCDFAVRFGAEHSLQVMVAVAGSAAGTSPCAS
FT                   SGDDSGKTVPEFAEWVDPGPLYLGACQRFPELRRRLQQDCARCEMTLASLIRRRWERVR
FT                   HLLPTRHSLSLLPYYGKECGALQQIMEEEAIFFEHEILRDVTDVNDPRLDVVFQKLAKR
FT                   LQPSAPVA"
FT   CDS_pept        457015..459333
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1240"
FT                   /old_locus_tag="LmjF36_1240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1240:mRNA"
FT                   /db_xref="GOA:Q4Q1V2"
FT                   /db_xref="GeneDB:LmjF.36.1240"
FT                   /db_xref="InterPro:IPR035155"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V2"
FT                   /protein_id="CAJ09077.1"
FT                   /translation="MRCSSSPTATPTVARSSNLRHYRALLQVMTYAGQREQTAEQVIRD
FT                   AMVGGVVVPFTVTHNANAPAAAMTTGDPPCITPMDAPVSADNSPREEVGIIALLMPSSK
FT                   FIGTAASLLADGFFSFAPLSSTVDKSRHTSYQHRSECQVRDLFTLIMLLFPECFIAETL
FT                   PRTPLETREAEGSVSETQSSNRAESEVQHPSSVSRVSPPVSPTPPILPRGRCTPSAQRT
FT                   QTSVTEGRGIVVDAVSPSNSAVDAALGGFHAAPLEGSLGVLTPAKLVTTDAGATDGEGL
FT                   GVSSASASMTANMMPLPIVSAVPLSLDVLDVLLESRRSLAVVLLSVINDALREVQYRQL
FT                   EQSHTSTTATLSTAAARLPSCEGGVLQFSAEVLLTAKLLLMSVISASAVWRQRFSKTME
FT                   GMKAVLQGAALLPSPPPLPFHVFSELLGEDAEGATPFLTLPVERWSWGKEKDALGQWYD
FT                   RLLDRLLVATDGAGVRVDAYLKTAKSTAVSCGRSVSSFPALLLHRPSDGQPAVEMSLAS
FT                   VARLSGSVRLPSLPIQQGELHLLLCPEVQDDKTGVLQARGHELLLDATASPTADFFQAC
FT                   TSSACSEAQLQPSGDAVPWLFRQRFKDLSSTEQGIVTAALCDPATLSAVLEKNAAMLVR
FT                   LTLWCRNRWPPSSDASAVLASTASQSDDVVKENKGPKAVHSIGDQVEQHILFQRPFSAA
FT                   VGRYVRELVTLRGLSKDVLEAWMRHVCTGTDAAAGVAVDGSIPSPHRAMFSALVKFAVL
FT                   HNRWRLTPEVEALQKEYAM"
FT   CDS_pept        461147..461719
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1250"
FT                   /old_locus_tag="LmjF36_1250"
FT                   /product="putative 40S ribosomal protein S9"
FT                   /db_xref="GOA:Q4Q1V1"
FT                   /db_xref="GeneDB:LmjF.36.1250"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V1"
FT                   /protein_id="CAJ09078.1"
FT                   /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVN
FT                   MTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPDIL
FT                   ERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADASPF
FT                   GNGRAGRVKRVRAKAAKRHAGGGDDDE"
FT   CDS_pept        462650..463765
FT                   /transl_table=1
FT                   /gene="ALD"
FT                   /locus_tag="LMJF_36_1260"
FT                   /old_locus_tag="LmjF36_1260"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1260:mRNA"
FT                   /db_xref="GOA:Q4Q1V0"
FT                   /db_xref="GeneDB:LmjF.36.1260"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1V0"
FT                   /protein_id="CAJ09079.1"
FT                   /translation="MSRVTIFQSQLPACNRIKTPYESELIATVKKLTTPGKGLLAADES
FT                   IGSCTKRFEPIGLSNTEEHRRQYRALMLEAEGLEQYISGVILHDETVSQKASNGKTFPE
FT                   YLTARGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYVKRASVYYKKGCRFCKWRNVYKI
FT                   QNGTVSEPAVRFNAETLARYAILSQMSGLVPIVEPEVMIDGKHDIDTCQRVSEHVWREV
FT                   VAALQRHGVIWEGCLLKPNMVVPGAESGQTAAPEQVAHYTVMTLARTMPAMLPGVMFLS
FT                   GGLSEVQASEYLNAINNSPLPRPYFLSFSYARALQSSALKAWGGKDSGVAAGRRAFLHR
FT                   ARMNSMAQLGKYKRADDDASSSSLYVKGNIY"
FT   CDS_pept        464364..464768
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1265"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1265:mRNA"
FT                   /db_xref="GOA:E9AG14"
FT                   /db_xref="GeneDB:LmjF.36.1265"
FT                   /db_xref="UniProtKB/TrEMBL:E9AG14"
FT                   /protein_id="CBZ05898.1"
FT                   /translation="MEVLSHPSLRADTYKSIYINIYIHIYVYLCVTGGIAACAQGLFAG
FT                   SPFVSLLPFNFFFYSSLWRCISSYIQAGTRVHTRTGTHHKENNNNQKETKLGFSSIYLS
FT                   VYRWEKKTKYNNNGNKEKRKEEKKRELLEE"
FT   CDS_pept        468203..468778
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1270"
FT                   /old_locus_tag="LmjF36_1270"
FT                   /product="amastin-like surface protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1270"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1270:mRNA"
FT                   /db_xref="GOA:Q4Q1U9"
FT                   /db_xref="GeneDB:LmjF.36.1270"
FT                   /db_xref="InterPro:IPR009944"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U9"
FT                   /protein_id="CAJ09080.1"
FT                   /translation="MKRSIPLVVYVVVQFVAFLLVLAGTSADMFRIPRGSLPTLCITLW
FT                   GLRLTCNSSGYAAYIDATFRPCPHRIARFRLAQAFALISILVYGAAFVLGLVLLFYCSL
FT                   LRLVCLVLNIVGAVTLCVVWAAMAVTYNKDEHAFCRALKLTGLYAAGFALFLVAWILDI
FT                   LNIIFLLLPCTVPATKANEKPESPTAQE"
FT   CDS_pept        471758..473536
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1280"
FT                   /old_locus_tag="LmjF36_1280"
FT                   /product="tuzin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1280:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1280"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U8"
FT                   /protein_id="CAJ09081.1"
FT                   /translation="MRGRLPSPKKPWNSLAGVLVGVRVTHAASVLEDRPVALGRLVSRL
FT                   SEAAYKAEMLRTGKRDRDGEDRRGDAAQLPVVDAGTRVTVRTEGDPASGAAVAPSAMHM
FT                   KGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQSARLVALVNWLRSCVHD
FT                   PRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELDSVSEKARWERDHDKAMQM
FT                   LRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLRAYRRQQRGHQLRTAIETLS
FT                   KAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAPSHPRIVALAGGSGGGRCVPC
FT                   RRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVCGDLLGFVEEAMRGATVKASDG
FT                   VPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAVPMKALTPLNVSSRRLDLYCIPP
FT                   FSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDELCAALRQRGVDPVTYTSLMLARAM
FT                   RRLQAALGPPGSPARAAIRQLASMPFADGVRDDATGAMSVLGQPDVQEMVLYDPVQHEW
FT                   RFAQQVYHTAARCILI"
FT   CDS_pept        475223..476257
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1290"
FT                   /old_locus_tag="LmjF36_1290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1290:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1290"
FT                   /db_xref="InterPro:IPR039963"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U7"
FT                   /protein_id="CAJ09082.1"
FT                   /translation="MLPALTWPSSEWSCIHDGGRPVCGNLKADRASLSHSAASFANGKG
FT                   KEFLSSFSFWLTIRRCQSVRPRSPFACRRCGDFCWGLAPTDNDFFLILSLSCGSHLSNG
FT                   LPRIPSHAFPSWLAGYPPENVLRRVTNLFVHPSVVAVRGISSAVIGIMMENYDTTIAGK
FT                   RLTREDLDQHIRRLTAPRREVELRDPFEVCPTKRISPEALSRMTDRLYTQSLQHKQERL
FT                   AAAEQAAYGAHTRGTLLRASPLSPQDQETSVKRLFNDAVERKQTNMEQLRRQHQYHRPT
FT                   NETKVTLNMFVQHMYYDRLEAKKKTEKRLYDTYLAPTEIHTGTISREKADEASNRLCTT
FT                   KAGA"
FT   CDS_pept        476707..478542
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1300"
FT                   /old_locus_tag="LmjF36_1300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1300:mRNA"
FT                   /db_xref="GOA:Q4Q1U6"
FT                   /db_xref="GeneDB:LmjF.36.1300"
FT                   /db_xref="InterPro:IPR035426"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U6"
FT                   /protein_id="CAJ09083.1"
FT                   /translation="MHTYLYMLSFTPLSRIISSGDDTHDVIESGEVLFILLLFLFLFLP
FT                   TAYRGCNLPRLSPTTTTHPVFDMADAAAYLKLGKKIQSSRFGRAGVAREEATVSQNDGY
FT                   AAAASDGGTAGVDVTSNSTTSGLVVVQVNDAQREVQQLPMKKKRVAKRSRSGSDEKDRP
FT                   TALPVKSNSMATAEPATSTGQPPSEDLSTRGVVFEDELNLTNVASPTAPVPPVEGVAQR
FT                   INLMAKWFPASLQERKLDAAVAPSMMFVEATVDRVNKMREYVLILRYGIEDAEALLEET
FT                   RQTQSNVWGKKSVDGNSTHQGPRREYWDLSSSEVRQLVRSVGLPRFTQALAEFSDAVFT
FT                   SHWSAAAAVYRLLSRRRRVCAPMDYNIRAWHEYLNTHGPESGRAPRLSDFLWLSAASTS
FT                   AMFTATASRLLRGARSCAEQISVSDASLGDRASRTGSEGDFGSSDRPRFFDNTETAAEE
FT                   EEPVPTRVWLLSAPVNFPTTLSPDQRAVLSFLRFLMPTSHSSRERTTSVGYGVWLFAAF
FT                   SALDIPLDPDTDRLAHDLFRTCCRHLRTLAAWQGVSGSTRDLLLSKLHPRRPDAAPPLY
FT                   ASLDDICREDVLALYTIVVVLARFFRQNQDHFMPL"
FT   CDS_pept        480150..480923
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1310"
FT                   /old_locus_tag="LmjF36_1310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1310"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1310:mRNA"
FT                   /db_xref="GOA:Q4Q1U5"
FT                   /db_xref="GeneDB:LmjF.36.1310"
FT                   /db_xref="InterPro:IPR040747"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U5"
FT                   /protein_id="CAJ09084.1"
FT                   /translation="MFTLLCCADLAGNKVNLEIALDTFPATLRGLESDIARIFNREVEK
FT                   SGAVEHNANVAEPFQVMSVFVYDDVLLRWTKLESLTQLHEYDQLYVFQPQTQWHVDVQK
FT                   ELPPPRPPARSRASSITGASGTLASLQVNGCASSPWPRSGISTRISAAGDIDTSHSPVP
FT                   SRSPARAQLEEHRREEERLAHRLSTLRRVREHLEREAQREEEEERRRRSLETYRLLKCK
FT                   EEEIWSQRDALARAEEEFRQFLAEKQRLMGQSPSP"
FT   CDS_pept        481764..483032
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1320"
FT                   /old_locus_tag="LmjF36_1320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1320:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1320"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U4"
FT                   /protein_id="CAJ09085.1"
FT                   /translation="MRCGSYAAFRSSGSALRRPKSDYGISLEARDRSNGKVPRKSTSAS
FT                   SCSAVEQTGQHLGSPRWRFVRETASVTQPTATVARRSPALLSIPPGQRTSTPHHGQMLP
FT                   RGEQHVSVAGSDDYMDDAASALLSELQQVVVRVSHQMVEERRRAAQQRKQIRALEAIVA
FT                   EQDAMLDALRTQCDAAQCEKSRLLKSYQQELRWRGADPVQAARRSRDICGTSGTHVSAA
FT                   QVDNVVQAEFRRLSTIYESCPFSGFDDVSPVVAAVLRSLATQVLQLRGAARNDEAEASD
FT                   ISKDAQPAPVQPHATSSSLRASARGTSTSSLMPAFNRSAPTDGHGKAGVVDRVTPLAAL
FT                   EKRKKASMFAAATAGPNHSPSETAGRTNGEEAELHRVDLDAGRNGDADAAACMASEASA
FT                   SVASSVCEDAASILSDIRARYGL"
FT   CDS_pept        483956..484906
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1330"
FT                   /old_locus_tag="LmjF36_1330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1330"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1330:mRNA"
FT                   /db_xref="GOA:Q4Q1U3"
FT                   /db_xref="GeneDB:LmjF.36.1330"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U3"
FT                   /protein_id="CAJ09086.1"
FT                   /translation="MMSARRWCATTPPHGTGSSGSQSIDEEAVVRAAKWSSSKFEERLG
FT                   FCAGETITEERLKRHYRILAKHYHPDTAAGSGSSNGVGYEGETSAGRDGAFQNIKEAYD
FT                   VVSAAVKQGGRRGGNASRGFSAEDFAGGFEFSDEARRRSQMRLLGDAVLLFVFMTVAFI
FT                   GIVSSHNKSRMQSRYLWHLVGIFFIIQLFPRLFAAAILFAVHSMHLLEKATLQEQAAIS
FT                   LIVERTERACCVQLDGLRTEAQPNVVVQVTTTADADNEATERVSSTLTFDKGVTAFTLP
FT                   VPADSSCVYHVKAVDEARKIVLVDRSLSARMPAAV"
FT   CDS_pept        485854..487989
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1340"
FT                   /old_locus_tag="LmjF36_1340"
FT                   /product="putative N-acetyltransferase subunit Nat1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1340:mRNA"
FT                   /db_xref="GOA:Q4Q1U2"
FT                   /db_xref="GeneDB:LmjF.36.1340"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U2"
FT                   /protein_id="CAJ09087.1"
FT                   /translation="MSSTPSTLSVDQQRLFDRMNREYSNREYSKALRTSECILRVVPDH
FT                   VDTFAGRGLVLYNMERQEEGYESIKQAILLNPKSMVAWHALGMCQRLDKKFGEAVKAFK
FT                   RALTFDPANTEVLRDLASACIQVRDWPLFLEAREKMVTAKASVRANWVALSCGHRILGH
FT                   SRIAAAVMDTMTSIMDAGDNPVEVSEAQLYRVELELESGAPQRALELLKKHDSEIIDVE
FT                   TKLLLRAKAHAQLGQRMEAEKRYIEVISMGVSEADSIAALAHLRKIPLDHYLRPAAGYT
FT                   EKYMEIIDRVLKACPNCDYAKRHALDCVPIAEFGQRLAAFATPYIQRMIPSLFSVLKSL
FT                   YVDAERAAIIGDVFAMMERELEAKDFSCFGGEANPCYILWVRTFLASHYRRTGEYALAH
FT                   AYIEKAINHTPTLELLYLEKAKIFAREGKTAQAAEQADWARRLDLQDKYLNSKAAKYYF
FT                   RDNQVEKGEATMQLFYKPSVVAGDTYLTALESQCYWYEREVGEAFYRRGDYISALHNLL
FT                   MFERHHEQNHCELSDFHNYVFRRNTMRPWFDVLDCDDNMGRNKFFLKFCPAIVRTYMRI
FT                   HEKGEEAVRAAHVPRPELNFDEIAADEVKRVKQQQKDYCISNVDLSEPLVKASRYMGYL
FT                   LAHRNTQASTHTLAIELYTAADKPLLVARALLALHRQRCSKTKDLAVAFKTGLYTRTAM
FT                   DSRVQAVVDEILAAVLE"
FT   CDS_pept        488745..489602
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1350"
FT                   /old_locus_tag="LmjF36_1350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1350"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1350:mRNA"
FT                   /db_xref="GOA:Q4Q1U1"
FT                   /db_xref="GeneDB:LmjF.36.1350"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR019406"
FT                   /db_xref="InterPro:IPR036957"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U1"
FT                   /protein_id="CAJ09088.1"
FT                   /translation="MSRVRVMIDRNQRISLSASAFFFLTHAPLRHGELLPKQRVQRRRR
FT                   SAMPKLCVEYSKSGRAKCSNTSCGKKIEKHELRIGTEVIMPFSEEGVESWKWRHLCCFT
FT                   ERQISNARSSGDIDAIQGEGDLAPADKALVQNMREGRLVGDMSIVGRIGDVAHSAATEE
FT                   LKGKGSKAVKPKAKASGSANDGGLPTASTGEKRPRAPPRKPKMPNTKMHDDVDSDSTEE
FT                   YEVAVEAVMGKPKCPYGANCFRTNEEHFRQYTHGDDNGTAADAAVPSDHGSAKLMPVIK
FT                   RRKL"
FT   tRNA            complement(491569..491652)
FT                   /locus_tag="LMJF_36_TRNATYR_01"
FT                   /product="tRNA-Tyr"
FT   tRNA            complement(491733..491804)
FT                   /locus_tag="LMJF_36_TRNATHR_01"
FT                   /product="tRNA-Thr"
FT   tRNA            492629..492700
FT                   /locus_tag="LMJF_36_TRNATHR_02"
FT                   /product="tRNA-Thr"
FT   tRNA            492783..492866
FT                   /locus_tag="LMJF_36_TRNATYR_02"
FT                   /product="tRNA-Tyr"
FT   CDS_pept        complement(495891..496553)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1360"
FT                   /old_locus_tag="LmjF36_1360"
FT                   /product="putative adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1360"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1360:mRNA"
FT                   /db_xref="GOA:Q4Q1U0"
FT                   /db_xref="GeneDB:LmjF.36.1360"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1U0"
FT                   /protein_id="CAJ09089.1"
FT                   /translation="MPLFIILFGPPGSGKGTVSHLLVKEYGFVHLSAGNLLREEVLKKS
FT                   PLGRRCAEIMSEGSLIPDELVVDLVCNRLSEQAVQKHGILLDGFPRNLRQAEVLTARGF
FT                   KFDMMIFLDVSPEILLDRCLSRRLDPVTGRIYNLKSDPPSPEVADRLQIRSDDTKEKHE
FT                   RRMQIYNSQKATLIAHYSDIIIEINADPEIKVVFKELQKKINKRLQGTTTQVPLAKL"
FT   CDS_pept        complement(498032..500386)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1370"
FT                   /old_locus_tag="LmjF36_1370"
FT                   /product="putative Transitional endoplasmic reticulum
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1370"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1370:mRNA"
FT                   /db_xref="GOA:Q4Q1T9"
FT                   /db_xref="GeneDB:LmjF.36.1370"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T9"
FT                   /protein_id="CAJ09090.1"
FT                   /translation="MADAVGNTNSKVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFRG
FT                   DTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIMPCKDVPYGNR
FT                   VHLLPIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGAMRSVEFKVVEVDPGD
FT                   YCIVSPDTIIHSEGDPIHREDEEALDGVGYDDIGGCRKQLNQIREMVELPIRHPELFKN
FT                   IGIKPPRGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFE
FT                   EAEKNAPSIIFIDEIDSIAPKREKAQGEVEKRIVSQLLTLMDGMKSRSQVIVMAATNRP
FT                   NTIDPALRRFGRFDRELDIGVPDETGRLEIIRIHTKNMKLADDIDLEKVAKDSHGFVGA
FT                   DLAQLCTEAAMQCIREKLSIIDWEDDTIDAEVMNAMCVTQEHFREAMAKTNPSALRETQ
FT                   VETPNVVWEDVGGLLDVKRELQELVQYPVEYPWKFEKYGMSPPKGVLFYGPPGCGKTLL
FT                   AKAIATECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSVAKSR
FT                   GAHGDGGASDRVINQILTEMDGMNVKKNVFIIGATNRPDVLDPAIMRPGRLDQLIYIPL
FT                   PDKASRVAIIKASFRKSPLASDVDVDQIAAATHGFSGADLSGICQRACKMAIRESINKE
FT                   IQLEELKKSGQLDENADIDPVPEITRAHVEEAMRGARRSVSDADIRRYDMFKTSLQQSR
FT                   AFGASNPPPAEAAAPAGSGAPPPADDDDLYS"
FT   CDS_pept        complement(503460..505316)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1380"
FT                   /old_locus_tag="LmjF36_1380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1380"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1380:mRNA"
FT                   /db_xref="GOA:Q4Q1T8"
FT                   /db_xref="GeneDB:LmjF.36.1380"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040104"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T8"
FT                   /protein_id="CAJ09091.1"
FT                   /translation="MGLCAFHPLLGMMHMRSRRLSFSPRRGTRPVSEGPSSWNLQVQGR
FT                   TSLAKLARRRLCTHKARTSKRVPMTSTLTNSNRINIPAVCRLRERNTNKTVGSGVLVAQ
FT                   GLLLTSATAIPTQSRATHIVATFFEGTKKSAVDVQLQPQRYYFASRYPPEMDYCLISCE
FT                   EAPLLNVTPVHMALTGKGWAPVEEGDVVLIVEHPIGDVAGTAAVPLDGKATFSSTLSAT
FT                   GDGDFDSVRAPYTEQKRFEEVLRCRGNVSFLKSNGSWRTAGCPAFNEHGQLVGLQSQSR
FT                   ADGEGVVNRILSLISIVKHLFANVQLPHLPQEDVTFEDVWDTWYVTNDITRILAILANF
FT                   KGKSMAQQVTWRLCELTAKPQLVKSIASNGGIEVILQNLSLFSSDEKLSESGLRALWNV
FT                   SIGEEAHLATIIKKEGVQTILDVVESFPANETVLEFGAVLLHNIAGCRAAPNFSEAHGA
FT                   RALKALYPGFQQFRESVVLQKFALSFFATLARLNEDFARDLVQQHVIEHITHLVEEKPK
FT                   QIFLMEIVVGFVAELAQYPQTVELMCSNTPQYAAASMSYLIDLLIHIILEYKDLDSLLV
FT                   SGNRALWGLGNVPTCRGIILENPRGIDALRISLPPLIASTHR"
FT   CDS_pept        complement(505955..509296)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1390"
FT                   /old_locus_tag="LmjF36_1390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1390"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1390:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T7"
FT                   /protein_id="CAJ09092.1"
FT                   /translation="MRFSVVGGPLASTISLEAKQSDSFESIFKRVQEAVGKATPLDAYD
FT                   LYTTRRSSLTGELVAAAGPLRFTDTPSALRLDFERSDPHILMLMQRSADNERGSTQNQL
FT                   LCSTAAAGDASRPDSTAIASTSPSLMTTPRVRDEYRRRMRAMYLKYDPGQIHKVEVALD
FT                   RYRGYEEDVLQQLVKRYGPEPAPGEVDLSPKAAAAPSSGPDARESMPSHSASTDEANPH
FT                   TKPSYYDRLVAIYSTYEPAKLSKVNGTLRRYAGREEEVIQQLVKKYGPEPSTEPVAAAK
FT                   VAEAASEQLAPTSGVGRQQLTSSATHAEASAHASATVPAVEEQVAAVPEATEASAVPLT
FT                   NTAKVAAATIPAAPPEASAYGDSTVGTQLSNTERKPLATVVSPLDGSLPCYTAVALPNK
FT                   ASAVESMAIGANYRERLVALYNAYNPAKLHTVEGTLKKFSGKEEVAIQQLVRRYGAEPA
FT                   PLNREEARKLLTTAGAGGVPSTPPSASPTTTNAPGSAASSTAGFEPASSGERVDRVLET
FT                   HKSGEEEVMAQSEVRYAAQRAKNIAGEPATSGAGSAAESGSFGAVVTTAQVSAAPPSIA
FT                   VSVPPSHGNSPSGIVSASTPSTVASTKAASPVGPAGAVVATPQTTRVGTVGPAAAAVPH
FT                   AQESKAWQGGPPQRRALPLAALRVAAAHVEAAAHMSLRERYWAIWRTHHAQKRAAVLLQ
FT                   QELWVKASAGAAGCYRLNDSVEPAYTVANLSVVVAQEERGGCSAQGRALSSELQIAMRA
FT                   LLASLRHCVESRVIQAQSHEEHQQADTLLTHWAAAENLCPVTDSPELACALHQAAHLIG
FT                   KLEDLVTVIRTQAGQLHQLKALHRDVLERMEHAHANTQALGRLQAQLSAANNDRRALEQ
FT                   ELERISAGGAERHARQAPLCRLYPTAEERKDAQVAKLQQELAKTRNLLFLSKEAEDRLK
FT                   VQLQQSHTREARRKHEEWHRQGKSSRYSISDRAYTQPRSRSARAGNGPHSSPSNSPYRR
FT                   YTPVSTPRGAFSYAIAHDTPRGPSTLQVHVNGCPVSSIRGPDAATAEQVSTSMSVNSST
FT                   PWPSSRYVMTPTKVDRGPCPNCLTPLTSCCREESGTASEKAAFCFSCRRYFTFGELWTC
FT                   DGREIM"
FT   CDS_pept        complement(join(509845..510144,510147..510560))
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1395"
FT                   /product="hypothetical protein (pseudogene)"
FT   CDS_pept        complement(516012..517343)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1400"
FT                   /old_locus_tag="LmjF36_1400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1400"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1400:mRNA"
FT                   /db_xref="GOA:Q4Q1T6"
FT                   /db_xref="GeneDB:LmjF.36.1400"
FT                   /db_xref="InterPro:IPR023379"
FT                   /db_xref="InterPro:IPR038888"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T6"
FT                   /protein_id="CAJ09093.1"
FT                   /translation="MTESRWITEALVQFSASPIWLTPIDNFVDDNCCIFSNESEMQLEY
FT                   TVAHNKFKKLIDSLLTCFLMELGVSMETAVEALQSSLAVSVQTSEGLSEQQAAKKLLKQ
FT                   IFNADNFSHFHTMMVKRNLELDILANAALSSDGVCGNGGAALSTEEVEKETRARARVQR
FT                   AIDVNGDVSEDDALRRAIEVSLQDGTAQQQVQAYRKACIQEDANLQLTAVEHQANSEKA
FT                   QLEAVLQTQSAQNLPEGEHFRQNHVEPINKQKESQLQPIRAHAMSGKGQKGCDEAEPQK
FT                   ANFNSPESPCPLPALQVPAAASAPVAAPVSVPALPSIGQRQAALPSIPSTITASVLKSA
FT                   PSAPAHQAHGTAVSATPAPTPIPTKEELEKRAQYMREQREKLLARNRASRQEQLNTFLQ
FT                   NNSSSTTTSSSAALAATGAAQSVTVEIARRLRGDLIGEARKSSG"
FT   CDS_pept        complement(518671..521382)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1410"
FT                   /old_locus_tag="LmjF36_1410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1410"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1410:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1410"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T5"
FT                   /protein_id="CAJ09094.1"
FT                   /translation="MLPALKATHLAWRGEKGRGTGRPIDLLLAAPMRAAQSVYQHGALL
FT                   HPTLRAAPAIPLLLRRHRLQTLPAPWRWNRDFTSRPTDASAHQSPAQEDMLVRMLIQDA
FT                   FHPASTSSLAKTCDDVAGGNEQSHRTVAGTESRSCHPSQCATPATEGGGAGGTLGTEIQ
FT                   ALGGGRPQPPPGVAVRSEMSAHVQDGLRGQEISGSPVRVDEATASVTDSRASNAAAEPF
FT                   ATIRRGGQGDDMPRALEWLCSACHTYNSLTSSSAACRKCEASAMTSYRSAFPPLRHVVI
FT                   APTAWVCQNCSHTNRQTGASAQPHAGRAGVSRVQQEKFICNQCRAPFGGVQDWVCPACS
FT                   HFCPRAATQCPSCFADRPLAWTCHCCESGLQNSVFAVKCRGCGHERRQKYSNSVVRCTA
FT                   CRGWNDVRWELCATCMAPMESLLLARETRPDAEEAALPTPPLSESALGDTINVALVPDS
FT                   AGMLHSKTVLQATELLKAARTSGTATAARGLRQDTEEPASLSPSPPSSPVHEDEERPRV
FT                   ATKLPDNAWWCFTCNVAHRRNVTFCDICLESRDAMLLRNKKEIAAMRASASSPSTGVMS
FT                   PAVSSDPVSLEDAADVVIMPATVEGDWQCPYCRKLLGVRQHECCGHRREVPYGYWLCDH
FT                   CCSTNRNDRSLCLGCNERRESVCPWTCQECEWGNDAANAVCLQCGLPRTPCTTADRGTT
FT                   LSDDSAPSTSIACGVCSAPNHFEKTACYRCRARLRDVEWTCDGCGHGHRTRNALRCEGC
FT                   RVIRQFDLQEEVWLCEVCTTPVFSGGEIPVRTHCPKCNAQRAPTATHYPSRWKCECGLF
FT                   NRSRVTECLECGARRRLESLSTTATCPRCFRDTPIDVQERCTYCSASLADCFSRWESSV
FT                   TLLADTRELAEGCNESEADAVPDDGDDDVVTA"
FT   CDS_pept        complement(522739..524424)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1420"
FT                   /old_locus_tag="LmjF36_1420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1420"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1420:mRNA"
FT                   /db_xref="GOA:Q4Q1T4"
FT                   /db_xref="GeneDB:LmjF.36.1420"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T4"
FT                   /protein_id="CAJ09095.1"
FT                   /translation="MRPAVCTMTQRVVQPAALCHPWTPLWRVSLVASWCSSHFPRGCGA
FT                   DSARADSARPYTTLTRSLRQSWKSRSLRPWMCAKESCRAVNQGIRKECESCGTEKPQLL
FT                   GWKCEGCSTINHAGVRKCKKCADASDKSKEFWMCAVCHENNRVDEIEDNSRCGFCGYDM
FT                   APHSVAEEEILRRATEKTVMLQQQQEHFDSVSYTEADEQFTNPLEGAEALDPSLRAIHP
FT                   GSEAPITGRVLKLPAVAPFVAGGVPETRHSPLHQRRKVHPALQTVLEGATAPEGPPGFD
FT                   WMCRDSSCGHINPGDEESCLKCGSHITPAEWECPLCASLNHLARSRCFYCKNRIPVCWT
FT                   CSACQGTTSIYDKACRGCGMDRPAAEPRTFRELERGGGDHVGGYVPQGNRSRGEWYCST
FT                   CNALNFSRRTECFQCTSPRPTVPDQGVADSFSAAGWGGTDSSGPAAVAAPVQHNNWMCT
FT                   YCQTSNFRTRHDCWKCGRTSERAEEWSSQALTPQYEREGFQEGANTKSAEGAMNASWKS
FT                   AGDWLCAKCYSKNFRNRLECYRCGARKHALSAARGSSVRKPVKL"
FT   CDS_pept        complement(526909..527544)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1430"
FT                   /old_locus_tag="LmjF36_1430"
FT                   /product="putative translation elongation factor 1-beta"
FT                   /db_xref="GOA:Q66NE2"
FT                   /db_xref="GeneDB:LmjF.36.1430"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:Q66NE2"
FT                   /protein_id="CAJ09096.1"
FT                   /translation="MSTLKEVNGRLNTQPFVSGFSPSSEDARIFNEMFGSNVNVIQWVA
FT                   RMASYYQAERDEILNAGTEKKATEPAKKAAAPAPAAAAAAEEEDDIDLFGETTEEEKAA
FT                   LEAKKAKDAEKKKAKKEVIAKSSILFDIKAWDDTIDLEALAQKLHAIQRDGLIWGDHKL
FT                   VPVAFGVKKLQQLIVIEDDKVSGDDLEEMVMGFEDEVQSMDIVAWNKI"
FT   CDS_pept        complement(528483..545312)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1440"
FT                   /old_locus_tag="LmjF36_1440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1440"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1440:mRNA"
FT                   /db_xref="GOA:Q4Q1T2"
FT                   /db_xref="GeneDB:LmjF.36.1440"
FT                   /db_xref="InterPro:IPR026847"
FT                   /db_xref="InterPro:IPR026854"
FT                   /db_xref="InterPro:IPR031645"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T2"
FT                   /protein_id="CAJ09097.1"
FT                   /translation="MLEGHVAELLAMHLSRFIKDVNANQLRISLWSGNVVLHNVELRSD
FT                   ALERIAALLHGERSGVETTDAGASASGAAGAPSRSSKSHEGSLSTSTLSMRMLLAPFTV
FT                   VKGVIRQLSITVPWASLESEPVQVDVTGVELVLGPLRARPFNAKEEQEREQAIKQQQLE
FT                   RYEKERHRLSCEVAAETVSESTSKMTASTESGHVKRGHGSAVAGTNRASGASWFSWLWD
FT                   FDRLSQIAVRNVRVNLQDVSMRCEFDYEGLHPSCASAFCVFVKQVQLTTTDEKFKDVFN
FT                   KNLLTPLCKRIALSEVVVSAHAIRQSPRGASCSAREGRNNAVPSAVGEPASCAASYDTY
FT                   ASRWALSTAILRVHTLQLQVKLVPPECVSRNAIVEEMPMLSASSTELTVMTADSIEVDV
FT                   CFGAVQVLESMWRSYQQSLPCARYRKRLHMLRLTGRHATHTRALRQASEPNSASLPQDA
FT                   ATAWRSLAQQRWRFAIRCVLDDVRQHRQIFGLHEWKRCEVVEAMVQFGKLRRAYTAYWK
FT                   RAKGVMWAPPLSALEEKRLKSMERQLSLWQVVFLRCFSRAQLVLEQESYARQQDYIEEA
FT                   RQRIKSGLLSSSGTGRGGTPTSFLWDWFFGRSARKNDTATLSRKSLASVAGCDGMGVIS
FT                   VPTYRGLCFRDLVALEWDLGRRYAPPHYARLAQPRAPQNRLPKLAAENKLYFTLRALFP
FT                   KLILRLDPIYWPLTHDSSVPATPSATPLQRVEQRLVVQLRAMELFYTTIPDDRPEKTSL
FT                   SFFLGAASLTFEGALRSVLLQSKEQFGEDYVVVKRNAQRTHIHVWVAPQLVICQLTHEW
FT                   AWWYAEVSAFVQWFRAVQQAFYVSGVPEASPGAMPALAEGAQSDLHGAASAGSRTSASS
FT                   SSTSTPRGQSAHTTTETTVPGASPVPRVLNVTIQSLDVCVPLFARDIESSDLEIFSRQP
FT                   SAFSSAALPGSLPGTMPCDSTWKCGESQGQLSTETASGDGDAGDGRPHDEAILQSGDAA
FT                   PAALWLHTTDSIQSFPVDGDTDGAEYTESLCSSPSAGSGTFARVAPERCFLKNETCLVL
FT                   SVSTTRLWTVAPPAKRYKGTENEYYLCIGDQSKAVRVFCQNGYNTHTHTTSRQLELLSF
FT                   VAGEVRLNPKELTVLLNKGIDAVADPWVFALVNDALLKPTALAAADAHGQAVRALMAEL
FT                   RQAEYRWSGTRGAAVPWRLATSTCVELQVDSESPPVLREVPLDYARHILSALSAPLSIA
FT                   ASLATTVVHAISRGELATGVFGGRVCTVGVGVARLLIRSEANVDLGELVLVAPEHLPPA
FT                   TAPYREALSALGAEEPRAIELICNFADSQWHAVEQSSYDPLPLCPAREKVCPRLLLSIP
FT                   DITMTTTAGRKLLTIEHLTLVQTCTAPTKPEAALTIQTVSAFCDVVLVELLEVLIGTVC
FT                   TMRSIKPPPQAAAYVVTGASRSDSAASEMPQSRFFGVLPIRVRVHTARFQTPLSRDDVV
FT                   DAPYVEVTITIDDALCTLEPLTGGTGRGGKHVHLRFSVSEAMQLADYIGGEPEVRSLLS
FT                   AYPWAACTGDGTAHALQCVADVTLPGSCVGDTDTSTSPRPGVPPSTTCRVELVGGAIHV
FT                   YCPFLYFYAAAMKADERIVRLGELARSLLLRHGYTRAACFADGTRRSRVVGGAWASREA
FT                   ALPLSLSVEATISDLDVVLATDAAVPIDMTKPNTFCVVHVEQIVCGLQQTTSGSPGASA
FT                   TLETQTHASVDTNRVQLLDLLTARSRDVCLPDVKLRANRGVLLVPKEDLTGYTYQRGAP
FT                   DDWAFLVGVHPASARSPQRAASVREAASSTASRPSDVTIHMSAQQCRSLVCFFSHNVAR
FT                   LPIRSTRRTPRVGGGHLQHASTAPATVTFPMGGSNPLSSSRHGAEAPSHQQAALSPSVT
FT                   LLLTIPAVSILIDTDDYAAPDRSARQSTMPRSTKEDEGEFIAPAAPPTRLPSTRRVSYE
FT                   VGLRRGGQLYSAVGECWSTSPVKNGQLSGVELVVREEMLENSTGGADVTETTSTHVLLT
FT                   IDLVGLALLERRAGRASREVDGDARNDAAVVKVAATVRHAHFRVPHIKWWLLLCSIFSG
FT                   VCSAEGGRQSTAARTPGKSGSASTIARFGEAGQNGNEGASRLGSSAFGDHRGTSRGEYM
FT                   DGNKAVWPTPQEHLASRQRRSRRLHGTVEITHTEVSFCTIGCANGDQQPLCRFTVPEAR
FT                   LTASPLPALQEGGRAHLNNAEYLYDEFVLEVPCCPELLLLCVSGEADGAAGLESQLSSG
FT                   SSYASVLRRRPAEASSTASAAPVVKGSFWRQAAAAAVAPASKSPLLSAHSSEACISLGL
FT                   VSFSDAGSLRSLRYGRCYQVTDLTLHRTSVVQVRVQRMLLDIPVVPLFSLAREVVRQVM
FT                   ETQSIEGMRPHARAAPPDGRDAESPALTYIDMEAELTDVEVRLSAEATPLGEPAASCDA
FT                   GRDPVSWSVAVSSARLTTSVQLQSVLTSTRVPALLVGDGLSRGWRVQIWHMIPQLVVQD
FT                   VVFSTNSDTQAWWRLSDVRIKASLPLTRRIICVRGKGAGGMVDELELSSSAEQLALRWR
FT                   HGSTANGFQMEPTAVTALNGLHYHVLASLHVDVGVESDGAVGTAPGHQAASVQVRLSTI
FT                   FALASAAARLVALWRQTRHTCESSVAAAVNAGTTSRPAGWWRPDARQRHGLITWYEFEL
FT                   GLSGRRVELIMDTAAATVSDKAASALTRDCVLCVSVDGAVTVQVDRGAGEEAVKRTTVS
FT                   DIAQRDAGSDETMAECDGRVDDESAVAVALHTLFRLRTAPVHVHDRAGNLLLHVSAVPQ
FT                   GGMADAMVADYASAAARLDIDAGRVVIHASSLTAAAVVCWWKAYRALKRRWESAVTCMR
FT                   QSSACPPEATRKSELSMGSERVCRWCWLQQINAEVRHIELVLAPAARVCAQRARITFSP
FT                   TDVGIALDAAAALELRCEEVCVYSMLPQSRAAHETTPIVLARTVSPVLVITRAPKQRPL
FT                   VQYRTPLVSIMNGDGHSWALCAFRIAKVVTGTVTALAARAEVTSLHTLESDPPTDGAAP
FT                   SWVAWIPRAEVEIHRAELRCFAPHSKRTCSAASVVCLAARRAVFRCVESASQMDSSSVG
FT                   TLVGIRMESSAVLSATYSSGLSTDVKAHPLLDDVTTTFALSSSSQSASDPVEVTFSAAA
FT                   ATEQNAVCLRVLAGDALEKTVAALWLLARQKLPRRYAQARAAKDSAAAGDKVRRGSGTL
FT                   WHVRAAVPRVLLRCVVSSAAVSSSAQTLRHLCSISVDDVRVELYTRRGGSEGGDRQPHA
FT                   EVWVGSVVGETVVTDAAEELEERVMEMPWTFLELRPLVEPSGDRAPGTAPVTGGATRTR
FT                   SNDRAGFSVVQRSLSLSTGGEEHDSAAQDIAADDATALVIRLHALHAHPSMTLLKTLME
FT                   RVLRPFVTGISAASADASLTHILDDLEDTVLRVESATAVLPASGALSRHAGRVRVVEVA
FT                   TDWHLDEDLRLGGEGGFQLHFCGTAGRSVITVRGGGAGGAGGEKLQGSAVTIFLCLPVG
FT                   ANGEVCPAIRVDPDLTVRFENVRVVVGEKAHAVRQDACVLEAYVELGERSLCLLPPPLV
FT                   GVSASPSTVATDAQVEEAAARVSQANSGAAASDTAVPQVPTTSLWAVSTIFSVNVAVGF
FT                   DVSLTAGARRLAATGAVKGRYRFEEKRNPERTLRSEHEGECTIVLHTCVSESGPLTDTP
FT                   VAATAQMCLAAAENQHLVVLDCGSTRWRLPLGHAHVLIELGRLAQQALCQTPFPSPPQR
FT                   PWQPPAAGDALAHGPTRHATRLDVRANVPSWALTLTSDAGSALAILLVEHAGLQCCTDM
FT                   DVADVVLTAEATVSLRDSIELDDESGEDQGATLRYAAERSSVASAMAARVLFSAQPHLS
FT                   LSLTRFSPGCRSLSVSVHVDSVVATLPLVTAARLLRTSAREMDAGKLVFCNDSGVEMEV
FT                   AESAQHAGAPLRSVSRWRLLAAPGRLLHTNIPPSCAVLMLTPVTAPVSDVSSTAGRKDG
FT                   EGSGGVAVNLQALADGAVGRVSLPGYTSALGALDLVVRKSVRDRLEVVHLTSSVVLANV
FT                   FYAVPADGSAAAPAAAGIVSVTAHGARLTVPPRSARYVPLPLLRECLTVELDGGAYAPV
FT                   AKMLTWAMMADAMTLLADQAAGGGGETSGGSGNGGSASRKSGTAAGFMLYGNLDAQGRD
FT                   RADNDNGYGGTLRAPAFCERVRALDAFTLSFPMLLSPLTPAPMKPLCGDGAGDGDNDAT
FT                   FASAPARQSEAAVSSTENTARTGRVVQLTWRRRCSRLVAPLFSGRLSPSEYTVAVGPVW
FT                   TLWNWTGCRLRLRLRTSRDGVVSSPVKAPQGTLSPPSSLLTSRSSDAVATAEVENGACF
FT                   QWTPTTLDALQGTVFAFFQLMAPSLAGGSTTLPKSPSSTQWWSVAAPISLQERPPLYIR
FT                   LQQGSNTTRGAVRIEQHGPSSVVVRCAALLRSALARPVYLRDAEQSQPLLGAGAHGCVL
FT                   PRQQVPLFYSEYVTTLAPHADLVGFTVVTNPVTGTGARNASLQESNAYYLKTPVVATLL
FT                   SAQELAHCTRFYTVSAVSDAQFERPAATLHGKNDKDLGEQCVPAEALACLWTPEPPTVV
FT                   QLSSLCRIRNTHVHRTLLAMPFDASAPSNAEGARPAPSMVTLIPPGEEREVTEFCRHAK
FT                   EPEMQFCYSTIGGKAPAHAWSPPVRLLSLATATQPLVLKHTCVPRDLQGVKSDAAAEEP
FT                   RFIMNPVRRRVGETVALAVEHFRCLTVLSTMTSVSLCVSVGLQAAPPLKIVNRLNTTLQ
FT                   FAQCAVTTGSDLASSPARRGAVTTALCSCAPRPCSYVVAAGTMSCGCWEVPVLELPGLR
FT                   VTLYSNVRQGFTVSQDVDLLRCAASPSSGARVGNTDAYVYVSLDHRRRQYTVTVAPSRQ
FT                   LEGRMLFQPRRLTQLEVYVHSCTVYVAAMTLPRAGPFARKSLIAQAARGRLRLRRGARS
FT                   GESVNRDTVPLIATDEDVLTFLEGHELDVVLLRLLGFYGSATLTERHLMGSASLALLEV
FT                   VDCTTVEAAYPVILRVGPRAGSGSATTMASNATVVPDAEAEQGHVSSPILPDVFGGAAT
FT                   LTSSTSVPHFKDPSWFALEVQLTRPGQAAGVDGVVMLPVPRLRVTVPPIVVRADDDLLF
FT                   TLRATAERLGEEWASAAPSEQGGHAAERRGSLFSTPGAAAADSTTHSSHRACNVFVYAL
FT                   QVSPIVAEVTYTRSGHWRYNPFQGLAQIPEQLIPSVEDLSISLKEVRLQEVELRWSHSL
FT                   FGIAKSFLWPLYRTQLLLQSYKVLGSLDVLGNPRALLGSWSRGVWDLVTNSSGQSRWTS
FT                   TREFLRTTTSSTLHSVGVLARSIGNLAGTSPITVAPRLSCGSSSSDVIGHAVLAAPQRR
FT                   GVLGEVLHEVGGGISDAVTKPIRGAREGGVSGFLIGIAAGVAGLAGRPVFGFFRGVSVT
FT                   SEFYARLLGGLGALTEHEARHLGLQRNYLIVSTSARGAPVWEAAEDVEGQDSGTGAATH
FT                   VNRVSRASLPRGQYILTHAMYDQVFADVPRWRRGEETNVRLAVGRVGIYNTALHTPYAA
FT                   LCTFLSPSEFRDALPCALTALLAGNIISLLACNCTVGGFRGSAVVEKGNDKAPDASDTG
FT                   EGQGTQARLAYECERASYIKASLGMRASHTYVADEVFVQVCSLEEIEAVLKETEAQKKY
FT                   SRALARAIGAAGERLLAP"
FT   CDS_pept        complement(547543..548010)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1450"
FT                   /old_locus_tag="LmjF36_1450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1450"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1450:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1450"
FT                   /db_xref="InterPro:IPR039879"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T1"
FT                   /protein_id="CAJ09098.1"
FT                   /translation="MSAVASDDSAGHVVDPVQHTHRYVQEHRLNELFGHLLQLVLYHRP
FT                   DDPRAFLAEEVRKIREEKVSLSLFTERDLETMFEMIDATAQRWITVAQLRNTCRNLATA
FT                   SSAGNVSTGGGDLTAEQEAAIAGAGDAAGRVTMDKFKEVLSSLLLTKNKWS"
FT   CDS_pept        complement(549194..551161)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1460"
FT                   /old_locus_tag="LmjF36_1460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1460"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1460:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1T0"
FT                   /protein_id="CAJ09099.1"
FT                   /translation="MPSSRAADNTIDRNATAPAPTPNRYQGPFSEPARESAKAADTLAP
FT                   TQGGDPRRGSAGSIRVIDFHAPGVTSDSDNVCAVTTSSGHAAPLSLEARLAALRSRRLA
FT                   REARAIGASGSAVSASTAPARLPVALAEPARDAVERPCLGHTLPTFPLPPGPLAPTFTS
FT                   TTPTGASEPAAQSAAATFTLAPRTANNVNKVVAAVNSTTLGDACWTRYATTSRTETPNA
FT                   APCSSASVQADKAGHHPAQVGRMASQRCFPSTTSSVMTTAFSESPVSTNAATAFSVRGS
FT                   LPSQAVGAAPRNNDKSEPAPRHRGQRSAAEVSSLRYHPINDTQAARRLFPDDTAPSIYV
FT                   SPLDTAADAIRGTSPEHVEAQHLSPLPAVQPPRMSTLEQDGGCLSRTTSTPERTGLPSI
FT                   VEIQTLLPTAISSSTGLPTASRGMARRYGVHASLRCTTGDAPPSTASAPIRPFAPFARL
FT                   ITTPPREGCPSPQPLSDDKSWLSRRDFVVPGVCLHRDSPPTGCTQSTSHECSYPRRVTS
FT                   AETTSSTEARSARLYSSSAERDTSVSSAFSGKMPIFSSFRRRVIPAVTSRVSSSPSHAR
FT                   TSARHSLLSSAVCTALLTTAVRSKYKLLDDKTTVSTKESAERDTIAEELAMQLRLSRLK
FT                   SELTRQRMEQRRRGGHISTL"
FT   CDS_pept        complement(551886..555206)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1470"
FT                   /old_locus_tag="LmjF36_1470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1470"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1470:mRNA"
FT                   /db_xref="GOA:Q4Q1S9"
FT                   /db_xref="GeneDB:LmjF.36.1470"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S9"
FT                   /protein_id="CAJ09100.1"
FT                   /translation="MNGSFTASPALTMLPTLSTDHPLKRTADDQGRQRDGAGAGTPDNN
FT                   TPSAHRRSLIGVRGSVLPEKKGGLPKTGHVGVCYHQNVYVFGGVNSKGQFSNHVFCYEK
FT                   RTLQWREIRGVGVVPRGRANHAAVLIGNKIYIHGGHRHLEVFDDLFAYEIETGRWEKIG
FT                   CERSQGPGPIFLHSMVYIPPLDSLLVLGGIHQREQNSCLGHLLDVRNRVWTGVPPPSSV
FT                   DAQHLQLVTAAYYAPSAVVVVLGLMDADVMKEDAVPTPHVHVFQPATFVWRRVDTSTAP
FT                   MSPLPFRMEAMWESLLHLLIPGGGGAYDPLLESWMFPLPSTETDSPVDDSSVDQGLSTP
FT                   GLGLPPLPLNKYGFLVLDLRSMSWSLVSCNLSRKLVAELNAVNRVTREKMERLVLRNNA
FT                   ATASIALSGNSSQSKSAAQQPADSGALLGMSSASLTYGPSGAASRHSSVFRLQPLQWPR
FT                   NDSSSTNVLWPRASGSRPAMASGSNEAKMAALLSSSRYRRLFFLDDAPEFMRKYTLVVV
FT                   RDEPTKSGKLRPLQYVVLHGGLTEPTDYAMLMFAPMLTRSNSNRATPTRGAGLMARSNS
FT                   FRRRSTASVGSRRGSAYTQSHGGEDDGYGDDSFDDVASLVSSGTLIGAYSTQRNYRRTA
FT                   PHAPLSDAEALVRSRGGRYSDDDESDTDVEKRMNNGGAAHNSFLLPTLRSGRTRHNYYR
FT                   FALQFTPGNSIQKESLLPYANIPVAVLQTPKDVQKWSRNYYTDQRRWLSERMKEALIED
FT                   RKLRRLRQLSKAQVASSFGAQGNATRAGSAGCDDSSSSESEFLNDGLYLAETFIGDPRT
FT                   HGGAKLSSLHAYENRLALDAADAALTQEEAPKRRLRDFFEEHGFDVFEEADMQQLHERM
FT                   QLRTALGGKGAKQDRRRKDPRLQERAVVAEGASAKAAKRSETSPLVQKSPVSDGFMPLA
FT                   SEVQIADSGFERLRMKGWQDVGRERIASAVLHDSFISGLTGGTTGDELDFRKLAAYALL
FT                   RRAVARLRADGNPHEMRWRLAQLRWRYLRTLVCTGEAAYLLYLASQADFRMKGIMVTGT
FT                   QGLMLAPELHFLSPLQAYRVPCKPVPYNVAAASAPPPASSSRFAQVTASGMVVYNSLK"
FT   CDS_pept        complement(555977..557209)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1480"
FT                   /old_locus_tag="LmjF36_1480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1480"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1480:mRNA"
FT                   /db_xref="GOA:Q4Q1S8"
FT                   /db_xref="GeneDB:LmjF.36.1480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S8"
FT                   /protein_id="CAJ09101.1"
FT                   /translation="MELLTSVFQRHPPALRLHRELTIALADGDSARAADLASVLATTVQ
FT                   RVVAAEADSSDAATPPEGHANTGHFSQRDIPVAGLEDVEEAVEKTRQTLLREATVRVSS
FT                   GVARDTGGSAISSEPAAAERSLPFWRDPERLCVTILESMFETEVLGGESQDTLTAAGNR
FT                   AAEHEAEQVRILDAYLDKEGARWNAQKAAIAKIVLDVTRSLGLTPEDLQAFEGISASAG
FT                   AGAAAAAGERKLNVLRHSNLVIRGEMPSAPLSSTASECVAEGVETELRALEERMSSLGQ
FT                   PLTPWEVRMARYELQMSKSKMRYVVGVHKELQLALDHSAALRASLREKSTAEVTFTTGT
FT                   EVFMAEVIRALNEGADAYSANVTAEGAQLTVSNVKAREAVESPVLPFTFMLKGSLWFTT
FT                   APSRPPSSSSD"
FT   CDS_pept        complement(559224..562832)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1490"
FT                   /old_locus_tag="LmjF36_1490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1490"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1490:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1490"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S7"
FT                   /protein_id="CAJ09102.1"
FT                   /translation="MEEEEELSMVIPVPGSGVSSQRAASEYSEHAGKSSAQDASTSAGN
FT                   PAVPFSRSTTPVAFRRGPSAARGSDEQDQVSIPTPSIQRMKPSMSPEADGSTAAHTQRP
FT                   SGRSAVSSSSIVFSGADSTTGTSILFASDGASSEGVRNGEVSPLSRSPCAVKNGKSGNV
FT                   AAVKQQTQYDEVAQDAAAVVDLTSDSSFDLHIEEDEQAEEPPAVAAAADEAPQWKRKSS
FT                   KASKRPTPGSSKLASSISKKEATNKRVEKAGKSTSRATPAVSSADPAPKGSRARRGAKV
FT                   AVPSQQASPARASRGHPGTLSASERKANTPGAEQRLASFSRDHDLVASPLLSSRSSSGG
FT                   SLSHRESRGSVNSVGEESADRFPNREHHRNCGLRPTPGEDTEEDDEDRRSISRAERVGG
FT                   HGASRSHKSVIADTGERGRSSRAQREGAKGQAWRTHSGASRTDHCRGRELSREGHRHLS
FT                   SCSPVRRHGSRRLTVGSLHGGALAHECLMKLRQHSREGGFDWPRPHHRRRSGEAPPHHR
FT                   CHCRSESRAKAPSPLCADRMPLHRTSFYDDYTDNDVYATAAVASLERFGDLSERCRRRS
FT                   SREGGDDGYGAAVVQSARSVASSVFSGDDVEEKEELLTSSHFDDRRSSTRGRRVDSALS
FT                   PRSKARYADSKPGETLCRQELLKYDHGDRRAFELRKGGSVHRRNGTAARNHRRRGAEWE
FT                   PDYYYWNEPRRGYSLDSGGCGCSWCPQSYHSPRPAAPPARESPLRSRCGLYRPDSPSDA
FT                   PPGEVRYQSLRPLASSPVRRHRARSAASGTQATPLRRASQSPASSVASVPLSEKKLLGE
FT                   VEWKLDALEKQIANEDAERERAMMRSPFERLYHLNNRRDRDERRNKVFQLSLLERIRDR
FT                   IVSGSLKEDIARKEERLRKQEEMLTSPNGVFVRLYQNSSPRRSSNAAAEGSDCKSVGEG
FT                   NRDGRASVNTTGVSSQRASTARSRMSAAESQELCNRLYETAAIVKQKKEAMRKQSVEER
FT                   QRQQAEELLIARLAGQIQLERSRTRASSKRRPKTPAQLEDEARAALEKLRKEDPEGYEK
FT                   KVLRGRLLSPAERVMQAERLWKHGYISKAKLEAQKKVLELKKCTFQPTINEFSGSAGVA
FT                   GSGETRGKGGGGTNDDKHLSAGTDRAQRHRKANRFEELYRKGIQAKVRGETLREERDRE
FT                   ARLRILRSRMVSDHHFRRRVELDPLLAERFMKSLVV"
FT   CDS_pept        complement(564409..567249)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1500"
FT                   /old_locus_tag="LmjF36_1500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1500"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1500:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1500"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S6"
FT                   /protein_id="CAJ09103.1"
FT                   /translation="MGIPDFVKFIARSSPSALCRVPKGSSRHEPLIFDFILIDATNAAQ
FT                   TLGLDTLRAFLNPDHVMARSAVIFALDSQRDRSGTARAHRHALVGIGDLDVHVQKLCGQ
FT                   LADAYCAQQGCNNRLGAGSGANPYVLMSGRGVAGEADYKLLDLQRCLVTCAIASGAAVL
FT                   PTFLFISEDSDVLCGALCGPAPQQVSIATKLQDVLFEPSILRLDRVLAFVATCTDAFYA
FT                   ENEKEAAAAAAAKMKAMTERNAAKATRANAFATAPATKHAGEHHSDEEVELSVKDTAVA
FT                   TATATAARDDGVVRRRKQDGPMVSTGVRIELADSSDDDQPEHVETKPTKVPTATAGASA
FT                   KAPVSEMGEVPIDGGECVEGASAAPTEGELLVSSIMHTSCVDMVFLFMIVMGNAVNVPS
FT                   LVRGATKVDSGSCWQAYCKHKYKNLSAADAETGRALLTPSINTHSTNRGTLVLNCHFLH
FT                   SILDAVHYADAEPRPPVEEEKSSAITYLSNAVYATLRYIVGCNLDRTPTLKQTFLDSRP
FT                   LSETPIMLPSLSAVMWVLGQESARTFSFPLHGLAKKELLVAASSGASAANDAADASSKL
FT                   AANHATFARDASSSTSDLDVGEHLVAPAASNAWAVRGARTSNVSLATLMVNFTSGVDRA
FT                   SSAARSAHYTAAGMWSAQLPSVSEMLKKALQMVSPASLAKANLLFYLMTVWTYALGLGV
FT                   RRMATLTKAAASVTKAEVGDPELSLAQSPSSAGTAKTLQVAPDTTPVSGHYVYSFELRR
FT                   MAPVLQAATSQPPSFITAASGRSAIPGRVDSTASSSSEKSAAQQAIFAALGVSYDYSKT
FT                   PRAPANVVNLPRCAMDEEDIAELQRLRKVAKKERALSALVVDAVPGKKRSANADDKDSA
FT                   SSDNDDGDIDRTRSTKRAKEAKNGTSKAKKRLGKRERLKQQKATAKAAAAEADGGSPRH
FT                   AGRAPRVHAPVKAATS"
FT   CDS_pept        complement(568195..568719)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1510"
FT                   /old_locus_tag="LmjF36_1510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1510"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1510:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S5"
FT                   /protein_id="CAJ09104.1"
FT                   /translation="MLCRNVSRSYSARRRCRPSVCVAFGALLVEPPQAAYLRRCAVSSR
FT                   ATATAASLSSDHASLSVCKRCEHTTTIATPPERVLTTKEQVDELMDSFAEACELITDAK
FT                   ESVGTTYFADDMEDAEKQTHDVLNRWESLQAALERKGTAEELQKVRNMYDLKIKQLKAE
FT                   LEAVREAGGAG"
FT   CDS_pept        complement(574041..575570)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1520"
FT                   /old_locus_tag="LmjF36_1520"
FT                   /product="putative nima-related protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1520"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1520:mRNA"
FT                   /db_xref="GOA:Q4Q1S4"
FT                   /db_xref="GeneDB:LmjF.36.1520"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S4"
FT                   /protein_id="CAJ09105.1"
FT                   /translation="MSGGNAGDAMIGRVCRNFPDTFAKDEATAREQEKKYWISRVLGSG
FT                   ATGTVLCAKRVSDGEGFAVKCVDMEGMSEADKNRAQAEVDCLLNCDFFSIVKCHEDLAK
FT                   RDANNPEMVQMIALVLDYANAGDLRQEIKSRARTGRTFREHEAGLLFLQVLLAVHHVHS
FT                   KHMIHRDIKSANILLCSNGLVKLGDFGFSKMYANTVSDDVGRTFCGTPYYVAPEIWRRC
FT                   PYSKKADMFSLGVLLYELLTLKRPFDGANMHEVMHKTLAGRFDPLPSNISPEMRDIVTA
FT                   LLSGDPGRRPSSSRLLNMPICKLFLSGLLEIVQTQPAFHGGLRDSISSQIQETKRLLVT
FT                   EKRHIQRMMEESSGSSVAASTTILEGATPLTTALGGLTIHEGTVKKQSSDMVWKKRYLC
FT                   IRAELADGQTVLDMNPKFKTLDMVLAISKETMEQQCISTPFTELEDAFPVPAKYTGCNA
FT                   SFVFAVAFKTGKRLSFQTKSEVERDLWMEKIQDVLGIGDGDDDMSALPAKE"
FT   CDS_pept        complement(580649..582154)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1530"
FT                   /old_locus_tag="LmjF36_1530"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1530"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1530:mRNA"
FT                   /db_xref="GOA:Q4Q1S3"
FT                   /db_xref="GeneDB:LmjF.36.1530"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S3"
FT                   /protein_id="CAJ09106.1"
FT                   /translation="MAAPSDALIKKVCNAFPATFGVDTEEERSPAEGRLSRPFRYYLDT
FT                   VLGSGTSGTVLYARRVRDDHPFAVKVMDVEGYTPQEIMRASGEVCCLLSCDYFSIVKCH
FT                   EDFVYSDERNPESVSMMAMVLDYANAGDLRQEIKSRSKTNRPFAEHEAGLIFIQVLLAV
FT                   HHVHSKRMIHRDIKSANILLCSNGLAKLGDFGFSKHYAATVSEDVGRTFCGTPYYVAPE
FT                   IWRRRPYSKKADMFSLGVLLYELLTLKRPFDGEDIEEVMHKTLAGLYDPLPDSISKEMQ
FT                   TIVSALLQSEPKKRPSSKTLLNTPTCKLYISVVREIVQSGETGGFSAEQETTIARQLKQ
FT                   TKEELQVDRRRPPLSMEDVLRTTVKVSLSDSPDRIGFILYGGKVMKQSSDLSWKRRYVC
FT                   IYGEVEKGCTLTDDVASCLVSLELVQAVSRDTLEQQCISTPFSDLEDVFPVISKYTGSD
FT                   AAHAFAVAFKNGRRILFDADDDNDRDGWMRSIQSFLGIGDEDD"
FT   CDS_pept        complement(586650..589454)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1540"
FT                   /old_locus_tag="LmjF36_1540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1540"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1540:mRNA"
FT                   /db_xref="GOA:Q4Q1S2"
FT                   /db_xref="GeneDB:LmjF.36.1540"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR030731"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S2"
FT                   /protein_id="CAJ09107.1"
FT                   /translation="MSLLQKNAVLKKYRREYREQDATRSSSKEEGQTEEGGDDDTAVYP
FT                   NVNAFQALGSDAGGALASPSSSPRFMRCVETTQMPAIGAPSVKVWSSGVSSGFRGTTAA
FT                   SVSMHSKATATATAGPSTVSTIRSPFPHQDGGGEANHAAPTRSLSPRNHTVNAGAGAED
FT                   KYFDLDNFIAPLGPLPLPPLSADGAPPALAPLGRRGADSTGPRCWSSRSDLSGEEDRAI
FT                   ADTHFQSPPTDPCVSPTTGTIGGEAFMSITDVPEASRSNHVTRATATSGLAPSAGESFG
FT                   LASSVGGLSSFALAAGKPKTPTGGGAHVRSSPQVSTAVQRPIEVLTRVHKGPSGEEVSS
FT                   SSSSPSSSFTVTEQEDDCGDVDGKPTTLREEAVRQLDLACANATHESHPAKECKNSSAS
FT                   AAMRLDISDTLLQPPTSILSEPSTVTVQTKDKSAVSHRSCGGAAANGSVESRRVAYAAD
FT                   GADASEEGAFSPVSGMDDNERASYAGMADDRNIPYADNRGVVFMQQVLSFSGTAHSLAR
FT                   IWDDEDVDVDPLTTDSMRLPPRALPPITFYEAYLELTKALRSGDAIAARQAEERMTDRA
FT                   CSSTVLQQAAPPVMALPTLKKAARAAILSCCGGTASRASTVAKQPQLSTAACNGPKRDE
FT                   LSGVAPAGETASARGGPEEHLRVIRALKSQPLSLQLTTHRRMLLTIFNTLTGKIPWLSR
FT                   NVTSSEFTPVTSSQPSSSTAVKWESIGFQGSNPATDVRATGVLGVLQLLYLIDYYPAFA
FT                   QRLWQLCCDPANEGASHSPSRNYRGGEPPVAARRARVSNELPFVLVCFNFTALVLDAAG
FT                   QHILDEEVQKTANGKRPSFTSHKAAAKTTRPAAHPSLYAGMHVCCECYVGALALFVEAW
FT                   RARPKAGAALGGNVKLTVPANRPSIADFGDIKARLRGKLLRKGAAKIMREAAFQVRGPV
FT                   EQQE"
FT   CDS_pept        complement(593145..595691)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1550"
FT                   /old_locus_tag="LmjF36_1550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1550"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1550:mRNA"
FT                   /db_xref="GOA:Q4Q1S1"
FT                   /db_xref="GeneDB:LmjF.36.1550"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S1"
FT                   /protein_id="CAJ09108.1"
FT                   /translation="MAKRTVSKLAVGGDHSGNSTVPDASICSSTVDDEDASQDRPATAL
FT                   ALCEETTSTEAAAEGALSAPLSWPFLCPLCSAVELVDPVDLHERPKDTLSPSSFHSKTV
FT                   DEAVHCLACRACVEQWLSAVRAFSEGQAETMDHTGGATSATTFSPLSASACDGATLLAC
FT                   PLCNRTCDATILSHSGPIAGVAHALDASVVRNSYTGSQPLSCITKTGSGVGRPSAPAAS
FT                   ASPFCSICEEAKAMCVCLQCDFGMCDTCHRATHAKGGFRQHEVLSCEQARRRGNQRCTQ
FT                   HAGMALDLFCDTCSTCVCVTCCFGGAHRGHEVFPLADVASRAAAALTQHSTELAALQRD
FT                   ADATSVQLASLWPAYEAKVDDVRTEIQQCFSSLRQVLQAREDALLSRLGEVSAVVSRRS
FT                   SALRSAMHAISSFLGSTGERLRRLPGSVSPATLMRILDTVHEQQQWVSRVSTRVIEQAT
FT                   AVAEGWSYHMCSDSANGCRMASFVLLNSDTPNDDGLRQYKRVLADLGRLDASADVQLPL
FT                   AVQGSAGSVGTAKGRDNREEESAAHHLWGGMAEDHTEPRDGLANGAPVALRGDSDAIFD
FT                   AGANVGEGEETLLVRPSHIDPATPSLPGQTAASKCREVSMAYRGRDRGGSRQRSMSAST
FT                   VQSQPRQPHLFPIGASTQSTRGRLLTYELNVDPTLKGAGAVAGPAAEATTASGTPRLTG
FT                   VASKWGAVKQDLWEVGGCGSFAAELGALGRQKTGCAAATRDVRDTIPFRVSLPPQRVES
FT                   HDRMDDDDRSVSEADDQLPWRALKLHHNSSVQDGVRSTATSVPRHGSTARLHYLTELDL
FT                   RKPSEVAHGALDSSLAAPKQGRAESQRRTTGLQLEL"
FT   CDS_pept        complement(597926..599437)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1560"
FT                   /old_locus_tag="LmjF36_1560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1560"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1560:mRNA"
FT                   /db_xref="GOA:Q4Q1S0"
FT                   /db_xref="GeneDB:LmjF.36.1560"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1S0"
FT                   /protein_id="CAJ09109.1"
FT                   /translation="MPAAVNVCVSVALPCRGDGVAAPTPAAQSGEMHDLTLEELKGSLS
FT                   DLGYNPYGELVYTRSHLASKHLRALPGLQRYVHLQRLCVDDNGLTELDAVRYMPQLVHL
FT                   HARHNRLTSDVFVSLAVAAAECLEHLHLDDNCITSLDGLEKFPFLLDFTCCRNRVQHLP
FT                   ARCLATAERLRHFSLSDNALETVDINAFAATRPLRVLDLSNNSLSSINFLYSVPPQIEK
FT                   VNIANNHVRHLSAALKQLPCLTVLDVGGNELSGLKELRVLRCLKALRTLTFAGNKALEH
FT                   LSHHAAGERGRLGDPLPTTAQGTEYDAEVVMSDGEDNGGSLCSGGGGGGFNAPTRTTAA
FT                   TAGAASAEVVAAEGENAPDTSSTLFPSASAISKVTRNADNAADDHRAGTKTITGWKSLD
FT                   SSAARATTPTTAAYVDLAASEMYAFVHAVGSARRDGELDVRVHHQKEVLALPQQEQVYL
FT                   WTLSVLPQLTEMNGRLTRPEEVAKAAFLFRANAAKQEPEKGVFTE"
FT   CDS_pept        complement(600609..602039)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1570"
FT                   /old_locus_tag="LmjF36_1570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1570"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1570:mRNA"
FT                   /db_xref="GOA:Q4Q1R9"
FT                   /db_xref="GeneDB:LmjF.36.1570"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R9"
FT                   /protein_id="CAJ09110.1"
FT                   /translation="MSATHSTAESGVSSLQRSGLSITVGDTKSIVLALQALQSKIRSLE
FT                   QDRDFHQDQYEVALQAHERYKLDMERQMEQERAAHRKREADLLELLRKAREERAQLEDA
FT                   LSGNKEDLGGCRRELEQMIASEKELASQRESKISMEVAKLRTEIKEEQTHRAALLVTVE
FT                   KLKEEREAALKTNEQLRVAMDGLLTRYEQLQRRRPAPQAVPHRYSSSGAICETHSRAAP
FT                   AACAHPRRSVSSRTRSPGYAPPRELQRPALPARQRKVSPSLHHNYEDPTCSSILRDVRI
FT                   VPEEAPPCAYPSANSSMHHSQQEAAETTGKATAARSGQGLRTQATAAPSRSGRPSPARR
FT                   PPETGAAGPSAHRTTAIDEVEAQLRQELAELQHRYDDTIERGSSEEAPREVLAAALHRI
FT                   TALLEQKKEQLKLLKEARMELEEAVSLSASRSTNTNRSMNGGRGDSPSTLAMQDKHTRR
FT                   ALLVNELRSLLAEAAKGS"
FT   CDS_pept        complement(603667..609153)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1580"
FT                   /old_locus_tag="LmjF36_1580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1580"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1580:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1580"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R8"
FT                   /protein_id="CAJ09111.1"
FT                   /translation="MAGYVLQTPFPATSLAPPPSPLGASAAHHSISLRRQALRQVSAEE
FT                   DVRLFDDLSLPCFSASQRRPVSPTKHDAHKAGLEISGAVITDASLQMSPGTATNNSVHV
FT                   SSLRSGSAGLGEWLHVPPLSAFEHPDAWLREYAFLRAKLKRPADSVTVYHDYAASLNSR
FT                   ATMRHACVVHPLPDLEKVQEALRRRFQAQAPATSYEVCEQQCAADSCAPTEWDNNAVSM
FT                   AAAPETADALRGAHREQRNDMFLPPATLWCVGGSSYENEIVVRNAVTGQRLLRILDPKM
FT                   RVAVTALQHAPFRGFMKVHQLHVLPVREPHDVLRLKASQLVFTDYVWCGLQDGSVRLVP
FT                   ANHHHVRACGASSPFSKAPSAALVYELPRYQGGAIVSIVCSPCHDAARAFGDSPKWGLP
FT                   NRVSNAIQCMTAVLGADVDSAAAAGQADGEPVDPASRQHLSLVCIAATDASVVIWDARQ
FT                   VYEAVATVQQQRQEQNEGTHSSGASVFRHGAAGSLAVGGTAASGTPFCFDASASLSGVT
FT                   GVSSDVITFDCSSPVPGLQNMQVRSSCTLIQVKPLAKLSGGFAGLTALRWVSSLIVAGG
FT                   CDAPTSHHPRMATRDPCTAPCRGEETPRIELAQTKTRFDKREEQRGELELTEEEMQGVE
FT                   RELEHMMPPLAAEPAQSLRVNLLVASDCMGTLHLWNLDEELHRCSEVKESALGWPASFG
FT                   AFYYSSLRSMSSRCDGRSAASHGSGASQPTSGTSNASARRTSASKGHGGTRRSDRVPKS
FT                   RRACRGLGLAEARENRARLSELSSNRPTSGHKSDGEAATIRKNLQRPSIGRSSTEEHYS
FT                   SQAAQGRSPQTTAEREGLRLSDGHGTVPALPTSRKSLVAPSATVQQCPPLHNALPPHHP
FT                   SSAKNAVPVSGPVKAKKVKKSRNSVHETSVSMFRSPQQSTSPSRGTAHLPSTSPGRLSE
FT                   SRHPAQPKTGMHSRASVQRGASITARNGCGTGSTGQDLSMPTQAAKCQIRFVQGAAAAI
FT                   ADVAVDLPPHIRTTLRRIPKPSNRVASWQHRPTEEEVDARILENEFEELTEERALFFAF
FT                   QRLEMYVAVDGAMSTVRCFPEWLLPDEDEQELFRQRNGDDGREAGGDLATQETTGAAVR
FT                   GWMAEVAMPDRMNMGAFDLHLRKRLLDVHAQPITQLFLDSWQGLLWVAREDGFAWIFAT
FT                   RDKSVVSRMPHPSADALLAPPSAQEWAKLQEQGLARSHLSDARVANGFGLECHKECRDL
FT                   PPTHLTQVLPIAVRPQRALLLCCSAAGGCHEGTSDCLAAATVTESPGRSCRRTLSLAEP
FT                   VAARDPPKPSAPKLLPSLSCSSNTTTNNSGIISVPRSCDAVALVCVDGRSDMKNLAKSR
FT                   EVQQWRWLRQLQLCRAESAAVCQAQRHRYYALCEVIGRKAGHVIQELGHYAFQSRLRTY
FT                   FHLWKDHLALFRHTHLMRRQRTARLERERALARRLECARMAQVCDAYYARWQRLLAARR
FT                   CRRQEEVLARFARAAVAVSHDRRTSRGTCCRGPLPTAAMMGHFHRLSALRACWRTWQAW
FT                   ADAQRLQHRCQKGLNALQQYPPPLSSTRSFTSSATSMATPPRRVVSGHRAGADGFAAEG
FT                   TTTPFHSIHSGGVYLRAASLSSPPASAYRPTALGRGAVAPQLACTQSLTEAVPTALPPA
FT                   LEALLAELLRARVFVFHFSDARSSATSVLDESWSVILENAESGAETDDDDDRRFSVFRF
FT                   ALLPLLQGLISTAEEVLPNLFNESVAEEVLSMLVGIVLAMDYVTANAEATWWTLREAAV
FT                   LTGCSAFVDGTEPMRSTFDASLLVLRAYAVRAFASDPEAAEVLRGLANGKKVLAQFLDF
FT                   AMERAVARRMEHL"
FT   CDS_pept        complement(611817..615446)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1590"
FT                   /old_locus_tag="LmjF36_1590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1590"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1590:mRNA"
FT                   /db_xref="GOA:Q4Q1R7"
FT                   /db_xref="GeneDB:LmjF.36.1590"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="InterPro:IPR039662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R7"
FT                   /protein_id="CAJ09112.1"
FT                   /translation="MSAKKSTRARGMPSSRASQYPDEADAVSQAYDVSSLPMDDAAATP
FT                   HQRSGPRPKKVSKKESQQDSSAAAALDGAIIATPQPTLGEAETASLAESTLQFLVDGTS
FT                   VVSSVAEAILSVYRGGAKEGALCAVLNVLAKASGVAEVELDASALVDGVEIGPLLEELY
FT                   ARVPEDSEAYLLVNKDAKYKRFRRTFPEWCASLMQDGFASDVLLDGTFLPILSQWIIAM
FT                   SESKSRSFRHTATVALLAFVQALSSVAANLQSQLSLLRSKKTIGAVQRKRNKVVEWRDH
FT                   VFSQAIHQRLRDIAPDIRLAGFQALRRWILEFPEEYMTNKYLRYLGMPLHDKRPELRSE
FT                   ALDTILQALAHVPDAYSRLHLFLQYFTSRLVELSNDVDVRCTELAIRVVAMMVRSDSDV
FT                   PEGSELLSNERVDQVLLTLFDERPSVRAAAGILLKVFIHCRTAAEESETAQVSVATELL
FT                   CSFAATLRSQYREAMPEKYLIDALWTPERPPLLLTDFQPILAAAQSDKPLDAVVGLQLI
FT                   AALLLKVQGRLTLGPLPKDDRRGGTVTASRKIPLAAKGEADALLHRLSEDAAHALPTIL
FT                   EVHCGSEDVLQAAAEVCAALDFSTFTSQSHQAALSALLIELRKATLNTSCTALEMRESL
FT                   TKAWHQLAFTEHPLHNEAHAHLQELLKNVMAQFSQAVRASSRSSQGSSSADAADLLHAW
FT                   ARMNLGSALVPMGAHWQQIQTALTGILAAQPAADASLVMLVVGTAVQCLLWQVHSSADE
FT                   ANPALSLSQLKAHVRDVVAGVLQYQAETEEEAQATGSPGAAADGAAVLARAEVFVYLCD
FT                   LLALPYYDLAQAQQEMLVRLLRGLYERVSAELRCAQDYLKMHVLEHRAQQQQRPSQAAS
FT                   WAPAGLTELVAARRVCSRVEALQLRLVTGVARLFLFKRLDAILAAPFLSLWTHTSSKAV
FT                   SDAFKSLFHTLRDRAGDDGFTLERDILLAAYHHCVEVGATPFSVEALYQIGLKLSSVHF
FT                   VGTDRFYSCCPAMVRFGADFAASTDPLLLQAVSSYAGKLRPADALHVLRDQLSRCSLFT
FT                   EATNSYVLALVTALRKAAKLDDSTAPSSMAGGKRQRALAGTTQLAEEEGMLNAITQGLS
FT                   EGSNAATGAASSSALPVSPGQRISVASRVVTADGWHVRAAGASQGNAEDAVEVEVSQGQ
FT                   RTSAAARPRHSVVNVPTTQETALSSLANGLDSDEVFVATEEYV"
FT   CDS_pept        complement(616764..617135)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1595"
FT                   /old_locus_tag="LmjF36_1595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1595"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1595:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1595"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R6"
FT                   /protein_id="CAJ09113.1"
FT                   /translation="MPRKAAAAAKKERSPSEKSVSSVDSISSLPAIKEARTEDATVAAA
FT                   QVPPRPLSPPASSAAMPAAAEEVVPLAALVAVNVDRNEEASFGLLKEPGPPSADVRRVT
FT                   KEGEGAPAIPTDLLQLLSG"
FT   CDS_pept        complement(618206..618997)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1600"
FT                   /old_locus_tag="LmjF36_1600"
FT                   /product="putative proteasome alpha 1 subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1600"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1600:mRNA"
FT                   /db_xref="GOA:Q4Q1R5"
FT                   /db_xref="GeneDB:LmjF.36.1600"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R5"
FT                   /protein_id="CAJ09114.1"
FT                   /translation="MFKNEYDSDITTWSPTGRLFQIEYANEAVNNGSAAVGVKGRDFVV
FT                   LAALKRSPVAELSSYQEKVFEIDEHVGMSISGLVADGRVLARFLRTECMNYRYMYSHGM
FT                   PMNQMADMIGEKHQRHIQFSGKRPFGVGLLLAGYDRQGPHLYQTVPSGDVYDYKATAMG
FT                   VRSQASRTYLEKHFERFTDCTLDELVTHALKALASATSEGVELNVKNTTIAIVGKDTPF
FT                   TIFEEESARRYLDGFKMRPEDRVAAADEEEVLQEQPLDVEE"
FT   CDS_pept        complement(624929..625276)
FT                   /transl_table=1
FT                   /gene="UMSBP1"
FT                   /locus_tag="LMJF_36_1610"
FT                   /old_locus_tag="LmjF36_1610"
FT                   /product="putative universal minicircle sequence binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1610"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1610:mRNA"
FT                   /db_xref="GOA:Q4Q1R4"
FT                   /db_xref="GeneDB:LmjF.36.1610"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R4"
FT                   /protein_id="CAJ09115.1"
FT                   /translation="MSAVTCYKCGEAGHMSRSCPRAAATRSCYNCGETGHMSRDCPSER
FT                   KPKSCYNCGSTDHLSRECTNEAKAGADTRSCYNCGGTGHLSRDCPNERKPKSCYNCGST
FT                   DHLSRECPDRH"
FT   CDS_pept        complement(628688..629215)
FT                   /transl_table=1
FT                   /gene="UMSBP2"
FT                   /locus_tag="LMJF_36_1620"
FT                   /old_locus_tag="LmjF36_1620"
FT                   /product="universal minicircle sequence binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1620"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1620:mRNA"
FT                   /db_xref="GOA:Q4Q1R3"
FT                   /db_xref="GeneDB:LmjF.36.1620"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R3"
FT                   /protein_id="CAJ09116.1"
FT                   /translation="MPHPLLARSSPPFLHSPPPPPRRTRARTCADSRPLESFPAFSRLL
FT                   SLSLSHFCRSRPSIIMSAVTCYKCGEAGHMSRSCPRAAATRSCYNCGETGHMSRDCPSE
FT                   RKPKSCYNCGSTDHLSRECTNEAKAGADTRSCYNCGGTGHLSRDCPNERKPKSCYNCGS
FT                   TDHLSRECPDRH"
FT   CDS_pept        complement(631832..636874)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1630"
FT                   /old_locus_tag="LmjF36_1630"
FT                   /product="putative clathrin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1630"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1630:mRNA"
FT                   /db_xref="GOA:Q4Q1R2"
FT                   /db_xref="GeneDB:LmjF.36.1630"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R2"
FT                   /protein_id="CAJ09117.1"
FT                   /translation="MDSPSISTEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQG
FT                   DGPTSLVIVDLEKRESIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKATL
FT                   FHEDVAYWRWIDDRTLGIVTAKAVYHWSLDTATDAPQHIFDRSADYDSSVQILSYRSDE
FT                   QKKWLVVTGVARDPSGTMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMCL
FT                   AWNSPQQGGQVMIMELPTGSKTDLSVLRRVYSVHIQPGDFPVAMNVSDRHKLLTVATSR
FT                   GSFVLMDIFTGTILVEQQFSSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNNDGIIDFV
FT                   KNRMHNAELALRIASTANLGGVDDLFKVQLDNFLRNGNVEEAVRTCLRAPGNSLRTREI
FT                   LMRFMQMPQQPGQPPAISTYFKIALAETSLNECESVELARAVVPKGGIGYVKQQFDEGK
FT                   LTASEELGDLVQQADSTMALKIFHQGNAHAKVLNLLLQRNETQKAVEYCKRASFSPDWR
FT                   VIMNNFIRVAPQDAVNLGLMLYREMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILRN
FT                   HNDESTMELQTKLLEMNLKYSHPSVADKIFVRKICQCYDGMRLAPLCERAGLHQHAIDC
FT                   YIMAQQQDSDLNNLASIRRCLQQLQNFNPEWIVDFFGKLNKQDSLKCLEDLCTDSRQNF
FT                   KVIVQVATKYSDALGAADLINLFLEHSLYDVLYYYLGAVVPYTRDPEVHFRYIEAAAEM
FT                   GQMQELERMTRESPCYDAERTKNYLKSKQLTDMWPFINVCDQHNMVNEMVHYLVETGNE
FT                   SFIEQYVTRRNPGKTPQVVQALIECNVSEERIKNMLTVVGAMCPIEELVDRVEEVGRLH
FT                   LIKQWLEDRRSEKKTDKALYNALAKIYVDIGQSPEQFLSENEYYDAQVVGKYCETRDPN
FT                   LAYIIYCCGHCSEMMIDLCHRNGMYKQLARYLVKEQSLDLWASVLGQNSAERQQLIESV
FT                   QQIALPESESSEEVSTTVRAFMNANLTEELTSLLGQIVVHGRFRKNRFLENLLIMSAVR
FT                   ARKDKVMEYVTTLEDYDAKDIAHVASGAGMHEIAFVVYTRHNMQKEAMTVLLQDMNDIS
FT                   RGRAFAQKTDTAVVWSMLGEYLVKQDEVNEGIECLIRAKNPDLVVEVTSAAERTNQFGD
FT                   LIKYLTMARQCSRAKDNKIDTALVITYAKTGRLEELEEFLKQTHNVKIGAIADKCFQDK
FT                   LYESARVLYTVANNYARVASTEVMLNNLPAAVEAAKKAKSIHAYKEANLACIEAGDLKL
FT                   AGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVLRNASSHQGAHMSIFTEMGVLLAKY
FT                   RPEKLMEHVIMYAKKINTHKMITVCEQYHHWVVLRVLHTNNEDWLAATNSMMQHHADAF
FT                   DHEIFKDAVSHLGASELLYTAIGFYLKTHPDQLNDFLSSIFKRVDPERVMAETTKVAPI
FT                   HVIRTYLEAAQERNAKKVNEALNNLYIEEDDFKALRHSVETYNNFDSEELSSRLEKIEL
FT                   FEFRKIALLLHRRNKRYSHAIAVAKANELFEEAIDTAAESGDSELVNKLLDYFAKDYPE
FT                   CFAACLYACYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQDYSSKIEKMEKLMMDAQTA
FT                   AKDAARRAGPVQDPRSVPLMIEQGGGMPMNGMPPQFGSGRPF"
FT   CDS_pept        complement(643944..644351)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1635"
FT                   /old_locus_tag="LmjF36_1635"
FT                   /product="putative poly-zinc finger protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1635"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1635:mRNA"
FT                   /db_xref="GOA:Q4Q1R1"
FT                   /db_xref="GeneDB:LmjF.36.1635"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R1"
FT                   /protein_id="CAJ09118.1"
FT                   /translation="MVCYRCGGVGHQSRECTSAADSAPCFRCGKPGHVARECVSTITAE
FT                   EAPCFYCQKPGHRARECPEAPPKSETVICYNCSQKGHIASECTNPAHCYLCNEDGHIGR
FT                   SCPTAPKRSVADKTCRKCGRKGHLRKDCPDA"
FT   CDS_pept        complement(649039..649854)
FT                   /transl_table=1
FT                   /gene="HEXBP"
FT                   /locus_tag="LMJF_36_1640"
FT                   /old_locus_tag="LmjF36_1640"
FT                   /product="putative universal minicircle sequence binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1640"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1640:mRNA"
FT                   /db_xref="GOA:Q4Q1R0"
FT                   /db_xref="GeneDB:LmjF.36.1640"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1R0"
FT                   /protein_id="CAJ09119.1"
FT                   /translation="MSETEDVKRPRTESSTSCRNCGKEGHYARECPEADSKGDERSTTC
FT                   FRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYKCGQ
FT                   EGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYS
FT                   GAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSTGSSDR
FT                   ACYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPSS"
FT   CDS_pept        complement(650928..651836)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1650"
FT                   /old_locus_tag="LmjF36_1650"
FT                   /product="putative proteasome beta 5 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1650"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1650:mRNA"
FT                   /db_xref="GOA:Q4Q1Q9"
FT                   /db_xref="GeneDB:LmjF.36.1650"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q9"
FT                   /protein_id="CAJ09120.1"
FT                   /translation="MFADFESVMLSNFTLDDCPRVGPFTYHNMDEDTLEEPLSLCSYRR
FT                   APQQTTERSPASCDAVTADPLDSSRYLHGENRCWTLTASCPVPRAIPKIDMKKGTTTLA
FT                   FRFNGGIIVAVDSRASTGQYIASQTVLKVLEINDYLLGTLAGGAADCQYWERVLGMECR
FT                   LWELRNGSRITVAAASKILANITYAYRNHGLSMGTMLAGWDEFGPSLYYVDDKGSRVKQ
FT                   DLFSVGSGSIYAYGVLDTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHVHEK
FT                   GWTKISRDDQTKLYDRYFPSQ"
FT   CDS_pept        complement(652829..654913)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1660"
FT                   /old_locus_tag="LmjF36_1660"
FT                   /product="putative tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1660"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1660:mRNA"
FT                   /db_xref="GOA:Q4Q1Q8"
FT                   /db_xref="GeneDB:LmjF.36.1660"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q8"
FT                   /protein_id="CAJ09121.1"
FT                   /translation="MVDVEKYFPRAVAHLKAVSASAEATEESRARRWHDTTHEVNADGI
FT                   VTPRKRAERERRESGLGSFFDEGGLDVRGGMADKLKSGAYGSARDPVERDSPDILKLTG
FT                   GNARRHGGLRLATESNAAPADQTIEGDRGDAGAYREFGDTPVQLTDMLRERLMELKAGK
FT                   LREERSETFLPQRLRHRPAEELLMLAQQGEAAGVEAGGRVATLQPTPAALQRKVAQARS
FT                   RAAASTLADLVPKDEEEEEKAALLGDAARDGARRGACDRAILQDGVSPARVANAMQAVS
FT                   GTDDSVPGASLHDPLRRLAAIAAITGRRASVFGTGDGASVSAEGVERVGFVHLLRTLPR
FT                   AGFCSRREAAAIIASGQVRVNNVTERNPFRLVQAEDDVHVAGHQSRLRFAPPRLWMYHK
FT                   PAHVIVSRSDTAGRTLITKHARILGMDHLVPVGSLPMRAHGILLLTNDGELSRFLENPK
FT                   SMVQRTYLLRVRPAFDPVLVHKLNTEGVHINGRPYRNAEFFVNPATKSRYSVKVKVRGE
FT                   SMPIAHLMQHLGRTVERGGRISFGPFALSNLAVGSVREVTIPPFYSQHLGAVWQPFIER
FT                   DWPYFRRQRVSRLRRLCKHRELTPKELEELDNYTYEEVKDALNFESSELQALAEQRAQQ
FT                   LRRARHLGDDMLPLPDDFPKESCRRSVGDVAVDGATAPFADADEDEDEDVIVEDITFLR
FT                   "
FT   CDS_pept        complement(656222..657859)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1670"
FT                   /old_locus_tag="LmjF36_1670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1670"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1670:mRNA"
FT                   /db_xref="GOA:Q4Q1Q7"
FT                   /db_xref="GeneDB:LmjF.36.1670"
FT                   /db_xref="InterPro:IPR019438"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q7"
FT                   /protein_id="CAJ09122.1"
FT                   /translation="MAHSAPPSYTGESVRSSICRLYGQRSDLPLTVLHATVPPVAASLV
FT                   QQRSHVLDAIFDCIHDQLYPKDSAVGENADTRSSAITNHWLRSVPESLLFDEAAVVNYL
FT                   GMVVAIDFCHWAEVPCKAGRTATASVGEEVTGFAGFYAAVDPPSGASAVGNGGTTASAA
FT                   VAELFAEPPSAVGKELGTLSTAAAAAPTLLRGSAAMMYLLRRAVEVHRLPWFCPDFLQR
FT                   FRGDTAAATSALRVCFLGCEQDGVTPLWMPCTRERVELLLSLADAFVARQTSYYKLLRA
FT                   CGGLLFAPDAAAAATAPCGFVPTLVRLHRRYADFARVPVEGPGCTGGNTGEAAPDVCIV
FT                   PVLKLSQLTALAIEQALPVLWRYQAASSVSSKSLHSKLPPSAPANCWLTDRAARIARSG
FT                   AESRTAEPESSLSGVFTDSAKLSICCDYQIPKALRAAGLLVYDDHLARIVDRHVLLMPG
FT                   SAEEVSIRVATLIAAERLLQFLNTPPQRQSSLARELDATAAGVPGAPAQLPAKRLCSGI
FT                   HLDYALWYVGRYMLPSEARHHLCRTIMY"
FT   CDS_pept        complement(658577..660925)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1680"
FT                   /old_locus_tag="LmjF36_1680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1680"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1680:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q6"
FT                   /protein_id="CAJ09123.1"
FT                   /translation="MQRYLQRTVPVAPLRLSISGNSSTEGVHADAAPLLESRFLRRLRA
FT                   EVDREARAEQLCKGTAARAIQQAFRRWAQTRQLQHRHLSIHGIVRPRCEFDPIRAAELD
FT                   AALCSIQASLRVWASSRLVEARRLKLLQQITSSVLDPACRTTLRCAASIRHINDRQLRE
FT                   VLCRQEAVERRDLLRRHFVFLVCCHQAFFNDPRMWDAGMSIRRIPLYTHHGLLSAETLP
FT                   VIWGTRTSSSTLNSATEDSVALRGDAVASPLPPESSSFSVTATVDGCIKGWGSPAEPGS
FT                   SLLEAVGSDWLVGKEEDGGGFDIDAALRLGEYRLLFSPEEWRLLKKLKASSPHPASPLL
FT                   SSGADGRRAARDAAGLPEAEAGALAAPRGQLQMAPTEAAAKSACSLSYAKAFASALTFL
FT                   RQPRMVDPSVRCTVQRLNDIRSSTLEMQQELRVHGYLFAAQVAPLLILGFHYQGLARGD
FT                   ADLSCFTTTSAMKTCRPLVAGRVACAATELRRCLIGAVHYSGGAAESVLPVALEEHKCS
FT                   GKAAARTLSQRLPPAGVSRSMLLPPRAAPTAGLMRDGFANPGTEALYHAPAKTTRRAGG
FT                   ADPRCGSSHTASRHGSAIRVALAAEWSRRLASSADEVGPYWCEFLSSTGLDGLVTAAGR
FT                   RGETPGEADAAYQTRASLPSPPLPTRVRRGLESHLVHGGSSYLLQDFMPSLMRRRAHSR
FT                   AGPQPLDAATGSVVVAVACAGASPSTSVSTSTCGMVHAGEWWDAVERLLLREYTNRREL
FT                   LTNEAVQRSSIDILRCTAHPSADESVAGV"
FT   CDS_pept        complement(662060..662986)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1690"
FT                   /old_locus_tag="LmjF36_1690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1690"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1690:mRNA"
FT                   /db_xref="GOA:Q4Q1Q5"
FT                   /db_xref="GeneDB:LmjF.36.1690"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q5"
FT                   /protein_id="CAJ09124.1"
FT                   /translation="MGSLSSSSSSSAATGAGAAASQTDAQEVTPVDSLWSPHDVCEAAV
FT                   DYVLRHVNTVQYMIQSIEEITGKPFLRDRIKCLPAVPRDEASRNPTMGLTPDRVFAGYM
FT                   WRSARSDCQAKDVVLLEDHIARLFNTKHATAFLKKDKGVNERAASPPTTSDAAATAASS
FT                   LSTTATQSQLQRLLAGSQLPVLEQVERNIRHELVHAFDDARGAIESSDCVHQACSEIRA
FT                   ARLSGDCFVGQEMRKGRFNFFEGGQKCVRRRAVMAVDRNPVCRGFSERAVDTVFQKCYS
FT                   DYEPFAAPIYALGSYGDSQFANGTLKL"
FT   CDS_pept        complement(665762..667402)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1700"
FT                   /old_locus_tag="LmjF36_1700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1700"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1700:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1700"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q4"
FT                   /protein_id="CAJ09125.1"
FT                   /translation="MLSDNDLTFHIPSAGLRRMDAWTAPNPSVFSHLHLVGNPDWMSSF
FT                   SASPQVAAARPALAPPAPVAIEPSAPRPLAAPAAIDAPAPATKKSFLSMFYRGSSNTVS
FT                   SSVMPPKTSSASFAPMSAPPKALDAFDTPMQRALPVDAQLSVEHLSKLDAVDATISAAP
FT                   RREPPHPMALGSDTWNALSSVPVPAKTAAGSARLLAPPASIDAVFSRDSKPLWSDLSFA
FT                   SRFRSTAPTLEAFRNAPPAPILSTPPRSPQHQATSSTATVATAFIPVPPKPVTASPLRD
FT                   TAVSSVEAAAPATMPAARREPRAMAHPLVPVGEDAPAVVTPLLKPVQEIPMVSSKSANL
FT                   APSTVNATPPVWGPEPLSLASREPEPSALALPTEFAKSISRPTMQEAQRDEARAAANVR
FT                   NFISTLFSGSGSDEMDSSTAGNRKADGFNALEFVTNRRGAQAKASQPVDYSTFFNTSLF
FT                   EDDHDEDSEEGLEKLRRVVLMVMQSAKNSEGTCVSQPTSQSCRRGGGVDATGVAALTTF
FT                   PSKYTEFSASYQTANNNNADDNEWMQFAR"
FT   CDS_pept        complement(669223..670386)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1710"
FT                   /old_locus_tag="LmjF36_1710"
FT                   /product="putative
FT                   phosphatidylinositolN-acetylglucosaminyltransferase subunit
FT                   c"
FT                   /EC_number="2.4.1.198"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1710"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1710:mRNA"
FT                   /db_xref="GOA:Q4Q1Q3"
FT                   /db_xref="GeneDB:LmjF.36.1710"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q3"
FT                   /protein_id="CAJ09126.1"
FT                   /translation="MSRSFSSSESLASSQQRLEAARYAASTEEESSLPESGDYDRRSQE
FT                   TRHYSSHPDHLQRVPSKQITSVSPLWRKVLYERQPFEDNYVDPQQFLEELSHNKDIKNY
FT                   EYATVVINTLAITQEISIVVLFCHAFMGVFTNSIGKYSLLWIDVLSVLAALVCYVFYQC
FT                   HQDACKETVERPASLSTRCSPPPRQPSRWLFHAWNFGRQVVSLVTMLALLSPIFSTLTV
FT                   TYSDDTIVTLSILTMSLHVLLTDYSYLNAYTQRFDPNLSVNMAIYCVTLMASRISSPLA
FT                   SGALICFGIMCFSLSPIVRHLVKHYSFTAHVAITFGLVGLAIGCLTQIRILAILYTVTV
FT                   LMISFGIPWLFVRMHSSVKTQINGPWDEAKPTNSAAAAEWANSGFLA"
FT   CDS_pept        complement(671439..684551)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1720"
FT                   /old_locus_tag="LmjF36_1720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1720"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1720:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1720"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR023362"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036372"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q2"
FT                   /protein_id="CAJ09127.1"
FT                   /translation="MYHYLVNALKGKPGKADGLVARSDPAITDSEAARSARLREEEQAQ
FT                   RVLRERRRAYSDFMTRTPLGHVLSEQMPAVESMTTTPATAFSVCQTSAVLDTRATGTSV
FT                   SLAAGGERPSPTETGLAHTKLELTMYEVLAPWLSRRTAMMTRRVLELVPHSAPVAPEAA
FT                   RGEQVGTIFTLPPPFPCQRPFVTLEEAKGALLPFLLVLVQLRHWQACLESLSATLSSEA
FT                   AARSESTTTTSARLVKALQQLSHVLVAITCATELQTAAMRSHLDLLGGEVTACVATTLQ
FT                   CLRRLTRACGTQEFSLWSERAPAASASAAESMPRESKDAIGGGDRRDGTSTPHPVSAEV
FT                   VEIQACRLLSLFLYWLHVVHDISTPCLAIEELFLASSTARFNACAATVATAKGATAGAA
FT                   EAEARETHRCTGLSNAALLRHTDPVPSCVPLAMLLLSGSDASSGSGEDKSPGEGSSPPL
FT                   ASSSDVASSLTALLLFASKGVFEHAQPSSEAHTVIEGLAVEEDSDLGLIVVLTSRLLRY
FT                   MFVAGASPHLVQVTQAAGPLQSALSLLLARFIAGDRNASALRAVAERTEASQSTSLRSC
FT                   GAQPHLDAAADFSFPRSSSLASTSQPPSPARSCCSSRAPVPSEQSGRLTRQLRLLGQLS
FT                   CGLVLLKTLFQQSATTVLDIMDHSFFFDALVTALQVVGSRFTEPSRQGAMAARVLDAAG
FT                   RRDSDAWADWVRGVETVAAQGTVAEGMSVLLNHALGCPLQFSLTVLSSDPYVDEFLHAY
FT                   LGLLAACRVVRSTPLAFIAPPPQGMLLGSNGAITASARESRALDTLDQLELTLLKTFLT
FT                   AYGTPTEDTAPAAAAASAAMEFSITLPPCPEQHPVDSEATDAFHLSGDMDGTGSLTFPL
FT                   ASCIYNLLLKHVLWCVGERERRCGQPLPPPPPPLTPPQAPAPPQQHHLALPLLQSSVSS
FT                   AALRLSPDTPASTATNTPRLVAQAPPTHPPVSPTLSMSIITPANLPQSAATTLPGHSSL
FT                   AAITGTGSSDDDPLVLFLVRHGLFRILLHDEHFASAFALAESTAAVDSADSPLGRSRDE
FT                   EAADRPATTRQRSYLVLYLLSHFLQLRPCDAGSSDGEPIAQLAGAQEGGGASADPNVSR
FT                   RGACSRSSSNTALSADERQLAQETTEALMTVLRVSTASVSSPCCAVVRCRRRRWCNCLL
FT                   ALLSAATAAPGAAAFAPIHVGEELRAGIEIGAPSAADAKTTPAAAAAVCEALARAGGVE
FT                   YLLRAAAVAADAGAAGQPANTVSCAWAMQAARSLAKDSTASVRMATKCAESLLLPLLWH
FT                   PLLRSDGQRLLEALLCRPLVGSGTAVDINVNMRELSLSMVSSTGKVGSDSAATDVHAVP
FT                   PHCRKLCEGVWRTLCDCVNGSAVGGSGVEMPDAVTSGTRAVSATNADEGARQAVLRAVL
FT                   GAVGTAFRTLSEQRFSDAGEHSGELLPLRTLQRALFEASKADGQNIYELLLHQLAQSSK
FT                   AVDNPGTSPRPSPLNTADVAEVAFSPPFPVPFLIAASGAPNAPDTSPAEAMEASTDTVA
FT                   ACRAAREMVRLIVIALVGMTVANPSQREVLYRATVDEEALVSCIVNAWGTTGGSQALPF
FT                   SCSMGEGDACGIVRVCSYLIYESVDAVDAFFDNDDESGSQDAAPRRRRCSDDASWAWSL
FT                   QNPMLLAAVLRCFTRLASLTVDQQVALRKLLVSLTRTVESCYVSLYLAASSAVHDVLAQ
FT                   LLPVVALLPEPAALRFSSSVETEAALPRLDAVLVRLLAALAHCHVDARQLKQLLLLVIH
FT                   SRHQRDRRALVPLVLQVLSEAVQPPLNMTLLHAARRDPQHFVSLHRGRGPAGFCAALPD
FT                   FPLEGYSAFLNVRWESDVSSQDVAGQTAGGNTTLRQYDACACIFCLRTADRATLLAFMV
FT                   ERRTGRLFVQYRNLQQQKLRVYLAASLLPRKWTHLCISHRAAAFLTATAGGQLTLFVNG
FT                   AEAAVIPQVAYPLMSRGYLYVGCLGHEVDRLSVAHAFYGQVSTVYFFPYVLPEREREVL
FT                   QTTVGVADTAAWMLSSSNAAIPPLRPVSFAPGRRPGSSASESAADVDGTEQWLAGRAVV
FT                   CVDTRLSDRGHLYNLSAVLRGRTGRESRLLTLEGSLVCSTQRLIDSMGVLGALTSVLMP
FT                   LCVLLVNPNLPISSRSLAAAAPIGSLAHRKPGLPPFSSLGAAAVSASSASDTINATVLR
FT                   VLDLVPPLAAAEAIRTEMAEARFFVFLGQVLQLLGPALQVVVPAAFVQLLEALAPFPRL
FT                   FEDALTNLFLSADVIRASPRAVQLTWVKVQRFFLSAHPDALPCLRTLGTSMFVAAELLR
FT                   VTAEEAKEEELTQEDTLVPAQTQDVVTHPLLSPSSSTSRPISVVASDVSGAPSSATISP
FT                   FSPSSTPPPPPSLPSCSLQDLENQWMAYFEALTVAPVTLGDAEALQYFVGNLHLTCPKA
FT                   SVQLRLLRRVRQLLVTSNTPYLVQLLGRRNYVVNLMPYLTSASSEAVRLEALLQLLFMV
FT                   LRSKRTQELMNPVLLASKDTVVHVVEEVSLSWLKDVLQRFPVNLPVYLALRCGLVERFD
FT                   VLTLPTQYVPLDESHTIRFAAVLLPLLMLMKRSTDTKLKGHVLTDMAVLLKSDAQAWRR
FT                   VITVRGWYVSVVGLFASSCASSPVSAPSSLQEACACQESTVPGAVSSPTIPTDSTVSEQ
FT                   VQSEGSGLAFATISMILSYTIYQVLLHEAYGATELELVVAYLREQRLHRLLHQVLCRVA
FT                   DRYRSRLMAPWRGERRDAAGNREGPGAPRPSNGCAFLGLGSATAVVNLCHFLRVVEVVL
FT                   FYAGSVPRRKEAITVPVKPAVSPFTPAGAALNGEEFGTHLPVRVGYTEWEQLTLVRSAD
FT                   DPPGGVAESDVYYAGEVDDPHGNVRRAVLRTPDDRWLHLPLAVKCAELLCSHSALLHLG
FT                   SNGNTTSHSVGGAGSVVGSGSAGSGGPGDLLWSVVLGASAGTGVSKSPTSPKAGGVGGV
FT                   GFRAGGGGVAPVVLRGGMLRLFGRLFKVLCQMTLRSGTALSSVVELTDVFVRRLDRGQR
FT                   GSGFLLLKRAVNAEDAREHSPIAITMTLIYCVHNLLLRRLHAAEYGNTSTHFNANAALV
FT                   DRLKSLVVMFRYSFEQLSAFASSPRSRSGAHSSVFRQSSLLATAAAWLTGGDREDSAGD
FT                   RSSGPNSTASCARSNLAYLDDLTGETLTAGVPTLQWLCDHRANPRRTVEAFAEVASRVD
FT                   YNAFVERCLLAVEREQSTDKALAAKLWSEQRASLRRLQELFAENSMSRRLVHDKIQALM
FT                   AAFNSPPKTGAAGETDSDSGAADLEGHSSTRADGFAPASFTSLFLPRAARRATAAARAN
FT                   AWTRFTFALRDTVWCADAAGLHNTLKYVKLSSQEQQFLVHRKLVYDRDGTNYCGRAMAS
FT                   YSAPRSPVCDDLSSVNVTSFRAVPALLGDEGESGGGLAFGGSVSASTSRASYLRLRGGE
FT                   SVLLQAIDDDDVGLEEDMMNFSLDGRGDVSTAAAASFSECPLLWEEAAPVSKGAGLAPT
FT                   SKVDNFSAAPSLLSVPCEVPYMMHCWSGSFTVRGSEVIVLIDDDNKAYNQVVAEEARAY
FT                   VLRPRPFSFHLSHITQIAPARRFRMRRTALEIWTRDRRSCFVNFSDTATMNAALQAVRC
FT                   GERSSYMLTAPSFLRDASGAATAALPTLLHEGTGGVRWHSAYVLQENPRREPLRLRATA
FT                   LWRNRLLSNFDYLLVLNLLAGRTLNDMTQYPVFPWVLSDYTSETLDLTNPETFRDLSMP
FT                   MGACGNRERRELVRQRYMEMRSLGDVPSHYFTHYSSPAITLYFLVRLPPFTTLAILLQG
FT                   GHFDHADRMFHSMQATFRAVMTSTQDVRELIPELYYLPELCINENHIDFGRRQDRTPMD
FT                   DLELPPWAHNDPFTFVYRMREALESAHVSAHLHEWIDLIFGYKQRGKDAIDALNVFNWH
FT                   SYEELDRNREAGSVDQLLLVDSLDNIGQTPIQLFRRPHQPRLPLEWADPLQLPIRVKVM
FT                   TLRWGCARVARTTVVSTDRVLVVAGSGAAASLRMHLTPIRQSSVLQRAAATPPAASPPH
FT                   AAASTAAASQLRCAPVGDGVAASAPSQNEMTATHASSHVNATAAAVPGHPATPVAVTPV
FT                   TNHPAPPAMDSGSFDVRDEYERSLAPIPAGVIPNDSAYADGSCTEASTALLCYDSEVFL
FT                   VLGGLFDNSVVVRALSGAGRDVRLRAHRGRVVFVARSEDSRYLVTGAEDTTFAVWSCHL
FT                   QPARQRLEMTMLFTIYGHEGMPSAVDVSSTLDVVATASLNGTLMLHSLSTGGLDRVIRH
FT                   PHGAPIHRVLLQTTCYVPNILFLSHQDEKVYQCSLNGAALRTFSPPGRVVTWATTASQC
FT                   LLLACQPLASVHGGGPQDGDQTSCILYLHSFFLEVLKTVPVRAEDVVSSVSAHPSNPQV
FT                   VVAGTESGRLLLLRSVLV"
FT   CDS_pept        complement(686726..689581)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1730"
FT                   /old_locus_tag="LmjF36_1730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1730"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1730:mRNA"
FT                   /db_xref="GOA:Q4Q1Q1"
FT                   /db_xref="GeneDB:LmjF.36.1730"
FT                   /db_xref="InterPro:IPR007265"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q1"
FT                   /protein_id="CAJ09128.1"
FT                   /translation="MAAKPTSCDAGEKSSLMRQLELLLVPLHHRFRYPLPVPTHFTAGE
FT                   GDGASIAAALTHAPGSPALAVAGATGSSYADPAGTAASHFAGDSAQLSEQQQDERLYRS
FT                   AMRVVEEHVPDLLTWQARVQRGATQAGNCYRVLERVRNSVSAMQRVTESVQKQSDHLSH
FT                   NASAMMVRKAKLELVRDSLEQNLAHFTHIDDLCREAGNPFLKAGSARFSTLLQDIAKEM
FT                   EFLCTNTQYKSAKPYAMKLAVAQQTVSAILKDAVRASFRTMEAETLASPAFEAATQVLQ
FT                   EDSAILSDSPLTRASTSPSMVSMSATAAPPLQLRPHDVAGSFEEFLAAVNDVFVKSGDG
FT                   FTSLRRMAELRQGGFGYSGAEAFGEEMLTAGGRLEADPGMREVMDSYCEARVGVVVPLL
FT                   RYWLTLWYYLDAQQNSQADAKTAGSVAAAVAAVGAASPADTGAGWDQLSGVAEAHTLPQ
FT                   LAEHICRLLQHSLAAESDVLARLWLRDDIVSHLLPRLVPSIAEEVYYMFRSRLLCVDDV
FT                   GELSRTVESIQRVSLLHNNDVQDSEVVSDLWVRMIQDTQERLVFRTSVYLRQTVSRCTP
FT                   TREIASVYLRCGTDAYNAEPAASTGDAAQTRMFYIPVVVHALKLLDWLYPTLEFSVFSV
FT                   FAEEAVHHSLDIIRQLMRLMRQMDSSDTLRDSKAFLCQLAHLQHLQVTLSHVDANITVV
FT                   EKHISLAALRNRRLELEQSSRESKKEVEMDLLKCSEHLTTAMFALVTQPVSGAAKKSEA
FT                   ERIQLVSEMKGRAAGMERMIAFYVEHEETQQDLMHLLRERVVELAAEMSVDVHAVPAAP
FT                   VKTAKLETESAAQNAPQRSATEVAVAPLPPASALQPASTAAGGSADSHHAPLQSSAAPA
FT                   GAAQPAASAPVASVGATDQFTALPTHAPRAPPEFPSPPTERVTYASAPPATTLCHQPPL
FT                   QDYAAPTAGARPSSQDDTDII"
FT   CDS_pept        complement(690432..695933)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1740"
FT                   /old_locus_tag="LmjF36_1740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1740"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1740:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1740"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1Q0"
FT                   /protein_id="CAJ09129.1"
FT                   /translation="MNRSSVRLFGNYSRTSGAQQHSQAAHTSSLSSTRSSSVLGSLVRM
FT                   RNQFHRLRHAQQQQAIAAVLARYRLQPALRTPAASTSRAAGQIDGDDSVGQEGSGEAGG
FT                   SAASSVLQTAIILCTEALRLLNGEVRCRDNLSDVPKSSPMYGSEVGKLLNIAAAFGAST
FT                   TFPRVQHALHWIKLNKESLHTPRQVMSLCMPLLSLADGRTAGVAFVLEELYEPLLLALQ
FT                   DVASTSPESAAESADNAPSDATAAVQQHLVAITSAMGMVAKWSSLRLGSKSKGSLSSSP
FT                   SEVLAAAKSDATAEELDKMLRIAETCAAALRRQSDRCRGTGPDEAFVAMAHLSPSDVLQ
FT                   WIQCLHGLEKMYALVAPTLGVSRAQAEAASRRLLLCYRALLPLTQRTLELPGGGGGATV
FT                   AAASSATFATGATATSVRVADVVELIQAGLQTSIEPTHVDLALSYGLQALPGALASATV
FT                   KDLSDAAQVVNKVRQKRPSALPAPLLLSIQAAFRPALFLLRETHALQFRASDCGVLLSS
FT                   LSRWEEVPGVTVSADIVELLSQRFVEQMHVVGASHLVPFVASLARFEERKRPPQRGGAA
FT                   GQAVKNAAVLGEDLAGESAQLAYSGVAWKTSEGRADRLTSPPVLGARTRGAEGVRYRFC
FT                   TTSRVVSQCVQRAIVLAGDTETPGDPAAPPRLSTADAAQLLTYFVQLSAPQCADFFNKV
FT                   EPLLAPAIHGSAATPSPASAAIRLRVVTGDAVQRFVRYAAEQREHTWAQCTNPTAQETR
FT                   KEASVVEVRRATALLRGMSRGLTKLVREAASPKDLVLVCSLLRRRLLDKGAAAGVAVEG
FT                   GEGALKKLKSAKPTTAVARARTRAWTRKELELATVFAAQASKMAPECKGVELGALASVT
FT                   SSLCTAGVLPHPVAQQFMRAVWARCAAGLAVASRGEAVGPEAAAALTLSLENCKTIMDA
FT                   SRSAHLTRTVPPVIFLEAFAAQCSELLEESSGAAGGEGSPSTARGTARAYAEAVTKLRR
FT                   TADLGRSLVSYFGSLRPSRGAAEGDAAMESTTWREAQVSALESYLEVAHSVVEAYATEA
FT                   TLSETWWAELDGGNPPPMPLELLSTTANVMAQIYRLVHRGVGSTKRVSSIPATAPTVPD
FT                   EVPDAEGDVLDGSLTAVDGAGVAVRSELESKALEDDVEPSPLLYHSPANLSTVTLDQAV
FT                   RDTLGLLGDTIVALARQQQQQLSSSVSANVSGETATEDYGRLTTAPGHALVQNPKHLLM
FT                   LLRAFETVEHPHPEMLYSVLPELRGCADRLDPLELSLLIRALTQLGAWNSRLLSALATA
FT                   VASKMNQCKLRQCYTLLHGLCWSGCTSPDTYVELRSTPRRDGDSGRGGAANKAAAQEPL
FT                   QRLAESTLLRLDAFVRTKDAFMSLARTAAVADLVGVVKVLRFFHAPPAATYDAFVVLAV
FT                   RRLASQAKRLSLGTVVQHTMVLLNAVSELRQPEQQRVSAQALWTVLRRAFASSTEAGSP
FT                   GALTAAAGDAFGGVLHLPACWELTRFAALHSLQYGREATRDFFVPIVASTTEQRAVSCA
FT                   RLTQTRLARFIETHASDLAADARSPLPFLTAAERAALRRYALHASPCLVRGDRELDAYM
FT                   CAPLKLARLIADGDPTTLVHAATTAAPAAQARRCIRLLACLLRTDLWPPSISAATADTQ
FT                   MLVAALLRLWTAAELDGLLRHSPGAFSTEELLVLAAAADRVHQYSMDAGNLQDDFAVAV
FT                   RQLCAATTEWRLPAAVDAWMLFAMPFMASSSIPAAALPNDSDELFVMLVASGDVLVTRF
FT                   AHAQQSWTTSGARMLPELLRLFRGPGQLDVAMLQSRAVGVDTLSSALPHPAADAPAARV
FT                   RFVEIYRELLRCFTVCLT"
FT   CDS_pept        complement(697578..699212)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1750"
FT                   /old_locus_tag="LmjF36_1750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1750"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1750:mRNA"
FT                   /db_xref="GOA:Q4Q1P9"
FT                   /db_xref="GeneDB:LmjF.36.1750"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P9"
FT                   /protein_id="CAJ09130.1"
FT                   /translation="MPPSSSHSVVTLAAALLLAMFACSHSGHALCPSNGNTHTIYVTSN
FT                   MGDDIWSFDTLGNYLGPVLNKASFPPGVQVDKLRSMRFGPEGHLYVSSARGSYSRVFAV
FT                   SGNGLLNGTMEENCTRDYLFTVVEQDKKNPFLDHPYDITFHPATEDMYVSNQNSVTVTR
FT                   YTRDRTADVMPKAGASGSQRAFYPAWKPAKNVKAAVEANEETVSGEETVVAPKNIPDSS
FT                   GLFASSWSSSYSMSSVRGLTISPLLPRALVEGGAPSGVFAVTNESTMYYLLVCDVSSNT
FT                   VHVFDPESGERLFGLNVPSPIQVMFPSRYYIGDSSSLSVSAAGVPTQRFDVPYIYVTSK
FT                   EDGMAYMVRFSTRQGNTNNNGMQGGVFGEDFIRAHHLYAINHPTPLHAASGIYENSARD
FT                   VLLIADRNGRRIYSYASPFLTDYTSGYGPSPFLGFFVKHLPDQPEFILLTLLEHQENIP
FT                   FCYELNKDGKLRYVALCTAASIWSVALALVLILVPSFIAYRQIQHCMHGQGQQRRQRYL
FT                   DEDASALFESGSSSPLLGGRAPNYGSA"
FT   CDS_pept        complement(700520..702049)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1760"
FT                   /old_locus_tag="LmjF36_1760"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1760"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1760:mRNA"
FT                   /db_xref="GOA:Q4Q1P8"
FT                   /db_xref="GeneDB:LmjF.36.1760"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P8"
FT                   /protein_id="CAJ09131.1"
FT                   /translation="MSKLFRTVGAKGFQPFDWANAAQYASGTTPMMKEPACYINGAWVA
FT                   SALSDKTVTVEDPCTNQIIGAIPCMGYAETTAAIEAARAVFERWKEVMPRQRAGAVRRW
FT                   GELMRKHCDVVANILSRESGKVVAEGKGEVLYAQGYADWYAGEAERIYGDIIPGPRPGV
FT                   QTTVFREPVGVVGIITPWNFPAAMIMRAACGAIAAGCTVVLKPAELTPFTAMALAQLAD
FT                   EAGIPPGVFNVVAGDAPKIGDALVESFDVRKVSFTGSTRVGQHLYRRCSETMKKVTMEL
FT                   GGNAPCIVFEDADLPRAADQLIAAKFRNAGQTCICVNRALVQASVYDEFKSLVADRVRA
FT                   LKVGSSFDPAVKVGAVIGSATLERMTRMVEDAVEKGATLMVGGKAVEGGGYFFEPTLLT
FT                   NVPHDTTLCCRNELFGPVLPLVPFDTEDVAVKMANDTQAGLASYFFTNDYRRQHRVARA
FT                   LRYGMVGVNDSALSSPAAPFGGVKESGLGRDGSKYGIESFVDIKYVLFSTV"
FT   CDS_pept        complement(704341..704661)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1770"
FT                   /old_locus_tag="LmjF36_1770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1770"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1770:mRNA"
FT                   /db_xref="GOA:Q4Q1P7"
FT                   /db_xref="GeneDB:LmjF.36.1770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P7"
FT                   /protein_id="CAJ09132.1"
FT                   /translation="MFRRALGASAARSLSSISAVVSRRSYTELSHMKFPVYYGAVGVVL
FT                   GYFVVMWIIFLRMGSKHTARSEYKNDYLRVWRRRLGTGYQWADAWGPQMDTFFKDLPEE
FT                   VE"
FT   CDS_pept        complement(705694..707931)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1780"
FT                   /old_locus_tag="LmjF36_1780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1780"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1780:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P6"
FT                   /protein_id="CAJ09133.1"
FT                   /translation="MPLLPLSSTLTSGAWGNPTSSITAFKVREKHEAGMRLLQGGLVYE
FT                   AIQIFQEASFFDAENVRPIVALAECYVFLCDLRSAVRCYRRALLSLHKQDLDDYCRRAN
FT                   ETPTDAVDEVSATNNCRVVASNSPERTWRNSGGEMHPSDVPDDERGSREARLETAQDPA
FT                   PASFQSVGGSSPPDHSIQGLADSLQSAEMAARFSMYQPSQAKSVDSAASEVPATTPSLP
FT                   APGAAPTVKDIRARLAGVLDALGLSLYQLGSVDQALRCTTEALEMLDAAAQVGEGEDKD
FT                   VSSSKLPQFLADPTIALHRGVYLMALQRDEEAEALLEDHFAIFPHWRPQTAALLVQLYC
FT                   NRQAFRKARVLLEAQEEKEACNTDSSKAPTEAHGNVDEGLCSARRSTLAPSLPSSTDAL
FT                   GSLAVAKYLFTELYARYRTAALASNDEASITRCLSIYSNDFDLLFRRAQLSVAAGKYKQ
FT                   SVKDLFRCVRETNGEHKEAIEVMTTVLFKIGSSLNGEAEVQDAVTYYSESLKWRPDNVL
FT                   VLLARGDCYTKIECFEEALADYEAVLGLEPDQRDARQRIASLHDLWGCKLFAQNQPVQA
FT                   EAEFTNAIKTDGRNPQFYYHRALCRLKLDQGRYALRDVLSCKELHPTTPHLRAFIARYL
FT                   EPVQPPEASQRRNTPQAPKRRVVAASVCEARTPPPLGDCDEPPALQRRRDRDTDDTLSH
FT                   PANGGASTATGVLPRIQRRASLQKRSAVVGWVQGCQTMLHQRETGAHAPVK"
FT   CDS_pept        complement(709059..711746)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1790"
FT                   /old_locus_tag="LmjF36_1790"
FT                   /product="putative exoribonuclease 2"
FT                   /EC_number="3.1.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1790"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1790:mRNA"
FT                   /db_xref="GOA:Q4Q1P5"
FT                   /db_xref="GeneDB:LmjF.36.1790"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P5"
FT                   /protein_id="CAJ09134.1"
FT                   /translation="MGIAGFFLWLQRWYGDCIDNIPQDVVDAAFKGQALPHSHASAYSY
FT                   DNFYVDMNGLIHPCCHDTAPLPEPENEEEMFERMFDQLDLLVRVVRPKKCLVLCVDGVA
FT                   PRSKMNQQRSRRFRAADERLESDAISNACADSIVSEYHLPRPRVRERWDHNVITPSTAF
FT                   MERVALALEWYIMKKLNEDAAWRHLTVVFSDAHVPGEGEHKIMQYIRGLRSQPGYDYNT
FT                   SHVIHGMDADLICLGLSTHEKHVCILRNQLTETFQPDHNRFCYFNLSTYREKLMQDFAN
FT                   IEGMQFERVVDDFIFLCFFVGNDFLPHVPLVSIKTRGIEMLLDHYVRDFALHGYLTQLG
FT                   EVDYAHLHIFLMNFTSKCMMKLTKEYYGVVRAKERAKQHVEERVTKTEAQVSEVLGTLL
FT                   PDRSNAQEVSDALLGLMSSARKERTRFVVDKQPLGFSYLDKTYRDAYYQHKFGWDPSTN
FT                   RAAFESQIRLCCAEYLRGMQWVMRYYTKGCPSWEWYFPYHYAPLLQDLAAFTATVNVEM
FT                   RMSAPLHPVEQLLAVLPRLSVHALPEELHEAVNDPKSVLGKFYPAIVDVDFSEANFSYQ
FT                   GVLRIPFINCEALSKACRQLVELEEDFGSTFLYCHESTSLAKQLDALTGPSNSALPLAT
FT                   GLAPPVVPIPSSVASTMPIAGRMGRYEAEWPRHEELQCPDPGMAKSTRYGGRIQSNRVN
FT                   QYRYELSTQADYRPVLMGEENATKNGAAAAASKPSKRLEKEQSPPRHRKRGRDADHVAN
FT                   SNDAKRKRGSSRHDDDGRDRRERHRSNGEREQNGESRRRSKDGNTCEASSSSRHTSSSK
FT                   HCSGHDDDARRSSELRHRSKEGKKRSSQHQTRSRESKSEAQPAPSSSSSRRAKKSRETK
FT                   KVPRPSEKMASTKPSRHGHRQQRA"
FT   CDS_pept        complement(712969..713850)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1800"
FT                   /old_locus_tag="LmjF36_1800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1800"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1800:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P4"
FT                   /protein_id="CAJ09135.1"
FT                   /translation="MSENVAAAQRRWQAGMHEVEAYLNALDSARADSAKAGLYHRAQQC
FT                   MQHMEKIIRLLAKRIAREANIMAERARQALTEQQRLLQRNLRKRWKTKMLVYEENASAM
FT                   LAAAEQHHYAERVREDERAHEELRSVRAGGSMAHSRSSKVQHLQSEIQLYLRQHRYREA
FT                   ERAQAQLSRFEKQEQQSQQRNLTHLQEQRLQAMRMKQEEQLAKMKAAYQQEKQEITRTC
FT                   RAELDAMTRQHEVALQAVEERRLFLHERVQAILKAYNDADTLDPRAAGQKLIRISQLLW
FT                   TSREVQQSSKRI"
FT   CDS_pept        complement(715264..718080)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1810"
FT                   /old_locus_tag="LmjF36_1810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1810"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1810:mRNA"
FT                   /db_xref="GOA:Q4Q1P3"
FT                   /db_xref="GeneDB:LmjF.36.1810"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P3"
FT                   /protein_id="CAJ09136.1"
FT                   /translation="MSTTTARPATSSSRSRLMNMSAPLGSQPTMVDPSNPFPVNGKVGA
FT                   QHSVSYFSVALTQPALVVIRMKEGNTASRCALFLSCFYPKPDANNAAWRLISPEPVKQI
FT                   VLHPADPAYCVDTLHIAVHYLEPSGQSNFQLQVRVQREFFAMWLRTNEETRAATGAAAV
FT                   DHMTAVKTLPSPGASASGKWATANAATLPAVPTLHTMLAASAARLSGSAANSAGAPFTS
FT                   LYVGDWRGDQRDGLGLQYYAAPEEMLSMTTLTKNNATDFEHSLAGHTDGMDWDAICTST
FT                   SQQAVTVGGVDVAQPLMLLRAFSERHNLPWSAWSIPDTLTPEELARLGFGFCFHSTSRA
FT                   RGGAAATGSTSDHAAVSGKGAAAPSPTGDSSLAGTVALSSTPPVAPCSTTAEGMAALGG
FT                   VISAFLVGEITSDEADAWKVLPVQPGVEVYAGEWVANQKEGRGAYQWLDRSYVGEWVGG
FT                   RREGHGFLRRQDGRWYRGQWERHVPHGHGEARLTPEGLLYKGEWRDGRRHGSGALTYPN
FT                   GMTVHGMWVGDELQPRVRVVYKDGSTYDGLWDPEEACRQGQGTWTDTQGCEHTHEWQHD
FT                   IRVGAGQEVYPNGVVLHGVWRAGELVDGTYVFPNGDRHVGSLDAVRHVREGAGTTVSAD
FT                   GASVYTGAWHEDKRSGYGVQTVQRPPRACKPGEPAASPSVERYEGEWLDDLRSGQGRLT
FT                   DGDGIYEGEFARDYRDGNGVQRNTRTGSFYEGSWKANRRCGAGTYYSATQGITYEGIFM
FT                   HDRLTSIGTATNTALAEQYTGSWLDGLQQGHGSLQLANGDVLRGAWHRGVPDATATIEY
FT                   IDADPSADGPRRAVAAVSRYVGGWQGGAREGTGTQVFRDGSVYEGTWHANKQHGCGRLT
FT                   TASGEAVECQWRDGCIVDGCIGDAHFADGSVYHGHVNVAGAPHGAGVLTYPDSTVFDGQ
FT                   FFNGVYQL"
FT   CDS_pept        complement(720687..723308)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1820"
FT                   /old_locus_tag="LmjF36_1820"
FT                   /product="putative ras-like small GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1820"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1820:mRNA"
FT                   /db_xref="GOA:Q4Q1P2"
FT                   /db_xref="GeneDB:LmjF.36.1820"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P2"
FT                   /protein_id="CAJ09137.1"
FT                   /translation="MAGDFFMSCSTDESAFMPEIRVVVLGDAKVGKTALLRQYLHHEQP
FT                   SRSTGHESTLLDSYTHIDYCGMQPYRLIFTDCSSAPSFHEHRAAYLAKCDVVILVYSVR
FT                   HRKTLLNLRHWMEEVLEARGLTRPARCASTTGDFGEVPIFVVGTHYGEKDSLEATNPTG
FT                   TDEAESITKECLQSAGYFINENDADTEEALRSNSARPQKARQRHQQRQGPKEKRSPRTF
FT                   HDLLHKLFHINADGEGRDAGALKKPTSDEVTAFQQRQPASAVRNNGCLSLASSTPMLLQ
FT                   PKSDTTNNKTKSSNAKSTLRIPPGASTRLPLFQLSNTDGKAVDMAVRASLTLYLWLQRH
FT                   EGDSVALSAAHTPQSSFATASKPEDAAAQSAPPHESSKSADDGAGAATESTAAPLTVLS
FT                   ATLRAHAISRALHASYVNERSVASFIPPMLALYNLGVSGSVCGESTESQALRHSRGAFY
FT                   VMQTAGSSAPAAQQPLQANSITEPSHETAFSCCGNGSSEVTVGARNDVKTTDQTAFGEV
FT                   CSQARARRGKRTEDRAPSYSSNVNSVRKEGKKDDAAHSGYLQTSMPKTAEPVSSPELGD
FT                   TAVSGASIKAGELMKGKTHGCLSSPGTNPAAAPNADSREVNSAAGKAGGELSTISGPMM
FT                   PDGALPLSTAPSVATRSRGDAVTGGGIVAASQQPTLRVRKEMGVGKEGDGAGTDYRGDL
FT                   PTRKSEPVTKLPVECEPDRDPSSFPILRQSRENDSAGVSAVRAASAGPLASPAHTPNSH
FT                   NHAPFAAKLSPMDECVPSRSPSSTANTGIGTDKSEAVSNKSAQEREPVTVSWPPRSSSA
FT                   AREPQASQSEPRRPQKSRQAKLNGTRNPKHWRRPVISIRILIGRQQKQKTTQCTVGGCA
FT                   GM"
FT   CDS_pept        complement(726949..729582)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1830"
FT                   /old_locus_tag="LmjF36_1830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1830"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1830:mRNA"
FT                   /db_xref="GOA:Q4Q1P1"
FT                   /db_xref="GeneDB:LmjF.36.1830"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P1"
FT                   /protein_id="CAJ09138.1"
FT                   /translation="MQTEDAAQSPPRKKRGVAVAGPADRDKMTAAAVVSVPPLPSSFMH
FT                   VPPSSHERHTERKPQPGSKRGRAGKRQSCVGGERPRGSHCHTETALDGIAAPASATFYR
FT                   PTGTNRTLIYDVESPLLLCTPRRSLQDAAASPPPLVRSIATPARRNAVVLTSTPLVIRE
FT                   ERERVAEDDAAAHDPSALLRTPLRLVRAARGLLSPATATLRRRLTHLRQSATGATGSER
FT                   GLQRQQSTAARSASPPPPSPWGQLSTIVPATDSLPSCVEEEGGSGSASARAASRRRGLA
FT                   LSSEPLPDAAALSSIPASQRTSVSASDMWRRSGRGAELPELLRSTMQPGSVVLSHSSDD
FT                   DITASLSRRSSPIVTAVDEARGGSRFQRRRRVDEDLRGAGMVGGTAALRGPYDVRFARV
FT                   SSLSESLADIVSSSRSTAHSSLTSVAAAAASSAVAQDRISSAGHGSAGDAREACMPRRS
FT                   ATVMDPNFSSILPDEEELAIRRRLQRGRNRQTPHSRSDSDIRGAGVAALVQERQHPVGA
FT                   RVAAGNVMELFVSRAPQPAPLAWQQPLQPEVRRRTSSGCASGVSVSAAGGMAAAASVHQ
FT                   RVASRAHDADVWPPQPQRRSASSTLLSPPWLTVACVSRLTVALLSALVCVWCVVAVALP
FT                   LVALQPRYTLSAVARADSVAAEVQFVQTHANSVTEMQALYKIVPASLSADAVVRLHHRT
FT                   LSEGVERLERATQHLVPDDNAPPWRRLFYLRAMIRAYLALSRNCELYARSRDGSHWRRY
FT                   VVYPLADMKRYGVRRFGSIASRSSITTSAAAAWRDRVWTTVVCSAQSEVLACPSVLYVE
FT                   EAMARDAAQFVYTDVNEAHESPQRKRKLQDWRVRLHRDWTSEVYLETLLRYIRSGVQEL
FT                   TRNYNR"
FT   CDS_pept        complement(731409..733382)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1840"
FT                   /old_locus_tag="LmjF36_1840"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1840"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1840:mRNA"
FT                   /db_xref="GOA:Q4Q1P0"
FT                   /db_xref="GeneDB:LmjF.36.1840"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1P0"
FT                   /protein_id="CAJ09139.1"
FT                   /translation="MSARAPTSSLEGHSDKAAEAAAEQSTKKRRRLRHHRCKAAREAAS
FT                   NTADVPYDELAETVEKNDDAHSVEEAQAAASNVASTKRSEKRRREENSDDDDEADADAT
FT                   TSSARPCHPHKRGAAEGGKTSSPSASASPAALSSPNGSTAVSMTQRNKELAKSIPAVTD
FT                   YKSLQLNPHIVSALEQEFKFKELTPIQSRCIPAALQGRDLLAEAKTGAGKTLAFLIPIV
FT                   EIVCRSGFRPSNGTAAIIIGPTRELCLQIEGVLLKLLKHFNGSLTFLCCIGGQSRNQEG
FT                   FKLANGIMIVVASPGRLLDHLKLTTDWHTKNLLLLAVDEADRVLDNGFEEDMREIVALL
FT                   PKNRQTFLFSATQTTRVEQLARISFHKTPIFISMKSKKDKATVDTLEQGYVVCTSEQRL
FT                   LVLYHFVKKNLKKKVIVFFSSRNSVSFHCELFNYIDVPCIAFHGKQKQHQRSATYMQFC
FT                   NAPSGVLFTTDVAARGLDIPEVDWIVQFDPPDDPVKYVHRVGRTARAGRCGNALMFLLP
FT                   QEELFLKYLYDDAKVKVNEYIFDLTKLKENVQGQLEQLVSSNYYLRTSARQAYEGYLLS
FT                   YSSCQLKNVFNIQHLDLAAVARGFALSEPPPIKMDLSQSAAHMSKKSRHEFSAMRHTKD
FT                   AKRRDVNAKSMNKRHQNISGEW"
FT   CDS_pept        complement(734586..736169)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1850"
FT                   /old_locus_tag="LmjF36_1850"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1850"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1850:mRNA"
FT                   /db_xref="GOA:Q4Q1N9"
FT                   /db_xref="GeneDB:LmjF.36.1850"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N9"
FT                   /protein_id="CAJ09140.1"
FT                   /translation="MSSAPRKLTKAMREDDDGGNSGSRASMRAPSTSSVKHQSLGSELL
FT                   DDEEFKAKTFQDLGLCQELCAACADAGWQHPTRIQASTITVFAEGRDLIGVAQTGSGKT
FT                   GAYALPLVNWLLAQRKTPYLSVLVMVPTRELAQQVTAQFVLLGRSVGLRVATLVGGADM
FT                   VEQACELSKRPHVVVGTPGRVKDHLSNTKGFKLVKLHALVLDEADKMLDMNYEKEIDAI
FT                   LEQLPQNRRTMLFSATLSTKIDRLQKASLRDPVLLQVHRKNTTVDTLKQYYIFAPFAQM
FT                   LSYLHLFLTKETGNHILIFCRSAALVHKITLTLRILGHRALPLMGRMDQSNRNIALTKF
FT                   KEGKVRMLICTDVAQRGLDIPHTDVVVNFSLPDHVEDYIHRVGRTARAGAEGKAVNLIS
FT                   QYDIVLLQKIEQQTGVKCVEYPSLPESEVQLVLQRVEDAEQEAIREIREDAEERSLEKE
FT                   SRQLTTARKGKRDRGDADMGYDDAKHGTSDFATLRMRREHESIFEMTKKEQHKSLWAKR
FT                   REAKRQAKSR"
FT   CDS_pept        complement(737034..738329)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1860"
FT                   /old_locus_tag="LmjF36_1860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1860"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1860:mRNA"
FT                   /db_xref="GOA:Q4Q1N8"
FT                   /db_xref="GeneDB:LmjF.36.1860"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N8"
FT                   /protein_id="CAJ09141.1"
FT                   /translation="MLRPTCPVAKNLTSFATKGTMRGGIPRIYYTWMKPGSATRRRFEK
FT                   MRNPFVNLETGTSLYFRDTRDSAEAVAHAADSKGLKGMDNGVDLYNEYKIVPDLYPEGF
FT                   QWKHKLNTEYNQWRSNTWLTPELIPQEHRGRFLCNFQLNIVAYDMRVVKFSPKDHRQWI
FT                   YCVLYVGTGKGIAGFGRAVAPSTQEARNEAIREAFSNIIAVDLEQEGPMYPVRINADGA
FT                   RVLLYPARRIIANFRVADILCAFGFQNAGCKINLKASNNPKAPTHTVEGVFEAVKALRS
FT                   VSEIAASRGKVPHSLVYNIYPYLEEMRRRKGMMAMHPPGKDGIFMPNRVVDNRMPDHLK
FT                   KGYYDDVYWKDFFAGSKEQLNEPKMGLRGDELRAQLEESQGRTAKRSNRRTLDDVLRRL
FT                   GKTSRDLGALQVVNPRLDAKLPTHMKRNYLLH"
FT   CDS_pept        complement(740006..742636)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1870"
FT                   /old_locus_tag="LmjF36_1870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1870"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1870:mRNA"
FT                   /db_xref="GOA:Q4Q1N7"
FT                   /db_xref="GeneDB:LmjF.36.1870"
FT                   /db_xref="InterPro:IPR002499"
FT                   /db_xref="InterPro:IPR021870"
FT                   /db_xref="InterPro:IPR039059"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N7"
FT                   /protein_id="CAJ09142.1"
FT                   /translation="MTETVLRLGPQEYAHLTNLNTNTTELILGPLNRPVASHESVALPP
FT                   TKFVVVPPTQYCLIANPHRTAVDPTTGIAQPVRDAYGQVQVRSGEEEYRWHVPPFPLYP
FT                   EEAVVKLEDLKVLSARAALQIQVLAAYNVPACSASDSMPSPVRREAGERYLFCGPGTYY
FT                   PRVEEHIEEEVMAYTVERGSALWCTTSETFTDSVTGLKHYAGDKYMYVAEGMHFLQPFE
FT                   SLQCFVKGVVLSAEEGLHVQPTKTYADPRTPFRENGITRKANEPFLVTGDLCPCFVLHP
FT                   YDKLLKTVKRTHVSASQYAVILHPVGDDGNASVGARRIVTDTSFFLKPGETLEKDHPRS
FT                   AYLLCEQEAVLVTALGSFTDSSCTPPVQRYDGDRWLVQGPCSFIPSDLMRVVPNAKTGA
FT                   EVRRPYLLSEGDGLYVRNSVTGVVRCLPGPCSYLLTAEEEVWEKPLSAQVERHLAQLVS
FT                   HAAYIELERDKERKVLQGQTERAVSYHIPYRSVTQLYNYKTQMTRIVFGPDRVLLEPDE
FT                   AFTVVSLSGSPWDPAKPTKCMPKHTNYITALHLFLGPSNMTDVVHVETRDHAQLALQLC
FT                   YDWYFDVTPGDTEAAKECFSVNDFVGDACSYIASRIRAAVASMPFEEFHKNSARCLRRA
FT                   VFDVNPATGQPNGLLRFPANHLVVTSVDTQEMEVLDERTRQGLQKSVKMAIEITTHAQE
FT                   AEAQQAAMAREQEAHGRLERQRMHDKVANEEQRRVLLHAESSGLAIVSSGKSTAMAEAL
FT                   SSASRIESEASVEAATVRAAKELLLYNTMNEMQNKKRLLLAEQEKKVAAMTLAYEKALE
FT                   EVRHTLVGRVVAALGPETIAEIARAAPELQAKLLASLGLEGYLVTDGSSPINLFKAASG
FT                   LVGHA"
FT   CDS_pept        complement(743443..745347)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1880"
FT                   /old_locus_tag="LmjF36_1880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1880"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1880:mRNA"
FT                   /db_xref="GOA:Q4Q1N6"
FT                   /db_xref="GeneDB:LmjF.36.1880"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N6"
FT                   /protein_id="CAJ09143.1"
FT                   /translation="MQRYLMNTSYLQGQLKSLYALHNKTVADYGELVQNLNEECTILCD
FT                   VVPSYRISSTLENEDGGGQRKQKEVYNVQKLEHEILTQYTHFLQLLRKLSRKSHPEQQA
FT                   LGSRLCARLVKSSAPEFNHADALLSLAIDFANSKSVRVAQPCQTALSELLDDQKVSDTT
FT                   EHIVGALLRIVRKRSYAMNPKLLNLLLHVRVAMVDVHREDLAEEKAKSKRLKKEDKELA
FT                   RQLQKSKARRDRAEIAAKQTRILHRIFVIYLRVIEASKTCSPVHQTKILAPTLEGLVKF
FT                   APLVNLELYQQLMEALKDLVKGGGTSRTRLRVGGTEGGSDGDNVDDKHEEETATSVTTR
FT                   LHALVAVATLAQRDATATASEWRVDLSYFHEVLFRCLGEALELPSAESSSSAKMTREGE
FT                   QEASNGDMDEVASQGSTSSAGSLSSQAFSIAQSMTQGTLVHQNASREWTFHVGLVLRAV
FT                   DLLVLTQKHLPVARVTAILRRLIQATPLCPPHIAMSILALCHRIVLRYPLAGGVIVGGS
FT                   DNVIAGRGAYNPEALQTASANADSSFTWELSLLSHSYHPTLRQVAETMCKHYHKVSKHQ
FT                   HGQAPIVTKQLDSLGPYEVIEEYDPSLGNLKPAAPLPTALKAEVRKRQREEAQAYEVA"
FT   CDS_pept        complement(746536..747075)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1890"
FT                   /old_locus_tag="LmjF36_1890"
FT                   /product="putative endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1890"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1890:mRNA"
FT                   /db_xref="GOA:Q4Q1N5"
FT                   /db_xref="GeneDB:LmjF.36.1890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N5"
FT                   /protein_id="CAJ09144.1"
FT                   /translation="MAICVGSRLGVVRALLVVAIVCGLRAAAVTAEESSLSSPIVCTCR
FT                   CCYQGGCSPLTNVSWTVSSCSECSTKMCNEYISSQQVRADTARLFEGIQGEKPLNDTVV
FT                   VQECEVIAVLEAATCTTKSCKRTSTIKAECYDRNAPLIKYSIISFVLLTIFAVILGIIK
FT                   NYIPVFQSLNEKYFNY"
FT   CDS_pept        complement(748585..753552)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1900"
FT                   /old_locus_tag="LmjF36_1900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1900"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1900:mRNA"
FT                   /db_xref="GOA:Q4Q1N4"
FT                   /db_xref="GeneDB:LmjF.36.1900"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N4"
FT                   /protein_id="CAJ09145.1"
FT                   /translation="MVLNLFSGAALNGHGSTHRRGRASSSLSSTGTGCRPQQQRYQASR
FT                   SATDGASMQADGAEQSGSGVRAEAAEDRVLFNNCVAQVQRHLKTHADSPSTLHTLASYY
FT                   TKTEPFIEGRPFCVTLSYATFLFHMQMARISVADVELYVQLVISALSQITEDDQLHHPF
FT                   VQQVLRDHVFGLPSPTCRGAAHSVVLLSPQQYRAFATMTTALISLAVVPLSIVYQFHDR
FT                   LETYCECASPLVANRALALLVQTVGEVRMDEQVTALQYILKTKPVKMNVDFLLACYERL
FT                   KRAVIDPAHGPSFGRALSIHCSELFLRFRSPVRRDYVERFLYPSLCHSDMASFLEIPAT
FT                   RKHLLRELLSKCTPGMGTMNPFYMCLCAVLQSCFDNETDGALETVALIDCHMPHAAYFM
FT                   STLAVDSHMSVPMFAKVMISLARGAGMAMTGRETPDEVAASINENRTSVYNVLFLLREV
FT                   VRSCSTTASRRATDMLKALRVAVAPKTIEALGKLSSEAFEAVSDITLDPQLLCAELAMV
FT                   LHQDHIAEAMDSAVEYFRDVRSRCPCCAAARSSSLLCPVNGTVHVAGQSSVSRVLSTLS
FT                   ECAGAKAVEEKLISYLRDPALQMESAVHYLIYHIIANGGQHRNTLFVAVEPYVRSTLLA
FT                   LVSADRSGVRGLVDSTLKANVLMLHVKLVTLLASSIDPSYLESILKVFSELRVRNNHDA
FT                   LALWYMGNVLLRSCRGNLELLPTDPQENNYCVAFPGCAPASATTADNAQLVLKLLHRAH
FT                   SFSPEMHKLVGCCVCKLIQDFNMQAPNICSTLLSPFGFFPVGLESLNAFALPAGASSTF
FT                   WSFFLQQMRSAAPARTAFMATLAKSLSRRFRIASPRDALAPHGVEPTGHLFVIMVYEAM
FT                   KRNPPLARVLLYMVSHWMKQAGHPPGKLACLVYVCVQLITVVVDRAEGPAAAEVEAETP
FT                   QDRQQFDDAVKKAARVLKSQQARLDRLAPTARRENVEFFHLLRRLQRRVRRTVAAASGE
FT                   IVVGDEAAEEDDDHDDAVDGSSAGGHVRQDSITDAVCAMQELQNAADNSVFDDYADDVD
FT                   HEDDGAYGNNEGACDAASPGIGRSAQTGGSRDRAEGPSAPMRIRHLPQGITSILRSPAR
FT                   SSSNKSDWGATGAEKGLTTSVNTCRETNRQIDVEDVPHDADGDDAEMRGRDGKTAHSCA
FT                   LGVEPRTRSTSRGVQTDASLNSPALPGHAPQRNVGTSPIQPAGTSSHISVTRRNGTQLP
FT                   CRAPADVGSARTPSSPLHQPQRSHTRPPEADGVLSEGTRTPAQRGSTWREPDLVDYVDG
FT                   DTTPIDDYTGVPRLQATTTSDGIVLPSGMVLEYLRTHQGMDSLQHELRQFDQQWMVQQV
FT                   AEYVSQNGGMVGAAGPSSALRGGVSSVQSVTVESRANNYSRPHADPTELAPTRTVRTEV
FT                   RMIGPATSYSRPPRQEEHGPVVAAAPGLPEEGEVDVVDGEHPIRAVSGPPDESDLAGRA
FT                   GDNDTTKRRRVEATEGSATTPLPPPVSPTSAFRGRNFFLNQHTQQEVDSTLQDIRYLQR
FT                   RQQTNMSALAKAQSAAETVESAGDDGAPRKTPHQGQSSTGVAGEGVPPTTPYGQLILPT
FT                   WIVEQRNDTAVRELRQVMGAHNPNDSRLSTSAGKRSRIHGSGAGDGSGNSAAWWAEMSS
FT                   APMPNYAADPQYSMELF"
FT   CDS_pept        complement(754923..756167)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1905"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1905"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1905:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1905"
FT                   /db_xref="UniProtKB/TrEMBL:E9AG15"
FT                   /protein_id="CBZ05900.1"
FT                   /translation="MKGLDMSTPPHQSCAASTGASTTTMSSASPPAISTMCVDVRELLR
FT                   HSAAASKDVPSDAQAAVSGRQPYTAVAPSKAPSQPPRQPQATSPSCRKESTFWSPSYPP
FT                   RGGFAGNSGPPPLSPTDATILHSILGQPTLRKTVLSSFDQLIGRTSSPLTREPRTRRPS
FT                   LASTSPPPIDSSSTWGTSAHAEDGVQALKVGAATPLSALSEKDTSPPTPLRDVMENYLD
FT                   GEGSHSAGAAASMDFSPAGQRTMKSLLGQLNSYASGLAAAHTRAVTEMPTSSNRGGVAV
FT                   WPITYRQAAMKFSAAGPSAASPLPFSGASAHRRKGGAAATRPTVAQLWRRCPALAASTF
FT                   SRVDTSPQRSHDTVQAVVAPPQGLAYDRPHVAADRSTVPLRKALQSPPRTVPPAFRRQL
FT                   QFTEEAPTTRRPKRR"
FT   CDS_pept        complement(757201..758580)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1910"
FT                   /old_locus_tag="LmjF36_1910"
FT                   /product="putative T-lymphocyte triggering factor"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1910"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1910:mRNA"
FT                   /db_xref="GOA:Q4Q1N3"
FT                   /db_xref="GeneDB:LmjF.36.1910"
FT                   /db_xref="InterPro:IPR025593"
FT                   /db_xref="InterPro:IPR039308"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N3"
FT                   /protein_id="CAJ09146.1"
FT                   /translation="MPPKATTAAAGGKQREKGKKGGAAAVDSVMELRNMEDIHEVLAKA
FT                   QQLRNYFQVERDKVNGMWDITKKELENEQFSLQNAESELEELEREHQVEMKVYQQKVRH
FT                   LLYDHKVTLKQLRDESDAALRQAEAAHTQRMHQLEVERQQRMTGMQSAREAQESRIVDQ
FT                   RDGHQYMLTVTKRRNHEKELARLQASYEAKLSTLREDLELRRRAEVQDAEERYHLHINH
FT                   LIQQHEDKFNEMKAYYNHITHNNLEIIQSLKDEIVTMKKNDEHNEGLMFEIEKENENLV
FT                   APLEQLEKEVAELQVKKQQHIQDKQSLRSFRTRYKLLQQQLCALRQEKEMLEDQYKNVY
FT                   DEREDLRAKFESALREAMDVVADRNNSLQQNLIEAHARLEQRDAQLEGVLRAMGLEPVA
FT                   MELISNEIDAELQGKNQVIKDLHFEMRRLEKKVNAMVEEYERRCRTVGVPPLDRASVMQ
FT                   V"
FT   CDS_pept        complement(759668..761158)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1920"
FT                   /old_locus_tag="LmjF36_1920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1920"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1920:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.1920"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N2"
FT                   /protein_id="CAJ09147.1"
FT                   /translation="MERTNLGHGAVGSLAQLCDELRKSYAAAKEIEQRDTTLTKSETAN
FT                   TLKETSNLFALGMEKLISSDGNVVEVKDAIALAEDAEREVAALRAEKARLQSTEDGHRS
FT                   KLSATGSDAEVEAFVAYAKELSELHDHLFLARVVFKGVLTKRLEDIRDDRLSQQDKRFT
FT                   DPKSWDVKKGVLERMLQSLRTKTAQLQLSAKTYLDEDEALFLEVMNLATEAGDHVRRGD
FT                   AMREARDEKLKVFYAECAKLTGWCRQQLTNLEAMQEPDHVQEYCATLADNYPTMSNNFA
FT                   VLFNSVQEYVQASLIPVHKALLEAEEVWLYLQVSTLERLSKTLFEIHPQSPLDVEVEKY
FT                   SSYPEHAAKFLQDLERYLAAQHRQQDEVAELDSVHKECQEVLHTLSGQFAELPSEVHAF
FT                   AQRAQALRAGYQCFREALLQRLTYVSPAASTVVESKRRQEEFENCVRELKSWAAEASHG
FT                   ESWRDIYSKIVEIKQMIKSEQASLEMKRERAVASGQSR"
FT   CDS_pept        complement(762638..762916)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1925"
FT                   /old_locus_tag="LmjF36_1925"
FT                   /product="60S ribosomal protein L37a"
FT                   /db_xref="GOA:Q4QC01"
FT                   /db_xref="GeneDB:LmjF.36.1925"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QC01"
FT                   /protein_id="CAJ09148.1"
FT                   /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGKF
FT                   AFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
FT   CDS_pept        complement(765421..766323)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1930"
FT                   /old_locus_tag="LmjF36_1930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1930"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1930:mRNA"
FT                   /db_xref="GOA:Q4Q1N0"
FT                   /db_xref="GeneDB:LmjF.36.1930"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1N0"
FT                   /protein_id="CAJ09149.1"
FT                   /translation="MTSTSAPAVDFSCAICLDTATEPVVTRCGHLFCWECLDHWLHSAA
FT                   GAPECPVCKGRVDERMAGDIIPLYGKGRQQATKAGSGQGTVSAPVTTTAAATAATESAA
FT                   TVSVSAQEAFFSRPSAYSFAPARDARRSAEASSQQQQPEQQPHHPRPNADRAPPRPRPQ
FT                   QRHQFQNVHINRGGMPLTMGSGIFFFGGGTGVLFSILVVAIWTLYHYAPWREWVQVSAH
FT                   WYNRLRGHPEPANTSQAEHEATTDRPTRARTPPAAARPASAASSMEDPTNDASPPTIVR
FT                   HLIISLFLVFILIQLLAYV"
FT   CDS_pept        complement(770331..771830)
FT                   /transl_table=1
FT                   /gene="NT2"
FT                   /locus_tag="LMJF_36_1940"
FT                   /old_locus_tag="LmjF36_1940"
FT                   /product="inosine-guanosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1940"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1940:mRNA"
FT                   /db_xref="GOA:Q4Q1M9"
FT                   /db_xref="GeneDB:LmjF.36.1940"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M9"
FT                   /protein_id="CAJ09150.1"
FT                   /translation="MTGQSAALQGSNSALPWYRMGFHTLAEFNTYATFVLLGMSIMMVT
FT                   SAVTSAPDFVTKYFIYATGDPDAVAEAPLFWNNANTFYNAGTYAMQVVTEIASLTPFMR
FT                   SIPLGIRLFLGLGIPFVELVVIIAVPAATISSQNGAIAVIMVVAVMGGLSKALCDSCTN
FT                   ALVGPFPTKFMNGAQWGLTVIALLMSIIQIILQVSMGSTFQDVLTISRIYFGIGIGIQV
FT                   MAIVALVLLRYNPFAQKYIAEFRAAALRRRGHVEADDLQDSKEPATGDVAEAPKAGEKE
FT                   VAADDTEETDEVRAVPSDAFVVKSGAVLQATGDADQMVDLDQTKNITSTEQMLRASVWS
FT                   VFKRIYPMLLCAFTIFFTTLLVFPGVFFLVPARSGWYMTIIVTLFNAGDFVARVLLMIR
FT                   VLRPSPKLVIVGTFGRLAVIPLIVLCVRGFIPGVTLPYILIFLFGLTNGYFGTMSCIHC
FT                   PRTPTLHYAGERSVAAMLSGISLMLGLCFGSNLSLAITLTY"
FT   CDS_pept        complement(772867..775911)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1950"
FT                   /old_locus_tag="LmjF36_1950"
FT                   /product="putative mismatch repair protein MSH8"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1950"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1950:mRNA"
FT                   /db_xref="GOA:Q4Q1M8"
FT                   /db_xref="GeneDB:LmjF.36.1950"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR015536"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M8"
FT                   /protein_id="CAJ09151.1"
FT                   /translation="MVLVNGQVDVNSVGFTYPFLEGIDPTAPPSTISIPHKYLDAMANM
FT                   ERQYWDIKSKHYNVVIFFKKGKFYELYDYDAVIANREFGLKMVLDTSNRGKMRLAGVPE
FT                   QSYNEWARLFVYRGYKVGRVEQMKESESEAQAAKTKVVPRELVEVLTPGTLKDPSMLSD
FT                   HREVFVLSLAPVCRDGELVIDAFAVDLSLRIAYRCPCSSRNREAKTGCDTISSELSIKR
FT                   ENGVCGSLKDSTLRTLSALLQQLSPKEVIIPSSDWVPKDAERRQAFEHTCDEITKWTES
FT                   EGFSVEHISSRALQSLSMTAMVTAEQVMASYFTFLRLASDIAIFSTATEYTAHLSGAIG
FT                   ADSGTAASDATLNMAASGKTSIMAYERRFDKGLVLDATTVSNLEVLTNLHDGSDKHSLN
FT                   ECLNRCSTNGGRRLFRSWLLRPSASSRVIAARQDAVRFLARYNLLHSLRDMEVSEQVGE
FT                   KRSRSNEGLSLFSSVVSVDFERFLSRLSDIKQNDSRNIAYVDPMVQYKKNLGIILSSVQ
FT                   ALSAMVGWGKQFLARCREVACEQGTGIPALLGELLEEVTTAEASSKRIEGLFDRQAAEE
FT                   SSLLIPSPGTSSVFDAATAKLRHVESKLHDVRRQLQQDVFRGAQAHFTDLGKDLFLIEV
FT                   AVADAPKMTPAGMVERARNAKSVKYVVSSIEALVGAHKEATAMKAGALLTVLCSVASRI
FT                   CDEFPHLFSASRALSYIDCLLSLAQLHQAFPTVSYPRLCTAHERDVAVVRGWDMIHPLL
FT                   TAKNPVANSLNLDDVEGRVLLLTGPNMAGKSTLMRTVALNVLLAQLGGPVLATKMELSP
FT                   VDRVFTRIGARDASHKGQSTLYVELSETADILHSASARSLCLVDELGRGTSTHDGMAIA
FT                   YATLHALATAKPAAPLTIFSTHYHSLAMEQARTATPTPTGAHASAVQLGYMDFVLKSET
FT                   AAAFADEETNDTRRSCAPGSCVSNVVFLYRLVRGICARSYGVEVAVMAGIPHTLVQLAK
FT                   AKSEALSRETAFHEDVRGIENFIRV"
FT   CDS_pept        complement(777530..778681)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1955"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1955"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1955:mRNA"
FT                   /db_xref="GOA:E9AG16"
FT                   /db_xref="GeneDB:LmjF.36.1955"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:E9AG16"
FT                   /protein_id="CBZ05901.1"
FT                   /translation="MSCSRWGLFSYIYICIYIYTYIHIYIYIYIYMHIYVDIYACLTVS
FT                   SLPEQLLLRLFPHAGLPSMGQSFNTPPPGSDGNECDDCSAKEDAKVYHMPPDLPSPEIV
FT                   GVNDADKGVLALTPKLAARLADALPPSCRCGAFSGVTRWYLLYSSFLHGKSFQRLVQCI
FT                   ISRGPTIIVIKVKDSPRVLGAFCESDWLTVAQREKNAKSAAAACVRATREGQKQRATAA
FT                   PENQSNTFFGNVNCFVFRAYADGTDDVSTEGEIYHPHSSMNSNFMYLFDTHPLEEKIGI
FT                   GMGGQPGYYGWFIDRWLENGASHGARCTTFRNPRLSSTESWVVESVEVYAVKKDIVEQL
FT                   LRTGSNRTSGVSCVNDNPDSKADQMLLELNGTHEFNHRDHTEC"
FT   CDS_pept        779754..780497
FT                   /transl_table=1
FT                   /gene="PMM"
FT                   /locus_tag="LMJF_36_1960"
FT                   /old_locus_tag="LmjF36_1960"
FT                   /product="putative phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1960"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1960:mRNA"
FT                   /db_xref="GOA:Q4Q1M7"
FT                   /db_xref="GeneDB:LmjF.36.1960"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M7"
FT                   /protein_id="CAJ09152.1"
FT                   /translation="MTSKVILLFDVDGTLTPPRNPETQDMKETLAKARAAGFKLGVVGG
FT                   SDFAKQKEQLGDSILEDFDYVFSENGLLAYKDGTEFHRNSLLKALGNEKVVAFVKKCLH
FT                   LIADLDIPVQRGTFVEFRNGMFNVSPIGRNCSQQERDEFEQLDKERHIREKLIRNLKEA
FT                   FPDYPLAYSVGGQISFDVFPKGWDKTYCLQFVENDFEKIHFFGDKTSEGGNDYEIYTDC
FT                   RTIGHSVKTYKDTIAILEALLEESR"
FT   CDS_pept        781112..782005
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1970"
FT                   /old_locus_tag="LmjF36_1970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1970"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1970:mRNA"
FT                   /db_xref="GOA:Q4Q1M6"
FT                   /db_xref="GeneDB:LmjF.36.1970"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR032857"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M6"
FT                   /protein_id="CAJ09153.1"
FT                   /translation="MDEHSSACSCAGIRFCAKCRGSSRVQQLFNGSVPLSSARSVIEKQ
FT                   QDNERLSSCSFAVIGKSSLSFCIECASVFKSEVPIKSCADHQGAVATGITISGLAVFRD
FT                   TLTEEDETAVIRFLDDSRPFPPWKESQSGRRKQDYGPKRNFKKKKIKVAEIPGMPLVFE
FT                   SVFAVISSMVETFTGKAYRIAEVSALEYMEGKMSNFDPHVDDTWLWGDRIAGLNLNEAC
FT                   AVTFVNPEGVCCDVYLPRRAFFLMSGNCRYRWMHGIRPEHVRGRRISLTFRELSDEILV
FT                   DTKASEMVLSAASHFV"
FT   CDS_pept        782393..783616
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1980"
FT                   /old_locus_tag="LmjF36_1980"
FT                   /product="putative serine/threonine protein phosphatase 2B
FT                   catalytic subunit A2"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1980"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1980:mRNA"
FT                   /db_xref="GOA:Q4Q1M5"
FT                   /db_xref="GeneDB:LmjF.36.1980"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M5"
FT                   /protein_id="CAJ09154.1"
FT                   /translation="MSQANMKCSAVGGRNLNGTPVERSTLLSDGKLSLESIMLQFLCGE
FT                   QLRLEYAMEIVQQAALVLRTEPNTLSINDTVVVVGDVQGQYYDLVKILAACGSLDTTNY
FT                   LFLGNYIGNGGFNLECILFLLAAKVAHPQSILLIRGSNESKFMADVLQLGKECQLKYSS
FT                   TLLTQILSVFNCLPLAAIIRKKFFCVHSGLSPDVSHVDDIALIHRFRHIPTRGAMCDMV
FT                   WSEPDWDTNNQLYNNVEEPSGETYVPRLGLFETRPLFITNKQRGLSYVFNFACAKRFVS
FT                   ANNLLCIIRAHEVHELGFKLYRPHPNHLFPCIISLFSAPNYCSSFGNKGAVLVVSKETI
FT                   CFKQFDSSPHPCVLQGRNAFSWSLPFLESNLMSIFLTLLSGSDYDPTVADRSEKGSSNG
FT                   EGCVTPLT"
FT   CDS_pept        784015..784515
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_1990"
FT                   /old_locus_tag="LmjF36_1990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.1990"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.1990:mRNA"
FT                   /db_xref="GOA:Q4Q1M4"
FT                   /db_xref="GeneDB:LmjF.36.1990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M4"
FT                   /protein_id="CAJ09155.1"
FT                   /translation="MRYTGISFLFVFISLIFSIHAFLSLRLPLHSQACRLTSTQKPALL
FT                   RFGKGSSSICRAARVLRFWPFSMTESAEALQRRINHAIENQMAPPEANYISELLAASLA
FT                   LDNSNEQLRLLDYRWQTYLDKQYVQSQRLDEFLEGLVQHLLKKKPDRPLEELLLYLECE
FT                   RRQ"
FT   CDS_pept        788830..792666
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2000"
FT                   /old_locus_tag="LmjF36_2000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2000"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2000:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2000"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M3"
FT                   /protein_id="CAJ09156.1"
FT                   /translation="MSDTSLDFLLSEILSPDNVQRAAAEKELERRGLEVPGFCFSLARY
FT                   CRTLMGNQSSHAVALVALAVLKRSVTASDRAEELEQVVSSLLSDLTDIAALPGGAAAAM
FT                   RQWSSTVCTTVRRLAVLCASPTAAPAAGQATTGAITAQLLGAFDQYPNADASGLLSVFS
FT                   HVWLLRTMFEEPVPELMHAWCAELLLNCAPPLFEILCAGTAATLSMASSDSSAFAADSP
FT                   EVYARCSLLTLIAQTLAALYEWQFASSGRKRFPAELKQHFLSAYPLLQSFMCTPCARWL
FT                   SVCVGATSSASALPCAQARAANFAAASLAALEYVSSVLQLGGWYKRCVSAQLFQALLQS
FT                   LEADAACYGVALCVDVEEEAESLTASAGWTGWPHTGSGGGEQGDDASSHSWTTVVRRRA
FT                   TQCWSLFLDAALLPFLKVGLVDVVGYQCGLQYYKLLLAYAVPSPVDVGSWLHDPNTFLR
FT                   EEEEREDRVRWSTRNTVAQLYADSIAALGPLFLHASLEDLHERLLAPIPDNDGRTCGDG
FT                   QTSLAYDGTVMLTASQQQREAALFFMETVLKHRSRQLRECGAVDFTPLATHLWSNDVAS
FT                   ASAHPGLTARTLMLIAAIVRFTHATLVATEPAASADAAAATNTEAAAEGFMATVVADST
FT                   HALSLFTGTSKETIAASSSSCTPLVAVLLCRVLQRTLPYWSDVLLAQHSVAWQVSLLAL
FT                   LSSEAGLTDEALYNTVEQLTDLLKISRAARKKSAQPHYGRVSTAAAAPPMLDALPRTVM
FT                   DCWRRHVSDPNLADAVLGLLRHVVRDGESGASFVLQELPWINGVLSGFAESTAELCAVP
FT                   YFLHLLKCLFEHAPDEVANCAAAMMLDSLCQLLLCTEESAILGVSSSCLAALLRRCLAV
FT                   QSVQVRVVAATVEAAMAGGATTDEGGLSGAVGTTARLADAPRTVYPFATVIVAFVLRTL
FT                   AGRLDEASLMDVGDTLVAIMQKYTSFSEAELIRIIHATVRRLSIVRTDTIAQQLLAPLA
FT                   TLMALHPAALLRTLTQGGFLVETMSRWLPRVEHFSNLRATFVSCEGLLKMLSCLSQPSS
FT                   SPMLTAEEAQQMAQQPVTCRWLLPEELTESNKGSRKASRRGSKGGSAAATRRVILSSLT
FT                   PGTSVETSLPLYAGVLVGVGRGLLALLAAPPAVLWRASQAAGDTATPGTGIGAGVFPSD
FT                   EDGDDSNGLFRGDSVDGSDPEAEDTWEEDVDSFSDDETQGDARELEAPDINAYSPETTD
FT                   RQRLLRPMGAQMLPWMQTHGAEVASFFTLQEAQTLTSFFTSCAASGECGPSAA"
FT   CDS_pept        793740..794843
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2010"
FT                   /old_locus_tag="LmjF36_2010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2010"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2010:mRNA"
FT                   /db_xref="GOA:Q4Q1M2"
FT                   /db_xref="GeneDB:LmjF.36.2010"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M2"
FT                   /protein_id="CAJ09157.1"
FT                   /translation="MRLHAGNHSPVIRPGARAGAHDGVTASVFSEVHLAAASPPSSAPF
FT                   RPAHGTDRQGLVRGRTVPTVVDAPHDSRFPLSLEIEGVQTGEEVVVDVPSVRQRSSTSS
FT                   ISNDTAQLQRLRRQLEKVTADLKAAVNTNRRQKQAHQQQREKWLVLSNESDARLLNVQS
FT                   NQESRERLLCSELRDAIAHLLGEFKAQALKERAADQAHAGDKAEWDAKHAVLLSELEAA
FT                   RAALATQVTAANSADTHKEEADQLRAELEALRRSSGDQQRSFEEKIMQTQSALQAKQSE
FT                   LNRYLQERDQHNYLVAQCRLFIQQVCQPGFSVVKGPSLEPVETQRPEPTGFVLVPLAVL
FT                   LHGYALLPEGDRQALIDHYDGKAKSLK"
FT   CDS_pept        795457..797154
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2020"
FT                   /old_locus_tag="LmjF36_2020"
FT                   /product="chaperonin HSP60, mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2020"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2020:mRNA"
FT                   /db_xref="GOA:Q4Q1M1"
FT                   /db_xref="GeneDB:LmjF.36.2020"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M1"
FT                   /protein_id="CAJ09158.1"
FT                   /translation="MLRSAVCLAGKDVRFGEEARRSMQKGVTRAVAAVATTLGPKGRNV
FT                   IIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNQTNDLAGDGTTTSAVLVD
FT                   SIFGEGLKCIAQGTNPIDMKRGMDVAVHYVQTSLLKQSRPIKGTEDIVRVATISANGDK
FT                   EIGEMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMKIERGFLSPYFVTDAKVQKAEL
FT                   EDLNVLVSKKKISTIQTLLPALNHVAQQGRPLLIIADDVESEALTTLIFNKLQGKLKVC
FT                   CVKAPGFGDTKEGMLEDIAVFTGAKVVGDENTGVELDARSFDPSILGSAKKVTVTKDDT
FT                   VMLNGGGDAAAVKERQQLLRDRIEQEAVEYNREKLQERLAKLSGGVAVIKVGGGSEVEV
FT                   SEKKDRVVDAVCSTRAAVQEGIVAGGGTALLRASKELEALANDGSLTRDQRTGVTIVRN
FT                   AIRLPAMKIAANAGKEGAVIVEKVLEASEESTGYDAQNDKYVNMFEAGIIDPTRVVRVA
FT                   ISDATSVASLMMTAEAAIVEAPKESKAKNGKRSAAAETEDDEELFGSY"
FT   CDS_pept        799749..801437
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2030"
FT                   /old_locus_tag="LmjF36_2030"
FT                   /product="chaperonin HSP60, mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2030:mRNA"
FT                   /db_xref="GOA:Q4Q1M0"
FT                   /db_xref="GeneDB:LmjF.36.2030"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1M0"
FT                   /protein_id="CAJ09159.1"
FT                   /translation="MLRSAVCLAGKDVRFSDKARRSMQKGVTRAVAAVATTLGPKGRNV
FT                   IIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNKTNDLAGDGTTTSAVLVD
FT                   SIFGEGLKCIAQGTNPIDMKRGMDRAVEVILKSVAKQSRPIKGSEDIVQVATISANGDK
FT                   EIGEMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMSVDRGYVSPYFVTDAKAQKAEL
FT                   EDALVLMSAKKIQSIHSLLPALNHVVRSGRPLLIIADDVESEALTTLIFNKLQGKLKVC
FT                   CVKAPGFGDNKTAMLQDMSVFTGAQLVGDEGTGLELDAENFDPSILGSVKKVTVTKDDT
FT                   VMLNGGGDAAAVKERVELLRELIKNETSDYNRDKLKERLAKLSGGVAVIKVGGGSEVEV
FT                   NEKKDRIEDALCSTRAAVQEGIVAGGGTALLRASKELEALANDGSLTRDQRTGVTIVRN
FT                   AIRLPAMTIAANAGKEGAVIVEKVLEASEESTGYDAQNDKYVNMFEAGIIDPTRVVRVA
FT                   ISDATSVASLMMTAEAAIVELPKDDSAAAPMGDMGGMGGMGGMGF"
FT   CDS_pept        805406..807454
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2035"
FT                   /old_locus_tag="LmjF36_2035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2035"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2035:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2035"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L9"
FT                   /protein_id="CAJ09160.1"
FT                   /translation="MRNPTDMGTAVASQSPTDVLRPSTSVETMMSLTVPAASSRQSTSS
FT                   WLPTRLTSSYCVLSAAGLQEDFYTSCLSWGTNQIALALQEDLVLFHPSHPRQASSTARI
FT                   STPPALGEADSNTGTGSSAAFSGPRRATAVAMTRFQETSCFLGMSNGAVELYEGRGDGT
FT                   LQRTVAFAMPPPPTGYLSSLVLGSEDCGGAASPTSRAARALCLLRSSVSSISCVGTSSR
FT                   HPWLGSAATAARGLITLDARQVQPAIRFGTDAELSRDEGAPRSSSVSASDSSAVSGGLS
FT                   KLQRAASFLRKHDRLCSVSWNATGSLVATGSGSGIVKVWSLSAPQRPLHTFLVDQDCSV
FT                   KALCFHPGSPYVLLVGASAGAAGLRTYDLSGAEPVLTSTGATAAPVTQALYDPEGNYAV
FT                   TGAGVPLSPVSSSLPPPPFPVLAAHAELGATGGGSGSGFHEHGTGWHRSSSTRPSATSS
FT                   SSAIGASGGATLLHDSWGEMEMPASPLSATLDTTAGLAGALASESSGNSAAAHSAPPNA
FT                   LVVWRCGTRLRENYLRDALLQRSDRRRNSTGGRDDFARHGDDASDDDSDDVAQVDCLAR
FT                   GGLRDSTVVADDGHSSDIGYPRSEWMPMYALPGHRARPLLICAPFPQSPFAGCYASIAG
FT                   GEDGTIRFWRFFETTSDATHWQHRRQAQQQSATTQEDMDLLATPVLR"
FT   CDS_pept        809726..811069
FT                   /transl_table=1
FT                   /gene="ALG3"
FT                   /locus_tag="LMJF_36_2040"
FT                   /old_locus_tag="LmjF36_2040"
FT                   /product="putative
FT                   dolichyl-P-Man:GDP-Man5GlcNAc2-PP-dolichyl
FT                   alpha-1,3-mannosyltransferase"
FT                   /EC_number="2.4.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2040:mRNA"
FT                   /db_xref="GOA:Q4Q1L8"
FT                   /db_xref="GeneDB:LmjF.36.2040"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L8"
FT                   /protein_id="CAJ09161.1"
FT                   /translation="MRFMDVALAAEAVVIITVILTVPYTEIDWKAYMEEVEGFLAGELD
FT                   YRNLKGGTGPLVYPGGFVWVYSVLYYLTKKGEAIELAQWIYAGVYLVTLTIILRLYTRS
FT                   GLTWKTMIPLFVSKRIRSLYVLRLFNDCWAMLFLFAAVSFIAGRPSGAAKRSRQWFIGC
FT                   LCYSIAVSIKMNVLLFAPGMLYVMLRTLPFGRVAWYLLVCAAWQVAAGLPFLAYDYRAY
FT                   LSKSFELDRVFLQRWSVNYQFLNAEIFVKPEFGQALLAMTVATWVLLWRTRWAARTYLT
FT                   DAEAQVLHPAISDTRRQNTPLRRGTADGDETMDDEAQEQAVYAATLLTFFEANLVGVIF
FT                   ARSIHYQFYTWFFYMVPFVLAYTTFPRVLRLVSFALIRQGFESFPPTPKTSMMLQGGFA
FT                   LTLFAFLFLGREARPAATREEAHPTRDNEPKLPQTQGTADATGGEKIR"
FT   CDS_pept        813976..816672
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2050"
FT                   /old_locus_tag="LmjF36_2050"
FT                   /product="putative serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2050"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2050:mRNA"
FT                   /db_xref="GOA:Q4Q1L7"
FT                   /db_xref="GeneDB:LmjF.36.2050"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L7"
FT                   /protein_id="CAJ09162.1"
FT                   /translation="MPSFFLFGRKKDKKKKTRDGATDEGDAATPSLTARENSNGSKESA
FT                   TKHGKGSTTSHDAAGGSTPPGLDTPPADASGPATETSPPLLPSTKQRSYSKNTMQELPP
FT                   PPPSAPPATNSPSLRASAVHLTLHHSTLNDAPVSTPRSVDLFPRELSEVTIPQLTEVFQ
FT                   VFRTFLDNCTSTEVKQKSVSQLRQVLPEIAAVDTTVSAERIKAQNFHPTFSIEPILNHL
FT                   LAQPAPLRARLCLAIYRFCGELCEELEGDLLCQETGLFSGLQCMNPNLRPAADGNYGIS
FT                   GDPRQASLFGGSFTENGTAKIERCPDIDLPKIYNSLLHKEDYLPSAEELNEIFLRVQEL
FT                   LRVEPNVVMVAMPAVLVGDLHGQIRDLLENVLTLGGPLVSNEALALASPKSHAAKSKAP
FT                   TSKKSGKAAGAAKTFSGAPKGDENRPTQPPNYLFLGDYVDRGPSSLSVIALLFTAKLLS
FT                   PNTVFLLRGNHECPNTNRFYGFLDECHRSYPIVNHKVITLHMCARSASEENTDGAAANR
FT                   SGNSSPGANSTCKGDSGALSTIDTNSSVEPTAAGMGRHLGRDCEASPDDMGWDMKDHPL
FT                   WLVANDALCSLPLCAALYEEVEDDDRAALPPAPTAAASNTEDMLAADGTENPVAASKAK
FT                   KSTKAKAVKKSTRCSIGNASFAESFKSPNLVAGKSPTLTDGNARTTSNKAASTSTEPSP
FT                   LSPPSASAFVAKPKKTRQVVRVSAMHGGLSPFIDDSFDGIIAIYRFRNIEHGALADLTW
FT                   SDPSSSAAADGATASDSRANESQPPLSKFQSACVFNGAPIGFTGNPRGTGHIFGEDATI
FT                   DFINTNHLYFIVRAHQCVQEGFQWNHKDRLLTVFSAPNYCGMRNKGAVLLLDKNGAPTL
FT                   KQYAHTEAEEKSHATTTGAPQPPRLFS"
FT   CDS_pept        817741..819261
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2060"
FT                   /old_locus_tag="LmjF36_2060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2060:mRNA"
FT                   /db_xref="GOA:Q4Q1L6"
FT                   /db_xref="GeneDB:LmjF.36.2060"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L6"
FT                   /protein_id="CAJ09163.1"
FT                   /translation="MLGAQAVPSFLLALASSSSAPQCTQPQQLIECRPHDTLVQHSPYG
FT                   PSRNTTYGWGNLFQPPMTATVPGHPCIHIGISSLNGVPTVGKSDRSMRSLLTQYRKKFN
FT                   CLEHCHPYHKVGDAGTWKAWADMVRNSNVADGGRIHSLETVSAPPPHTVEGAAAAGVAS
FT                   AGATPLCPLAVNANRFLYTIKANNLLTHVKQLQMDDADVLAHVQVFFQERCPLLEPFLG
FT                   PVLVQLPPSFGYSAANVQRLTRLHQLLSQEEVLLLEATSVSPTAFSSSGTSSTPAPSSS
FT                   APRSQRRLRVAVEFRSRSWYRDETFALLRSFRWALVVAHHHDDPTYSQVIDTGAGFLYV
FT                   RLHGPLGRNVGDYGPLAMRLWAEKMVQYLHSERSPTDGDASSAVPGETTREVFIFLNNS
FT                   DSNVGGTTSSVVDATCLAEQMRNLLQCTSSRPPPAKTAAASPSPHVSAEPQPVVACVEA
FT                   ETSMAVPEDDCRASVAQHVRDEAVTPPPKRQRTAQRSSGTREDEIVID"
FT   CDS_pept        820688..821680
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2070"
FT                   /old_locus_tag="LmjF36_2070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2070"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2070:mRNA"
FT                   /db_xref="GOA:Q4Q1L5"
FT                   /db_xref="GeneDB:LmjF.36.2070"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L5"
FT                   /protein_id="CAJ09164.1"
FT                   /translation="MTEKPAKEPPLPRDLKAQFDVLAGTRWDGVGDDADAAEQLSQLRQ
FT                   EWKALGNACYGKGYFLAAIRCYSRLLEVPGGDTAQIRSNRSAAYLQSPMLVGPSLALKD
FT                   AEKAVELDPQWFKAHLRVGDAHRKRGHFAEAEAAYREALARQPECATALAGLRALQVES
FT                   AGLPAAAATFPRGHAERTPYHNAPPSPRSLSSRTTAHAVAVAQAKEEELQLTQEQLVHK
FT                   WKADISTREGRTGCRPRQASLSQADRQHGAAIKQALLARFRDKLESNGEFSAILRNRCE
FT                   EAMLRGEGINYRDADKLRNTYSHATNGIGLGISSDAYKEYTGRVDHRTW"
FT   CDS_pept        825651..829517
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2080"
FT                   /old_locus_tag="LmjF36_2080"
FT                   /product="streptococcal hemagglutinin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2080:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2080"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L4"
FT                   /protein_id="CAJ09165.1"
FT                   /translation="MRITAATATAPVGAPGAKVRKGKAKTIRAVAAAGAVWRPQSQLIF
FT                   TSNATSVTAPSNGELGDSKTAGAISTNGSINGYTGTSSALALKAAGTGGSGSCGVASVL
FT                   PIPTAPSSGSAQVPPLPSSGCAAVENQILRNDALEAVRRSGAEGFPPSREKGVVSCTLP
FT                   AAEKQRRVSDIARANELSTDNPNTFTPAEVPPWVAGGAPVDASKAADTGGGASAASFEG
FT                   VMDNSPFVSSSSLAPSDTGCTQRTKASHADQRPSATQRCDNGAFAERPQLLLSLAQDNR
FT                   GFLNPGYSCDSSDWSSEDSDASSGRAGADGSAGSARRQRTPSAAPSSRAAPSEQRGKAC
FT                   GGAPPPVLTTRLSSGRNRTALAVFPLTAAEEQSARQAYDTYRAQQEKAGYHRSDTSATK
FT                   LRSQRSASVSPSALSTSTSVGKRELLRLLHGLYHRAQAMMASTTKTAAPTSAPPQRKAM
FT                   SPTMSVGTADLLHKFPSTKYLLNAAEACFGSRRFRTLMAAVVADSDALVPIVVRNNDGG
FT                   ASAVPTASRSRLSSSSQGLTVEEALSFFRHLKHEMTSDVARHRERRQAEASAKPEAASG
FT                   DKRRNRPAKAAPLQPLLDLQGSQKTRSTSAPSCQAASQVCRLPSAQAGRRSGRPPPTPI
FT                   ALMAARHVTSASFPPSSTPPSPSPQLSSSPSRPGIPGAMTLVGPRKPTGRRKGPRRKTA
FT                   LPPPSPHPFGSNSCTPDATYMDDFIHTYVQRKAFAEIAEGQGFHDSTTVTLGKLIKVLH
FT                   WFELALDPSVIEHLCGVQVQPARESPDISIDFSTFVKIINSGLWCQRYSGGSGSSAPGS
FT                   TSADNNDDPESNACVPVLPPEAPARASPVALPIPGLTAADSASLSTGGGGAPCAKAASS
FT                   TISVRDIGGSNPSPLVLAPVSAAAHRRLSSLSSMSTSTASSPASGGSMHRSFVDTDDAY
FT                   PLVAHDSAIAALCRSIRQRLRRELRRSVSSGSNALLRPRDNQGSGNGAGDGAAQKEGSD
FT                   PQYSPSSRTAPASSCSWRSLSLASSAASSMSRGNVSVAGLVGESESASARDDGEVFSAS
FT                   PHFSKWRSDTKCSTPLSHQRLREQQSPSPHVGHRLPPHSHPYTLTPTPRAPRAQPARRG
FT                   EGAVASQWFPTAQRWQGHGHRLAAPPPARPATAQRPSLSTAVARRCRRHQESMHFITSL
FT                   SPYSNSGHGARRSASHCWSRIATLSALSRSRRSSSLHSCDTQSVVNSFQFSESGLSAAF
FT                   LSRTLPAQTVSRHPKRNRPSSAYTRLTTAPTHDACTAHVSHPPLSPAIRSSPLPYRRRL
FT                   FQAC"
FT   CDS_pept        833679..836495
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2090"
FT                   /old_locus_tag="LmjF36_2090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2090:mRNA"
FT                   /db_xref="GOA:Q4Q1L3"
FT                   /db_xref="GeneDB:LmjF.36.2090"
FT                   /db_xref="InterPro:IPR024224"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L3"
FT                   /protein_id="CAJ09166.1"
FT                   /translation="MSIRFDLDIGPKIEFVSPPDAITEEGKVKLLRCAFPDCNPDCGYN
FT                   FIFYFTMPDCTTAAAQSFSQTVAPPTTGNTVPELYGAAFYRQKHDPNVPRCYVQQVLVL
FT                   LSHLPYYNVHEIILRVVAPRFCQCCPLSPDTGKVPVSSSLIPVPEAYFEFDQSYSAEHY
FT                   TQEGVLSDAMAELAQWPSPHPQTRYTVTLLQQALVFITPAHSQRQSSRATRSSCASVRS
FT                   AMSVDKRVEFMEVARGSPRHRASALGSDFLPLFRLLGEQLHHLTHVWELLIRHEPLFIL
FT                   SNTPCMASAAAFSIASLVLPIEFSGTLRSYFTVQNEDFPRLSRMGKVLSFPTNEGLIVA
FT                   GTNPFLLRSFSGWPSLMVVMDGNTSIMVNGSIASPPPSAMAGAIPPLPQASPLRSQRSG
FT                   ACTAVSLASSLLRATLPGGPIAKTSPRPPLNGAHARTASGQEPLSVAMCSSNSTTSLGS
FT                   GSTSAHQHNSLGAPVTVVPSSFSSFNGNGDVFADVASRKPIVSSASSNTVDLPATYNVE
FT                   SPTYISPFASSTSRDSARRVEAAQQAQRSEDGSPAGEHASTCALGESPAQPSSGVSSHA
FT                   ERFSHGREYARLGSSDATLAAAAHLAPAPITMPSPVDFSVTLFTTDHYKTAVESVRAAE
FT                   HERRGSANHDDSRKSLQQRLHNYFDSSVHFLLNHEEQTQMLLKRLQMVSLLDEDAQRAS
FT                   VSLSLSHWHGNPRTVSSPTTSSKGLLFASPTPPLSSANTNSASGHCADPAAATNGITSC
FT                   SHFSVADDMVRKFFTSLTSEFLTPVTAWFQRVTAPYTAFHLCDRAFCDTLLTPSSFLDD
FT                   FAQRHRETAPSMWTQRHSYKTYKVVYERFAYGCLFKAYVLQLVDGSLRQQMEDFQVEDW
FT                   VTRVPSDAERIDLLINLFNTVQRELNETLDPDVLFVTSATSVLASMAVVLQQPHREQFM
FT                   LKIGELKL"
FT   CDS_pept        837416..838531
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2100"
FT                   /old_locus_tag="LmjF36_2100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2100:mRNA"
FT                   /db_xref="GOA:Q4Q1L2"
FT                   /db_xref="GeneDB:LmjF.36.2100"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L2"
FT                   /protein_id="CAJ09167.1"
FT                   /translation="MLSEEEQATLLKYYSTVKLHETQMDQLAQAYWAATREERGEIAKV
FT                   YAHTFVDPTFVQRLIFFHDYRMSLTAAGAGLSSSTGAAVGTGSSFAGQQSGSESANSPL
FT                   MAGPPSSFMAESPTTAANHAPRRTHAQHLLRSTIQEHFPKLTGPGPYALQFGCVQSEKE
FT                   REEVIELYSSQFLHPDPPELHRIVALPSSFSTRTRKRISGSYSWYLRCLATQELVCAVT
FT                   VTVHQQETIRFAEMPLFATGVGYKKNGFGRLLNAALLAWCAEVGLEFIMISADVQAIPF
FT                   WRHLGYRAMTRGEKNRIDFFYQHDCCKFKGAETMIGYCNVDRGNGSLSGGVGRRAFHSG
FT                   GSTEVLHRSVRQVLAQLPRFVVEGPAKLPTE"
FT   CDS_pept        840111..840971
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2110"
FT                   /old_locus_tag="LmjF36_2110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2110:mRNA"
FT                   /db_xref="GOA:Q4Q1L1"
FT                   /db_xref="GeneDB:LmjF.36.2110"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L1"
FT                   /protein_id="CAJ09168.1"
FT                   /translation="MNAMTDTEVVQYVLQNKSNYYKVLMVGTDATDAQIKVAYKKMALK
FT                   CHPDKNKHKQAADAFKLVGTAHTTLSDATKRSIYDRHGAEGVQRHESGGARRSANGAGV
FT                   YRHRPAGQRDFFEEFFFGNGYHANGQGVHPGAGGARYQAEVNINPNALLFVPIVVFLLV
FT                   AMLLSSSYTDVDASNPLFGGGLRGAGMAGTSFSFTASQNEGFVVQRTTSLYGLRVPYYT
FT                   TPRMSEMIDRRKEVYLSMEQKVLETWRDSLGRRCEAESLKYRSRGRNEVPPVCGDYQHF
FT                   RRALG"
FT   CDS_pept        844367..846346
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2115"
FT                   /old_locus_tag="LmjF36_2115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2115"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2115:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2115"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1L0"
FT                   /protein_id="CAJ09169.1"
FT                   /translation="MPLSPLIRPMSPLQTQCAPSLPEPYSLADIVLQPFSAAASSTPAG
FT                   AWDEDTSFVAVTGAIAPELRRSSPTAPLSGVDAASVPPMAMWTPAIPPLLPHTLAPTFH
FT                   SMVGDALSVEMLRESYAAQLQKGCQYRSVVEGPRCTSDGAAARARTCSGSDAGAAEVFA
FT                   ANDAVHVGHSRRAPLPSLALSSPIHPYVSGPTAHTRVAPKTPAEELSSAATSSSLLHSA
FT                   ATTAMAAARPSYGAALLRKHPPAQPTGRREGCRLHLPAQKQVQRSSSQSLFERRIHDRW
FT                   EVVSPTSPLSSCGGASTAAESSETGPSKPNITVPFTASATCYHGTAASDCTGRSHAISI
FT                   AAPPVVKKGGGAAATNTPAGCGARVSNSGVVSALGQAKVEAFGTLPCYAPDSACGSGEV
FT                   GDTFFDPPHGLSRKARQTIQPGPATEPVRKPAAQNQGKAARGTAPTTRSSGGAASGPAT
FT                   GSAASRAAEFHLPRYVYPALEECRRLLHEIRIASPLMHRCLTPPRPLEGSSGGGSGAAT
FT                   AASAPSTFSPARAPSRNIPAPPYSSVFPSLAAAATAAAPPKPAILAPKPEARRLYHWDA
FT                   ATAAEDLSFMRGPFQQSSERFAASVNCQLRRLQALGTRLYGKTHDMSTSQAEVHAAARG
FT                   RWSLPSPTPLTSRWDSAVPHFDDD"
FT   CDS_pept        848091..852692
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2120"
FT                   /old_locus_tag="LmjF36_2120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2120:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K9"
FT                   /protein_id="CAJ09170.1"
FT                   /translation="MEAIMSSPLLQRGPLQQPPPPSPSGSHSLQEEVEEHHQQLMQRSF
FT                   EGVPLPEPFSFTGSTESTVADIKHGSSGDGRHDGKWRLEYGDDNTKSSPALFGCHDYDG
FT                   AHNEDADDMSMVCEQGEADCSLGSAPHQAEMRTAHWPLCKRGETEEGQEKAWGVISARQ
FT                   RTSSAPRRGAGIGSYSCASSNAEAIADCSSSGGSPIPNSDGGRAALDRRELIRAEGHPV
FT                   VSEEEDKGDRYCGTPHSSSHGHNADCNGTAASQRFEHAAQQDLLLRTSRKLVYSNSATM
FT                   LSPTVVDTAVEGSDTAVTPVAAPTKSDGVHDDQDGVTAVPTVKRLEGAAVSHGKLSPLY
FT                   LAASDVNGASPSAHWACSALPCHNALQAPSAVEAPTLPSSSSAAHAKVVPLCGSMEQGS
FT                   GETANLQDTHRRLPPSASAPSEVDRVDAEIENAMLEMEKRLQRHCHHAGAATTGADSDG
FT                   CVASHSSTPSLRRSEGDISKRAESDRMENQRAHPSSFSATHEAAADAASVKSAHEEDWL
FT                   ARRRCKQAGVCDAEGVGAYRRGRALGEGAPAWASAAYTFFSSQLRPPEDRRGRIYELAK
FT                   ALREDGAHAALRGPGGGLLASPPADEQSPGRVEGAAPLRVPCAARGTSVSLGDAVAGSA
FT                   DMAMFRSQSTPVPPVQGERFAPHQQEFTAAGLQVYYSRCSLSSGEKEPRRCPRLSGSTL
FT                   LGSSVVEGMPSAATAEGVSTAMAAAAALTVDSSGTSSCTPFTSRRQRPPPRMLCPPTPS
FT                   PSPSPSRSTAMDAVLAAVANAEEGKESDAGVMEQSVFAEAAPGAEPQLQPQSRNANVLP
FT                   GQSSLEPCTVSLGVEAADTMPLEAATAAANPATLSPWQTLLWSSSSAPTVPADTVVPAA
FT                   ASAVATTSAADVDSDAGVSVIRSSSSCLKRAVEGNDGADTGLQGELANREGALTEPRPE
FT                   ADTSVSVGDADGPLPLSPRCASSEPSKLQLHGGHTFASSAYRADSAPQHAGVVAANSAS
FT                   SLGCERAASGAASHHSASPPSAAVTAAVPLMRHDGAGEDSLLLPICATSFPQGGQSTGR
FT                   MSLPPSRRDGCGGAFSSWSTSSAACEGAGADNAVDVANDATDDGVQGHALTIRQSANTR
FT                   KSPSTAVAEGEEHPQVPMRFLSSSAVSPSPIRPSTGGASGKERLHHELPILHWRAGGGG
FT                   EVGGGQHDDADSSDEYNEAHLCCDDWASSPAEPAAAAATFQTRQSDTPDGLHVDSDDDD
FT                   NADDDGGEDTAGQTWIEEALRRAEAKCAVLRLELTFATERAVAAEANARARERECAELH
FT                   ALASRMQAQLAAAQMTAEWATANTRADAEVQVAACTASLDDIAASAFSSPNSPNRLGTT
FT                   SLSMRKGTALADGTVWRRRHDIVAQELATLKVSMAEQLAVLDRLGMQPPFSEELVCAAE
FT                   RRLRHVKVAHAPGTAMKASQPDATIPGTPHTLTRSTCVDSAASADLSAGGASVTATTKK
FT                   IQVRNGNKIAALLNLRKQNRHQEKPAAAAADAMATGVTDSATTPSTSAPPVKRDGSEDC
FT                   RTTLDAKENHYVV"
FT   CDS_pept        853926..855647
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2130"
FT                   /old_locus_tag="LmjF36_2130"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2130:mRNA"
FT                   /db_xref="GOA:Q4Q1K8"
FT                   /db_xref="GeneDB:LmjF.36.2130"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K8"
FT                   /protein_id="CAJ09171.1"
FT                   /translation="MAERNYSPFSGFSTTSRGGGGSGAHRKGSAEGLGSKLAPVNWSTK
FT                   SLVPGKWKVVDASAIRKAASVKDDHGASKVKHLSDIEAEEWRQANSITVSDSDQCPNPV
FT                   TEFDMLTAVPQYLKAKLLAQGFTAPTPIQAQSWSIVLSGRDLVGVAKTGSGKTLAFIVP
FT                   ALAHIALQEPLKVGDGPMVIVLAPTRELAQQIEQEAIKVLPQSIRCGCIYGGAPKGPQL
FT                   GLLRQGVHILVATPGRLIDFMEIKRVNLLRVTYLVMDEADRMLDMGFEPQVRAICGQIR
FT                   PDRQTLMFSATWPREIQNLAASFQKNWVRINVGSMELLANKDVTQHFILTSEAAKLDEL
FT                   KRLIERHRNQRVLIFCKTKKTADYLEFQLKRNGVDCMAIHGDKEQRQREFILERFRKDP
FT                   RLCVVATDVAARGLDIKELETVVNYDFPMQIDDYVHRIGRTGRAGAKGASFTMITKHET
FT                   QLNASTVFQLVELVERAGQEVPGWLREWAEQGGGYHVPKRNRNMMGSFGRNGPRMRMPG
FT                   DSPAAGTGSSGGHFGLAPHAKGSQAFGMTDSTIQNKKFDYSSDDDDSARPAKRARQ"
FT   CDS_pept        859013..860083
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2140"
FT                   /old_locus_tag="LmjF36_2140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2140:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2140"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K7"
FT                   /protein_id="CAJ09172.1"
FT                   /translation="MLPASLSPIPHASGFAVAHTRTPIMGSLFLLIDIDNTLYEYSETG
FT                   FHHEMHDRIFAFAQQKVGLTAEQAECLSRKYWLNYGLSLYGYVKEYNVDAKEYSDFVHQ
FT                   CSYDKLHYNKPLIDMLLIMQYAPEAARGHDGPRSTNIDHLYYFTNANHSHARNVLDAQG
FT                   LRPIFTRPRPVGLPVKENHPASEQAGAEDQVEWLGFSYEDQWQLTHPEIANKPMRQAYE
FT                   AIYKAIEDQVAEDAALVATTTTAGSGSAFASSSASRNSDIAEEVKNKRARLRPENFVMV
FT                   DDSLMNIDAPLELGWSAVWYAHDTQELPTDVKDNASAPLYAAAVASGRLQVIRNILELR
FT                   AAVERIREVNSRSASS"
FT   CDS_pept        861163..861969
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2150"
FT                   /old_locus_tag="LmjF36_2150"
FT                   /product="putative ER--golgi transport protein erv25
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2150:mRNA"
FT                   /db_xref="GOA:Q4Q1K6"
FT                   /db_xref="GeneDB:LmjF.36.2150"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K6"
FT                   /protein_id="CAJ09173.1"
FT                   /translation="MMSSSNRGARVHWSLQGIPRLLLLLAGFAVALQATTSAQALTYHF
FT                   VDGKPLCFSEIIENVQTSQITGVYNWKPSAHSPASQVQLRLSAKDGTGNVYYDKEMMEG
FT                   EHSFAVQLHPNVLSGEQLICFTASSNFVASEDKPVKVSIELDQAPKNEFNADKVVVETI
FT                   QKRRQIDGLDVYTYQEAGGELKDILQPRAYLETIDRELSATKRLLDQLVTNLGISVMKE
FT                   SRMRATSESTFTRVWVCALLLIGIISGVLWMQFRFLKSTLRKKKLL"
FT   CDS_pept        865645..866034
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2160"
FT                   /old_locus_tag="LmjF36_2160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2160:mRNA"
FT                   /db_xref="GOA:Q4Q1K5"
FT                   /db_xref="GeneDB:LmjF.36.2160"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR037177"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K5"
FT                   /protein_id="CAJ09174.1"
FT                   /translation="MADEEDYDFEVNKKETDKIERPERLIEVLQHDTNQTLTEEMVEHA
FT                   QAVLDFMPVEYTYKDVAAKLKCRLDGAYGGTWHVIVGKHFGANVTNDDDTLINMKINGV
FT                   YFLAMRSGPPERPQESAENEAVTAE"
FT   CDS_pept        867241..869532
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2170"
FT                   /old_locus_tag="LmjF36_2170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2170:mRNA"
FT                   /db_xref="GOA:Q4Q1K4"
FT                   /db_xref="GeneDB:LmjF.36.2170"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K4"
FT                   /protein_id="CAJ09175.1"
FT                   /translation="MPAPKNKLKSFGKNRREIRSATTTYDEHGNWVGTPHQDKMRLVAN
FT                   KMFANYYDTLQQLGRVVARTVYPTSTDARVSSATSSCATAQDVSAGVAASLWMREMELF
FT                   RTPLLTTFWINDTDPLAAHVRAYMESLDPSLVEPISWYPIAGMGWRILADKAEFRKRPE
FT                   MQPLRQYLIRQTALGTISRQEEVSMIPPFLLDIQPNDVCLDMCASPGSKTAQMLVALGR
FT                   HKVVPFNSDASPFPFQYDSDGLVIANELDTKRANMLVHQVKRLRLLFPFALFTNHDARY
FT                   FPEMSLQSQPGDADKTTAAGTEVLRFDKILCDVVCSGDGTLRKAPHIFKLWSPKEAINL
FT                   QKLQIEIALRACHLLRVGGRLVYSTCSLNPVENEAVVAQIVHRTRGAMRLVDARALLPQ
FT                   LACAPGMTRWTVTDAKGCVFPAPEGNMHEALFPPHTPGGYSSAAVDALDLSLCMRLFPT
FT                   HCKGGGFFVAVLDKVSEYRLKRLEAQKAEEKSAPAESTAEAATERQTIIGSTAPPKREK
FT                   KEMHSVSSDGTEATADAGADALEGQLTTAHEPVKPKSLPPQFVGVPAEIQRAITDFYEI
FT                   SQFPMQLLFVRTAQGERELRLTPGSVCSIVSRMAAQVLRHKTDNVLIVSAGLRVIAFEC
FT                   LDKGWRIASESAVLFAKLMRRSSRLVRVPVSLIQDMVGSGGKLKEKLLESVEDTRLRSR
FT                   LERLPIGAFLLEIEAPKALGGVLYSVALRARSRIQLLVDHEDLEGVQLRLGEDPVEPAE
FT                   IPKAESADDA"
FT   CDS_pept        871206..872777
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2180"
FT                   /old_locus_tag="LmjF36_2180"
FT                   /product="protein-tyrosine phosphatase 1-like protein"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2180"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2180:mRNA"
FT                   /db_xref="GOA:Q4Q1K3"
FT                   /db_xref="GeneDB:LmjF.36.2180"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K3"
FT                   /protein_id="CAJ09176.1"
FT                   /translation="MSHDVSRVSRPSLLSNSSSRSTTEPPDASLQSAAATAAATPPPSN
FT                   TQTSGDDVAGSAEYTCGNYDLDGSTSTVDPLIDASCSKRERNPEFDMYKLPIEAQFNLI
FT                   EEEFAAIEASTMNPRLYNFTTSNANPTKNRYINVLANEETIFPPTSLTSAPPTTGGSRL
FT                   STSGSPPSMASAPSPMKSLTGRAQKIWGVAGQRLFGTRRGGTLPRDVEGNEKFTTGCVT
FT                   KKYPQWYINANVVDTSVEPVFVASQAPVQECIDDFLAVIYSCEVTLVLMLTELEEAGFV
FT                   KADRYWPEDSAPADRIESFGSMCVYKDEQDPYTCDAAHELVRRSFYIRPSAASQARAHK
FT                   IVMYQYVGWPDRGVPDSTESFEELLKIIQGYVMASPAPRVPAAGPESAAHSSIATNSGG
FT                   DGSTSNTGSGEGSGKLTPPVFVHCSAGIGRTGTLIGAYTAVKLTEAGLLTNTSIRRIVT
FT                   DMRKARFGMVQRVEQYMFLYMIVLQHMGVDARKFSARMQPRADLYNMRWMEARQKALLG
FT                   ARAAKR"
FT   CDS_pept        875333..877093
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2190"
FT                   /old_locus_tag="LmjF36_2190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2190:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2190"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K2"
FT                   /protein_id="CAJ09177.1"
FT                   /translation="MSNSVGACLPRAPVRGEGLGEGSATRPFAARRGLLPRPGVGDAST
FT                   ALQPQHSPNLASLQHAFRRLNRTTTASDEEAEQATFNCETEEDEDAVADDETGEEDGGG
FT                   GRGSVVQSDPLRVVVDFAEVRRVAARSKTAAAAAASSNGALQQAEEAEAMLTDAQKGSE
FT                   SHQQAQQDNANRLGLEAERDARDVASARAFLEKRARADVHRRATQAATTPAPPSELLLD
FT                   LLQHLPSTPGRAIYDRSSCPPTAAASGFNEDFHKCVQQLMTQIVLQRDGRAGDAKPPSV
FT                   SLADAAAAQQASASPRHRSRMQRKASKQKQKEGEVEQLVEAAERGIADDVRDVVAYARF
FT                   VMQERLHQEQRMGSERLSPPSKTAVGESEGSLCPDGDTQTPKQHQLLAELRAVVEKKLS
FT                   LMRAAAEATDKEAEPESATLRRKRAQSTGGSEDDADGIPGATDAARQDSKAVFVAAHTR
FT                   FMDVVRSSAANRREKVEAAQAAEQRLEATVASWRKSYDKLLTRELSRHRAGKRPDKQSR
FT                   TEALLQAMQPQQEKHQKRQHHQPPTDLWEMTKGMPKKERKHLNKLVKAAANVFPLPPFH
FT                   YPPAPPHFSP"
FT   CDS_pept        877698..879629
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2200"
FT                   /old_locus_tag="LmjF36_2200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2200:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2200"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K1"
FT                   /protein_id="CAJ09178.1"
FT                   /translation="MEALFYDHAVASTATRQADLRQALQAFLADAASRSAVQLIALFVH
FT                   IPVPSTVSVASHTASGSRTSSRTSSSREGGSAAARHAATGKAASAASPSPPAASRRRCN
FT                   AAKLAWCAWEADRRLRQAAEDASEMNKWLAHDDLSASRKAGAGIARSYCRGAFVVAVAF
FT                   LAPCTRDDIVVYESWQRCTEMCAEASAADVARGSASRTTRMLSPLRHARLIALSLGAPS
FT                   LLLSWAERPTRCHLDSLLLPHQSLLVDLSWWVATASGSAGTVSDAAAGSRVSNSVLRDI
FT                   FISDVQRSLKLPKGDSRCAVWISYATLLESLHPQVMGRIDGADGDGVSVDMRVAGSASR
FT                   RKRGRNTLCGEFSGVDEQAFMMTYARIRHLLSSLNASQAGAVGHTRFLRVVLSYGGPSS
FT                   ALRRQLVHTCSRTEHGVTAVDAALLRTRSLVDVHALFGVLAGQDTVNVYSEAAAFVRTA
FT                   RRRASAGEAAQQRHQRIAVQSARVEVTSSPSSGPPGTEHEGVDSGAGNLCHNAFVERGA
FT                   RALARRLRLWERKRLGKRGKRGVHVRPRDKAARRPMKRGHAGTNDADSERVLVHAVERA
FT                   SRAAATPKTGNKRRAEPLASVDGRPSASATRALLPPQKQRRTDAVAVSPTLATDTALRW
FT                   SEDVAGSG"
FT   CDS_pept        880651..882105
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2210"
FT                   /old_locus_tag="LmjF36_2210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2210"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2210:mRNA"
FT                   /db_xref="GOA:Q4Q1K0"
FT                   /db_xref="GeneDB:LmjF.36.2210"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1K0"
FT                   /protein_id="CAJ09179.1"
FT                   /translation="MSSGADAYGNGAHTQYPQAEPHYSGVGGPPVDGTPLYPEAASNPV
FT                   QAPRLSRFRIQGFKDVWATFVFAIFVIFSIVWSIVQLTTYHFDADPHSQSPFSGANGPR
FT                   VGYVVIACLASAVASVISSIVMLALMQRIPVHMIYVANIMTIFMFLASAVLAFLRINVV
FT                   VGILMIICGVFQAVWLFLVRDRIPFAAALLRTAARLISTYKLTVVLNLMLCTLSFGYIT
FT                   LWGYGVAAPVDRMYKDQANGGYMFVVAVLVFSMLWMSQVTPNVMHVTTSGLVATWYFAG
FT                   SDNMPRNPTLASFKRATTTSFGSICFGSLVVAIIQFIRWLVESAGSDYENGFLHCLLAC
FT                   ILQCIERIVEYFNRYAFVHVAIYGCSYIEGAKRTFTLCKQCFFAAYFNDCLVSPTLNMF
FT                   TLAVSLVFALIAGVSSKSWPIGVLVFVVAVLVHSLFFVPVDSAVTTVFVCFAECPEALR
FT                   ESDLQLYATIHAADANGTHNNAPPPL"
FT   CDS_pept        884021..885148
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2220"
FT                   /old_locus_tag="LmjF36_2220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2220:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2220"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J9"
FT                   /protein_id="CAJ09180.1"
FT                   /translation="MFRGHTFLLSLAASPLTVVELTQNGGRVVYDLDDKTPVTCAIIAS
FT                   DNQPGTPAHSSRGSGPSKELPKSLESRVRSSRLTVVYEHWVHQCLRENRLLLPCQDYPD
FT                   TIAYDPYLFTGVHFTTTQLPLQLKANIIALMQFYGATYHNHLLDTTNLLVYSHMHLSPA
FT                   APRHAATAPLALRLLAAGSREAEAPLSTKEMEAANTSPSQQLSAERSGDNSTEAAQPSL
FT                   TKLDVARQRGLACVTPQWVQLCLKTGELKPASSALAAAPLAQTPSPPSTNSSSTIRADA
FT                   PVPIVTAADELRHHEEEVDRWVGEVLTSTPPLARPHSGGATTGVCAAPLPGPSLCTVPG
FT                   RQKEAAEVREALKLAAQLSLSGASASRIRKRRRAH"
FT   CDS_pept        886920..888599
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2230"
FT                   /old_locus_tag="LmjF36_2230"
FT                   /product="vacuolar protein sorting-associated protein
FT                   45-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2230:mRNA"
FT                   /db_xref="GOA:Q4Q1J8"
FT                   /db_xref="GeneDB:LmjF.36.2230"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J8"
FT                   /protein_id="CAJ09181.1"
FT                   /translation="MNRILPCDTNMKVLLVDDGALPMIATAFSQTELLKHGVYLVESLN
FT                   SAARQRNLMKMLRCYILLRPSLTSVEAACVELRMAKYRSYHIFFCGATSAEMLDRLANA
FT                   DNDSLVEEVQEVFCDFNAINKDAFVLETPPPQSLVSSFLSASQVRRLAEGLASLMVAQR
FT                   RRPRIRYQKNSPFVQRLASELVNVLKSDPELYDYPARDTVLLLLDRNDDPLTPLLTPWT
FT                   YQAMLHEHIGLRSNTLQLPADVQGAEKEGYVFSEHDDTFFANNMFNNWGDLCNNVKRYV
FT                   DQCKEALNLDRPTATLEELKAFMQKIPQTKSLTGSVTKHTTVTTYLSGVLKKRNLLEIS
FT                   LLEQDMIASSDQSNHWTRLQSFASRPSTSQEDLTRLCLIYHLRYEKSRGTSQVAPYLDR
FT                   VNSNYALLLSKLRQYYGLHRNTDRLFAATGVMAKIVKTFVDVGNIYTQHEPVLKRTLQQ
FT                   LYSGQLDTAFYPYLEQLTSSSGGGGVANAEHKPMEVIVYMCGGYTFEEAALVHGINART
FT                   AYKPADAASFAAGGSSIKASIGGEAVLNTHSFLSLLDQLSPS"
FT   CDS_pept        890931..898682
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2240"
FT                   /old_locus_tag="LmjF36_2240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2240:mRNA"
FT                   /db_xref="GOA:Q4Q1J7"
FT                   /db_xref="GeneDB:LmjF.36.2240"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J7"
FT                   /protein_id="CAJ09182.1"
FT                   /translation="MMSEADLVVLPSACSDNEPRSHGSYPDSPPVTSARRPAPLLPSGA
FT                   AYRAAPSTLVTAPGTQASVLNLVTALPLLLSLDRSHYTATLDNAQGGVLDIFTASGARG
FT                   DGRLGPLSWTTITTDAATAAVRAVLYARGTPSWQAKRRRLRRLALDSFFRSTVSARISV
FT                   RRDCGAEGGDGVREAVVRLLHHTRAVMSDISPTQAHLVDLFAAQIMCGAQGAGAAVEGL
FT                   PRAAAGKATDEPTDAEGGQSLGAAPAPTAMMRERSKPAFEQRGIMKSSVSASTSVTASP
FT                   RHAQGENISTPASATVAEQLLYIILRTSIAANTPRRPLVMHGDDTPALLVDGLHTPPPQ
FT                   GTDGATAVGSLTRKKPRLDSLDCIRPANLSSENGQSIYRYSNDAGGASPASALPYQPHC
FT                   WLAPSTVALVERSQALRRHQRWTCDLDPVIEATIAGEGSSTHSSHLFRGAGTRSAAVVS
FT                   LLDSMRSSWAPLPGMADSDDAVVLTALVRGSGLPFATASTSAALGVAHEAGPASHSCGF
FT                   QWGQTMMGGEDPAVEALFADGRARRVHSHREEEDGIPGSEGATQTRQREADAAAAALPA
FT                   CRIPFVSCLPLYNEVVYAQVHLALHWCAAGLADPFCLTHIDNTAGPNLPALRVRDEFYA
FT                   RSLPANGGAGAAAAATAISGLASLLEWGCYYGTLLRRLHRLCDVADNVTLRGTLGSYGR
FT                   CAMSTLRLLLCLLQRQIGELGYQAGGPHRLSFPELLTAYQRLQRAVEQVEVLAAFFGVP
FT                   AAAAVPEAWDPVDVLEERCSSALLISRLYECFTAYHADALGQHGSAATHYHALQQERLA
FT                   QLLASLGSEDSEEVPLQANTPGGGVDQQRQKMRAALAAVESGTASPSVNTSPVDTGDSY
FT                   GAWEQHRKDLLSYSIDAIGLLLRSTLRPLNAMLHRWLTAGELADPYDEFFVVPSHGQTH
FT                   SGFTLEPSPQRLPVFLSVAAATDLLHAGVSLRVLRVAATHVVLSAQKDARRLEGMAEVN
FT                   EAAAEDYAGELLDTQTLRRAIEQFIKQLVHGAPTADAVHDMGRSGTGANDEGEVTDAAP
FT                   MPLPPRVDLLSSYGAINWWKEHYQACTRVLLEVVEEAANPVEGSGEDGSTEATPDPSLW
FT                   LHADEEEGLRSAEEASAAENEHVGGVTSSETHTGHAELSLSGATAAPAVRDDHHRDRSP
FT                   HVTAAFPSNESTSEAPSYITIFINSDDDEDRGAHSGMGRAAGGRQGADSACIASSSSRS
FT                   STTATASVLGLRRIASSRFSTGTTVTSTASSRGTMALYGAITEELRQVSLLEQQTEADL
FT                   GQCRHALRAELDAQLWRRRRDSRLSDWKAQRLALRLRRVRAMEGIVEELRDVYMIRAAG
FT                   HTEVQEPASRPIEEAEQDAAAREPSMAGPAMTEMRIVVPLRQLPPRRVAPPVILYATPD
FT                   DEYGVDGVTGGRRGSRLFPDRSRRTSFAAHPTIMELPATGARDTPQSCGQQRRSLSASI
FT                   LRTNNWPRTSGSPSLSARTARRVSAAAAGAGAVTFIDPLSTGAAVQHSDGVGAGPGIIR
FT                   QLRDVAPAALSTFGVMEKGNPVEPGQSTAAKLTVPSASTPPPMPPSKSSHPRCEQVEAA
FT                   MLREHVDMPAAVAADEAHAAAMRRDELGYAHPDSLFRVADINDDEFLLMRTGPKGYARR
FT                   EAEAAALAELAERQAQLAACTVDEPGYLRQLAAAAAAAVSDPCRDSPKDSATLPNSGLS
FT                   AKRRSRASIKTERDGAARDHRVDAADSAVHVGGHTNLPLELDPAWQQDDPHRGSREARA
FT                   TMTRTKAMGKSFTDELWSWTATEAHHWYFDDLVPLHHVLTGAEVDRALIVDVSLTCDEA
FT                   EALQRCSGYYRALGQYTASFLTQKALQLTLLPPYGSLYCLTTQLLDVCLLQRAPIAVRL
FT                   MDLWITLVDAALEMTAEAEEASMMQRIISGETRLSALAALTDTRQGLNVTEALSSLNSA
FT                   FQHEWATCVTNGESTVKLEWRLMSSGGEGHERLSSVEEALGSDANFTEGDEAAEEGVRN
FT                   VSSASRLPRQPTPLSQGSAEKASNESFPIHSFLASLSLTAASPWCSGAWLLPDHTLHCT
FT                   GAIFRALLFWKSAERIVLHTWRAGMDSGLSSVFFFCTTVRQVLLSSLQETVWVRLAELT
FT                   AVYRESLRFEAGVLYTYRALESFTIDHAAFLRECEFYTLCGPQFQCRVRPVLQAMVDTV
FT                   EEAERALRFAQVSIRVARRQYMATFRSLVSSASSSESDGDTGSDFCRQARGRPTVASAP
FT                   QHVFTPSRWSRRARKRQSDGKAPAGGSVAWASPWYLQPLEDALARHSEKLSPPEATSGR
FT                   LADVDAPDTESEVDFDSAGTPRRRAEKGRKGQAVTAERSPSSAVSSATTARFTTPVFDK
FT                   SLLAVPGTAGGGEETYREGDSASTPTPRKKRRRGGSQPAGARQPTTATEAPMATTLRAS
FT                   ATAQRSQTPKCSRSAGVSVRQPPAPAKVSSSTVTGAAKTDTLAMKRPRRGRRQQRRMPS
FT                   AERKERRCKLRAIAERKIKEEVDHQRRLVRDMISRQLRRFAWLTQSLRNALADVIVEED
FT                   VKNMEDESIAAAATATSDGASLKSIKDLHKAQRQHMSRNTYISTILRKLDALIEVMATQ
FT                   V"
FT   CDS_pept        899839..900945
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2250"
FT                   /old_locus_tag="LmjF36_2250"
FT                   /product="putative developmentally regulated GTP-binding
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2250"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2250:mRNA"
FT                   /db_xref="GOA:Q4Q1J6"
FT                   /db_xref="GeneDB:LmjF.36.2250"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J6"
FT                   /protein_id="CAJ09183.1"
FT                   /translation="MSSLQKINDIEAELARTQKNKATMAHICALKARLAQLKRELIASE
FT                   SKKGGGKGEGFDVQKTGDARIGFIGFPSVGKSTLLSKMTSTHSEVAAYEFTTLTCVPGV
FT                   VNYRGAKLQMLDLPGIIEGAKDGKGRGRQVIAVARTCSLILIVLDIAKPLQHKLIIERE
FT                   LDGFGIRLNKSPPDIVIRKKDRGGISISSTCPLTHIDQETIKIILGEYRMANADVTFRG
FT                   DYTADEFIDAIEGNRAYIPAIYVLNKIDQISIEELDIVARIPHNCPISAHHEWNLDGLL
FT                   ECIWDHLNFIRVYTKPKGQVPDYDAPVILKKSPQPSVESFCNRIHRQLIRNYKYAWVWG
FT                   SSVKHQPQRVGKDHSLDDEDVVQVVKKV"
FT   CDS_pept        904028..905017
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2260"
FT                   /old_locus_tag="LmjF36_2260"
FT                   /product="guanylate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2260:mRNA"
FT                   /db_xref="GOA:Q4Q1J5"
FT                   /db_xref="GeneDB:LmjF.36.2260"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J5"
FT                   /protein_id="CAJ09184.1"
FT                   /translation="MSVAPKAPMPAISSVAAASAARKASQQAVGPLKGTVALRRLVDVL
FT                   LFVGPSGCGKSTVIRRLQRDWPTLFEFSVSHTTRCPRPGEVHGQHYYFVTMEEFQQLVD
FT                   AGHMIEYSRLCMPETSSSTPPLSKPVGNLYGTSKKALNTVLACNRVVLMDTDLLGAINI
FT                   RRYCSREVASTSPVTVSRAQRSIVQHDGGAAPAAQAPLTLSTPRHVAVSVENEHAAVLM
FT                   SAYSSKDSILSSSPSCAAPAVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRM
FT                   TLNRQWMQWARENQSFFDHYIVNDHLDLCYAKVKEIVRAEVLMVESTL"
FT   CDS_pept        906375..907760
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2270"
FT                   /old_locus_tag="LmjF36_2270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2270"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2270:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2270"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J4"
FT                   /protein_id="CAJ09185.1"
FT                   /translation="MAEAKVVKDLAEVCASGAETYSAWTTAKALVQRRYLSAKAQGTFE
FT                   DCGKLLASLTRVLQTYLRIDLAQELLSDVLFQVMEHFSAKQAAGATAAVVKDGGAPQSS
FT                   FDLAAANFLQHMFDTLLSATTRTYTLMGPMPLVVEWNRDADSGGVEAAVAQSKHAAPWA
FT                   EAVVLEFAVRAADFLSQRPQSADVLSHWAQNLFVSYEQLLALRLALPSSPPSTPQDGKA
FT                   ASAAAPSPSVPVPTLASQLLRMSTFNRASRTGKESSDSTSAATTPLTAAVYWLTHFARE
FT                   PNAVNHLFAQYVYFDILGRGQQRSSTANTTPGNSGAPAKMLRERVNAALEERCTLTRRE
FT                   AISMARAAVEAYWQAFPLVLQQTSSVSSPQPSSCAGESSKEDANVDPQDVHLYRWTWFL
FT                   DSLTLTFAYSGSASASIDEDAAVQQRERQKHVCAQLLELYADVTAELPGLKWQELVAAY
FT                   IGA"
FT   CDS_pept        908857..910344
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2280"
FT                   /old_locus_tag="LmjF36_2280"
FT                   /product="putative Bardet-Biedl syndrome 4 protein homolog
FT                   (BBS4-like protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2280:mRNA"
FT                   /db_xref="GOA:Q4Q1J3"
FT                   /db_xref="GeneDB:LmjF.36.2280"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J3"
FT                   /protein_id="CAJ09186.1"
FT                   /translation="MQTIGGRKPDVAPLSEMGSSRNGLGTELGATVASPHRDSSASAAS
FT                   TAANAQQKLVQELQAIRERRNWLIHLLYVRQEYSNCLQVIEAQLRETGGTCEYALYVKG
FT                   LLKRLEGSLSESLELLQTAVIISPENAATRTQLGRALHLLGRHEEAIQAFQEAASIRVV
FT                   KGLGADWAIEYYIGLCHLHRRHYRRAMDAFLQSITIQRHDCAYLQLGKAALLAHDYATA
FT                   LQVYDEAVTLSPTNPDLLAMLGHLYLQQGNPCAAFDYLGRCLTISPTHIDALVAASSII
FT                   QDSGDYDVALSKYRIVVAQQPDSAQVWNNIGACFIGKKMTYAAVACLRKSVFLCPFDWI
FT                   GHYNLGVAFLMIGRYCSALQCLNAAVHLHADHAPAFMLLGICLGEMKDLPNACRAYEHA
FT                   LAMQDDFLVYLNYAVTLYKGRSVQEAYSKFRVFRNVWDQLTPEQRREQSSLIPGVIRQL
FT                   EDLLEPPPEPPMSTSDAVPEESAAAALATAPNPESLP"
FT   CDS_pept        912965..914395
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2290"
FT                   /old_locus_tag="LmjF36_2290"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2290:mRNA"
FT                   /db_xref="GOA:Q4Q1J2"
FT                   /db_xref="GeneDB:LmjF.36.2290"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J2"
FT                   /protein_id="CAJ09187.1"
FT                   /translation="MRMPSVFTAPSTYMADLEVGAATAYHVHSEAAMAGESDTCKPAAT
FT                   TASPRPPMTPHAEDADARNGVELSISSTAVAPAYQLRGELGRGQYGCVYLVEECVRHHL
FT                   LAVKATYNPIQVAALRERQRRQERQQQKPSKGSVGCVREAALSPYAPHEEDHAAVPFLP
FT                   QMPHFSNEVMCLRECHSPFIVRLEGVDKGENGEDLLLMEYVDCGDLRREIRRRRATDTP
FT                   FTETEAVFVFLQLCMAVDHLHQLNILHHDLKPENVMLSSTGIIKLGDFGFAKKYTEPVS
FT                   QRVASTGCGTPYYLSPEALRGDRYSLKSEMWALGVILYELLALTGPFAAATRAELRAKV
FT                   HSSHYAKLPATYSNELRSVCYQLLTLDPDQRPSTRDLFQDNEYLREKLNALRRISECSV
FT                   NMSTEAKGSMFHSISAALRRKPPSAKGPATASFNLGWGGSCKISSHGQGSARPEAAPKP
FT                   RVERPAEMTPVARARRVC"
FT   CDS_pept        926759..928195
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2300"
FT                   /old_locus_tag="LmjF36_2300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2300:mRNA"
FT                   /db_xref="GOA:Q4Q1J1"
FT                   /db_xref="GeneDB:LmjF.36.2300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J1"
FT                   /protein_id="CAJ09188.1"
FT                   /translation="MEEGAPANATASLPPSYETVLAFLTTLAQWLKHARERLTCRDEVG
FT                   RHAIAVEALTRHRERAYEQLTESVWRHTAAAGDMSTSLLPSASVELTAWVLLRLLVLLL
FT                   TWWLLMRLVRATTLPRLRARQIAVHPHVHLPTSVGSAQVVEAFIHPDAAQRGINATLLL
FT                   TVSACVSVACLLILCLLAMHVWVDVVLLRLLQHWTAPLWQAQTWLASHVLWPSNSSPQG
FT                   SLQAPATPVEQYATSFISVVSGLNSSLFHKLAWLRRLTQQVKLMYLWGMVGGTMLGVVL
FT                   WLLGYSSTLLRTYNASLPYFEENDPLLRWLAQQEAEAAQQRTNAAFAALLESQHRQERV
FT                   MERLASSLAPATPRERQRYLQMTEEGAGSHCFVEDAALASATSDATEDERRNGETAAGG
FT                   ADAVIINNGCSGDGNAGKLRVASGPSPDSDLAAAFEVAASATRGEGAAEASCGTTPQAE
FT                   EEGAATTALRMAKEGESPGS"
FT   CDS_pept        929190..930167
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2310"
FT                   /old_locus_tag="LmjF36_2310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2310"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2310:mRNA"
FT                   /db_xref="GOA:Q4Q1J0"
FT                   /db_xref="GeneDB:LmjF.36.2310"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1J0"
FT                   /protein_id="CAJ09189.1"
FT                   /translation="MNRIPAATRNAPMYATAMSQFAVCRQPWNEYISLLTKDDAQPFHT
FT                   TPQEKPAYRGRKRGREGWLFGQQVQLHYHRFPDEQLFTNLTRWRMGDTVGDVAIQQFRN
FT                   AQPFDIEDKDPQGFQRPAPEVYMKLNYKNPATISRFLTRTGHMYPQDIMPLNPEAVVKL
FT                   RVAKAQAIRIGLYPRFGNPFWFRSQSFRPKAYQENYDPTTYSTKHTMEHFAYNWVQTDR
FT                   IRQYFKGLEELHQSRRATASSGGGGVTSEHKQQSQLYALDNMSIEMHRNAPSYRADVER
FT                   SIKKPTVPGLMSTKGMKKKFHNLYSSTSTKRMGFSNPTLGIKKV"
FT   CDS_pept        931395..932630
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2320"
FT                   /old_locus_tag="LmjF36_2320"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2320:mRNA"
FT                   /db_xref="GOA:Q4Q1I9"
FT                   /db_xref="GeneDB:LmjF.36.2320"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I9"
FT                   /protein_id="CAJ09190.1"
FT                   /translation="MPLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFARA
FT                   AQHEGSGLHIIYVRFRVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVSVP
FT                   GPLTNGQLAGPFSNLKGIARLADYPVELFPRGRSALLNDLEAGSYGVLALSNAGMLSDY
FT                   FKVMWKGTQWDALSEGKPVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECG
FT                   CLSMSWCANEDSKYVQALAGYMASKARVKGLDSTVAPIWEAAANGSGLEFNYAYEKEGP
FT                   KASAPLKSAPEVAKLAKAGSDPAAVAAMDRLYKNLIGLTAETTMQFLPLTCVLMGDSIV
FT                   SNSFYFDNPENVKKLQARINEHTMERQLKFLSRTTFLRQVRSVNINLLGCLEFGSQLSN
FT                   RADQLAPTKSNL"
FT   CDS_pept        934541..935725
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2330"
FT                   /old_locus_tag="LmjF36_2330"
FT                   /product="putative endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2330"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2330:mRNA"
FT                   /db_xref="GOA:Q4Q1I8"
FT                   /db_xref="GeneDB:LmjF.36.2330"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I8"
FT                   /protein_id="CAJ09191.1"
FT                   /translation="MGEKPPQQQCPASKDAADALGRSAEAHALNAPPSAVAPHPSEETR
FT                   RAWEAEQLRVGLLADVPRTEYYYCRHLSNHGNSTVQLHAPHNEGAAPGGVFVHQRFALP
FT                   NFEASLLARPQACATDNSAAHDADSTLCVPSSFSSPWEALWCQLRFDKARQSAAAVVQP
FT                   LPTLTLVGGVDISFIPDSDDGVACLAILRYPSMEQVRAYMHRCTLREPYMSGFLSFREI
FT                   QPFCELFDSVRVELLATQTMPQLLIVDGNGVQHPRRCGLATHLGVALDIPTIGCSKKML
FT                   QVDGLTREAVEAALETLGEAASSSPSLPRLLPLLGTSSPTQLYGYVVHGHLNSVKKCIY
FT                   VSPGHCVGFAVATALVVTMLRHRIPEPIRAADLGSRAYIRDALSSAATTSSHPT"
FT   CDS_pept        936286..937515
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2340"
FT                   /old_locus_tag="LmjF36_2340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2340:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2340"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I7"
FT                   /protein_id="CAJ09192.1"
FT                   /translation="MILLAFICGALWVIWSVASFLMYRPRQISGATVVVTGACTEMGRR
FT                   LCMQLYARGARVIAWDYSKIKLQELQADVLKATKEAESLDAAGLPDGGRAAGSFHSGAF
FT                   VVMTVDVSSRLQVQRAAKELDGPLDMIVHAAHTYPSKRLCDRADDSAERLIQTNLLSPL
FT                   MVVRQLLPLLLSASNSSSNAGGLHKAAQRRGDYAQVVTLVSAAANYTLSSDSPEYAASQ
FT                   WGMVGMHYSMREWIFQQRCEYMTGSGSGAPSETKTTAAAGSRTRRPAREVRTTLLCLNE
FT                   IQYGVPTVMNSLMSSSPGVSTTVRATSPTMSSSSAVSPESEEGGSIGSRGWSASTYRDS
FT                   YTQLLQKRNVELDKAAACCVRAICRGQERYCYTSAWATTVVYPLLMACPVPWAIRLLRW
FT                   IQHTPAAAEN"
FT   CDS_pept        939192..940190
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2350"
FT                   /old_locus_tag="LmjF36_2350"
FT                   /product="putative glyceraldehyde 3-phosphate
FT                   dehydrogenase, cytosolic"
FT                   /EC_number="1.2.1.12"
FT   ncRNA           941562..941633
FT                   /gene="LM36Cs1H2.1"
FT                   /locus_tag="LMJF_36_snoRNA0058"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           941675..941744
FT                   /gene="LM36Cs1H3.1"
FT                   /locus_tag="LMJF_36_snoRNA0078"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           941765..941832
FT                   /gene="LM36Cs1H4.1"
FT                   /locus_tag="LMJF_36_snoRNA0072"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942201..942298
FT                   /gene="LM36Cs1C1.1"
FT                   /locus_tag="LMJF_36_snoRNA0062"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942323..942414
FT                   /gene="LM36Cs1C2.1"
FT                   /locus_tag="LMJF_36_snoRNA0084"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942466..942540
FT                   /gene="LM36Cs1H1.1"
FT                   /locus_tag="LMJF_36_snoRNA0086"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942660..942767
FT                   /gene="LM36Cs1C3.1"
FT                   /locus_tag="LMJF_36_snoRNA0071"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942792..942863
FT                   /gene="LM36Cs1H2.2"
FT                   /locus_tag="LMJF_36_snoRNA0059"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942905..942974
FT                   /gene="LM36Cs1H3.2"
FT                   /locus_tag="LMJF_36_snoRNA0079"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           942995..943062
FT                   /gene="LM36Cs1H4.2"
FT                   /locus_tag="LMJF_36_snoRNA0073"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           943431..943528
FT                   /gene="LM36Cs1C1.2"
FT                   /locus_tag="LMJF_36_snoRNA0063"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           943553..943644
FT                   /gene="LM36Cs1C2.2"
FT                   /locus_tag="LMJF_36_snoRNA0085"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   CDS_pept        944761..946104
FT                   /transl_table=1
FT                   /gene="TAT"
FT                   /locus_tag="LMJF_36_2360"
FT                   /old_locus_tag="LmjF36_2360"
FT                   /product="tyrosine aminotransferase"
FT                   /EC_number="2.6.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2360"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2360:mRNA"
FT                   /db_xref="GOA:Q4Q1I5"
FT                   /db_xref="GeneDB:LmjF.36.2360"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005958"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I5"
FT                   /protein_id="CAJ09194.1"
FT                   /translation="MTIDAQAAPAAQALKASNSTGSLTEERREVEQRVAENASFRRITS
FT                   SKHAQRTLQPLNNLADNMKPSRSTKSNLRLSIGDPTVDGNLKIPEIVTEAVVDVVRSGE
FT                   FNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVIITSGVSQAIVLALTALCNE
FT                   GDNILVCAPSFPHYKSVCESYGIECRYYYLDPSKSWECDLRSAAGAVDRHTKAFVIINP
FT                   SNPCGSNFSRAHVSDIIDFCQHHQIPLISDEIYAEMVLNNGIFTSVADFDTSVPRLILG
FT                   GTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPT
FT                   ECTEHIVTQLEAGAKVYARLLEHDIGISMDAPQASMFVMLKLNLSYFQDLKSDMEFYEK
FT                   LLDEENVQVLPGEIFGMSGFIRATISRPSAVLNEAVDRIIEFCERHKK"
FT   CDS_pept        957077..959941
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2370"
FT                   /old_locus_tag="LmjF36_2370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2370"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2370:mRNA"
FT                   /db_xref="GOA:Q4Q1I4"
FT                   /db_xref="GeneDB:LmjF.36.2370"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I4"
FT                   /protein_id="CAJ09195.1"
FT                   /translation="MFSLNIKTAASTSSAAPTPAPGVNAGEAPWATIDVDEADSFESTP
FT                   STNSSGNQSGRHHYQHAAQPSHSPQSPETPIKFDHGVYPHCPIFIPSKGRSDLDRSTMA
FT                   VLVRDLVPFVLVVEREEAEGYRAMLDRLVGQYFGFAGMTFAASVDDGIEGATKTGAGVV
FT                   ESSSTTPADLWAFPCACCCGSTSVAGSPSSPTTPGLSADALRALALRLSAAFHHGYVFE
FT                   PTSAAAGNHHGAVESKNVSPPVSISPTTPSAASGGARRPSAAFVLRNVDEVRALFVIEV
FT                   LPETNRGVSYVRNYILQVLVPRLMVACGVDRSGNVEELRLCGPGEHNTLTPAALRMAAL
FT                   EPDVYSALEWKSETESYLDVRRASTTTNMVTASTGSAAGTKDGGVSASVGALSAPTGQT
FT                   LAPALSSSSAPRSSTASSAAAATRGTPRLLHGLFGFYWVLDDDIYGFYQSHGSSTKNER
FT                   ISTRTMMREVEVRLRQLRHNADVASPPPPSVPPSCFQTPPTPSSGSAAASPYVLSNQQQ
FT                   QQNFVFTCKEDALQNNIISGGKGRLPTLQNYSLYYTTACFSLEYNRFALDTAPDTLSVN
FT                   SYNNIACLFNYALLHNPPQMRYFPPGVPHVRRPEDALVGYLDHSMLWYRFAVREDYDFT
FT                   LQLIARGLHTLRFRSIAFDVPQMMKVRGGMTDYYRNCHEEIRQQNDRFVLQWPAVAQHW
FT                   VKGKEGSRRDDIRVRWDLLSPARTKHPGAFLYLSAPLPQLQPQRLSDDSTGGNGSVISS
FT                   SDSAATATAVEGTETETRKRLRPPSPTAPTAESSHAPAGRRPCVPAATASAPAMSSTVA
FT                   RDWKGGYVVERWRDISREEARQHAGLVALSNDDIHIGRTVAVIPPFFDQKPSVVRATVI
FT                   ERAVEPTDSHASSGRAGNTSTAEAGDAQQSLTPRVIWTAVAQDVRGMPFLHVDTCFEVP
FT                   AEGIEKAAASIDQFFAKMESEPGS"
FT   CDS_pept        961263..962324
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2380"
FT                   /old_locus_tag="LmjF36_2380"
FT                   /product="putative sterol 24-c-methyltransferase"
FT                   /EC_number="2.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2380"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2380:mRNA"
FT                   /db_xref="GOA:Q4Q1I3"
FT                   /db_xref="GeneDB:LmjF.36.2380"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I3"
FT                   /protein_id="CAJ09196.1"
FT                   /translation="MSAGGRETAPMNLLRRRNKDEINGDVNAAADRFRNRFEKATLEER
FT                   KAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFMEGD
FT                   HIVDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSCKIDYVKTDFCN
FT                   MSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPNDEYHR
FT                   TIKHRIELGDGLPEMETCKQVIEYMKEAGFVVEEAIDVISQFESSPIKSIPWYQPLVGD
FT                   YSSLQGLRSTPIGRILTNIMCRVLEFVHLAPKGTYKATEVLEEAAESLVVGGQLGIFTP
FT                   SFYIRARKPSKQA"
FT   CDS_pept        965198..966259
FT                   /transl_table=1
FT                   /gene="LmSMT"
FT                   /locus_tag="LMJF_36_2390"
FT                   /old_locus_tag="LmjF36_2390"
FT                   /product="putative sterol 24-c-methyltransferase"
FT                   /EC_number="2.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2390"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2390:mRNA"
FT                   /db_xref="GOA:Q4Q1I2"
FT                   /db_xref="GeneDB:LmjF.36.2390"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I2"
FT                   /protein_id="CAJ09197.1"
FT                   /translation="MSAGGREITPMNLLRRRNKDEINGDVNAAADRFRNRFEKATLEER
FT                   KAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFMEGD
FT                   HIVDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSCKIDYVKTDFCN
FT                   MSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPNDEYHR
FT                   TIKHRIELGDGLPEMETCKQVIEYMKEAGFVVEEAIDVISQFESSPIKSIPWYQPLVGD
FT                   YSSLQGLRSTPIGRILTNIMCRVLEFVHLAPKGTYKATEVLEEAAESLVVGGQLGIFTP
FT                   SFYIRARKPSKQA"
FT   CDS_pept        968576..969592
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2400"
FT                   /old_locus_tag="LmjF36_2400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2400"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2400:mRNA"
FT                   /db_xref="GOA:Q4Q1I1"
FT                   /db_xref="GeneDB:LmjF.36.2400"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I1"
FT                   /protein_id="CAJ09198.1"
FT                   /translation="MLNESEHHLVAVAFQSMDPNNTGMVALSEVKKRYFAHAHPRVKEG
FT                   SMAPSAARDTLDYHFSVCAADHEGSITFDEFLAYHEKLADEAYDEHVGDVAAFTKKTIM
FT                   GLWRLGDVLLPTGVRPAFPVTQTPTGLYAVTLMTLVWVERRQMAASPASGQQSPSSGGA
FT                   AHDDLFVLRGIKDVVRPIFTRGDLPDELQGYFAYPEELSGMAIDYVAPRLSIQRWYDFT
FT                   WEYSEGKYCGVEGIISTRVDLESLPAGLRQFVCEHATAVSRGTTWMQTRLVMNPMYKKT
FT                   SSAYGCGVNEECRKIHHWKVKTFEGKQYGSQYQGLCGKYFSKLGAPLKSGTATGINI"
FT   CDS_pept        974149..979926
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2410"
FT                   /old_locus_tag="LmjF36_2410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2410"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2410:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2410"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1I0"
FT                   /protein_id="CAJ09199.1"
FT                   /translation="MTVSLHDLIKEWEVVNAELYRASLESHQRYSFPASSHGRSNDSDC
FT                   SAEEPSLSPPPLSSTTTYARVYNLLSHVRQIAEDARYNSFCIIQHLLWVTVVAWANQMA
FT                   SASSNLIRLPSELRQYYEPSPWCATRRDGINDDTAGKKVPSASTPVQRTSFPCSLLPPL
FT                   EFWDPSVLEEMAGASSPAPEVVRNASLHRAPNLPEVWSNAVQRIFTLWCATPMAGSCAG
FT                   AVQPCTAQSTCSTVPPGTLEYAHVWVIVAQHYHRFKSLLSLFFLRYDVVLEDAEELLQR
FT                   RGRQQLQEQQDRRLSDLHDEEVQRAGTHSARPLSPPLRRRGETSLVSSFSISPGGAASA
FT                   AGADNSMSRSSTPAALSTDREATKTTDKQARLSACPPSSLPSTANLLGHLMRIIVNENL
FT                   AKIREVTGEVLLFLLLPRVHCARLRSQVTTPASDTGNPRQLSHCAPPQDNTETGEADTG
FT                   KEASLALKTMRQLSGVSSWHSDEQHDDDDDRVVWSSPPSPLLSYTAASFGHGNGDTPAP
FT                   APRAGILTSNPHVRERAQQEEYVARHVFKLLFLVEHCRVHVLQHWLVENGKRLAFFYGS
FT                   QLAANLFDNTAGQQAALAHDPSSCDPSVTTIAATRTLAGANRVLRETLQAYIRLRAKLL
FT                   FLNAGTTHFLDALTPWGRTRMLESLNAFLCGFCGVILPSSFPSDGGASDKSTTESSKEP
FT                   RNQAASSPLDGCDESVLFTPTNAAVADFVQRWGVPLWIAMCDEAQQRMEALKHVEQKRA
FT                   KRPKQRMPLPENECLCVMPPAKYQQQQQQRHTMEKWSGGDMGEKDHWRGGLCNTGTSSA
FT                   PVTSSLTTAVVSAVDDDRAEKPDTRDRHSVASTELEDAVSRTTSIVWPPRSPTVANEGE
FT                   AGSGGTGIHRHGGAKEADRAFTRRRGRGLDLKRVLQQQQQRRARLGNVKLPQQGVTASR
FT                   VGAPLASSEDGGGDVVESLYTEETASAGDDGSVSAAALGARSDGANVGRLRDNNGAAAT
FT                   AARQRGGNDLTTAAGSHVKRFSRSAQLHQVATLPDEGFPCLLYLMPRRSRFPVLDKAAA
FT                   ALQQQLFTRFSANVQAYLTDYLTECETAAAAAVAADQRAASALQKKKREKAAHVTTMGG
FT                   HAGAGTAATSSIAVVTPFPKPVLARMVFLLEMTYAALQGRDGAASESCGHHTEDNHAIG
FT                   NGGSRRPLMETGLTATGQELGAAVLEQCNGEFDGVVSTTLSAPTSPALLAIAAVRKGFQ
FT                   GFLISLEKRAVLALVQALYGLIQQGAAQQPPAAQLSAVDTILNMASLLNSKDMFVLLLK
FT                   GYLAPQVMMCRSQSEILVESQVVSRMAYRLGAAVAAPCMTLLRDLQLAMSDPRSTMRSS
FT                   PPSGARADLAEDRELNATHGSLSGEGRRGDGGDFGGASSRDIAMECAQLAATQDAETLG
FT                   DIRPLQHGAFGLIHRVRVLCQAWWQPHTAVVLSSRRLRQLWEQHQLLDERMVDAVLSVE
FT                   WQYDGHSEPFRGYGRQVKLRERENTSPLHPPSRSSGGGGPKSLRSSLSDAPHGSHWRHG
FT                   DGGQNSGPLAAGTQLRTVTAAAVVRGFSSALGNAVRRTGRQAGDFGYNDSDNESEDYRE
FT                   AYGGLLTLSTLQQYRSAYAPSNSSYRGSNLSSVGSPGAVGGLGASGEHRGTSDGGQSTT
FT                   VDDHASTAVPADGQLERRRLRWPLGNGQLAFYIFSRGAASAGRSVSQAVQIVGPPLALL
FT                   VCQLLDRASEQPYTFDALHKALPVQAPKPLLAHILHELVKADVVVRSVAAGARQLTYQL
FT                   RDDTREVRQRKVIVDVRAAARQQWVAQTMDMTAADDGEDDSSEKGGARNPAFPANPTEA
FT                   ATAFPASSLKPARQARLDAPVNAKAAPSAPGDEPSSPTYSADSAHKIKVCIVRIMKAER
FT                   VLPHRELVERVALALEGQLVVTPSQFKCCVAYLIEKEFLQRGEQGEYVFVS"
FT   CDS_pept        980511..983069
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2420"
FT                   /old_locus_tag="LmjF36_2420"
FT                   /product="serine peptidase, Clan SC, Family S9B"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2420"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2420:mRNA"
FT                   /db_xref="GOA:Q4Q1H9"
FT                   /db_xref="GeneDB:LmjF.36.2420"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H9"
FT                   /protein_id="CAJ09200.1"
FT                   /translation="MPPTALKSSMNELSRYMDAFTSAAGKPQHLTIVGDRVYWTQGKQQ
FT                   ELYSAPVGLEVAEAVRVIASDEQEVGEEKQFTKEEEMLRERTRSQTTGIANFHVRCNDG
FT                   AIFYTSGVEVYVYYQNGPRAGKAPLKLFDYMSEEDKTHFKAMGSKPNLFVQAIKSFDEA
FT                   HPSTHTVMTFVNNNNVYKATLTESPASEEAPLAVTVEQITHIGDDLHQCGVADYIIQEE
FT                   FSRYTGHYATDRYIVFSYIDSSHMRSVALLSSLGSPEVPEAEPACPTYATEMEEMPYSR
FT                   VGDPNARTTLIVYDTATKKMRLLPDVAIRKVAPWTEYILRFGFKDAETLYVSVASRAQE
FT                   DYAVMSCPIAALPTIAKEEDLRSLYSEKDGKVTANIIGDAAAPELRVEWKQRIDFAWVE
FT                   CQPGVPVHYGKVYDVLCRHAAETETAHYHLYARPAGDGNPETWKPLTAGAWNVCAGTQH
FT                   VCEDRVYFLANAEGRLKRTLYSVPLSLESAPHIADALTRLTPLDEHVYSYCAKGDHLYY
FT                   VSSTAAAPAKLYVSCVSAPQKRAEVTVPSWIATTPGTDPATTADPTRYFGGLPVVTPQI
FT                   VTVTNRRGVPLSAAVFVSPSAPKDAPGPLALFIYGGPHAQLVFENDYETRCKAPVQVLL
FT                   QHGISVAVVDNQMSNANGLRDLSICKKNFGNFETHDYVDVTQYLCNTPESESGSPANFR
FT                   FDAKRVAIFGWSYGGYATLLAMCQAADVFRIGFAGAPVGDWKLYDTGYTERYMGALYGE
FT                   DGSAESGASRNRNEAYMTSAISHYAGGFPEECNRLYIAHGLLDENVHFGHSCHVVKALV
FT                   DNAKPYSMLVYPGERHGLRQNRQSRLHHDALLVKTLEEQL"
FT   CDS_pept        992063..992782
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2430"
FT                   /old_locus_tag="LmjF36_2430"
FT                   /product="putative caltractin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2430"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2430:mRNA"
FT                   /db_xref="GOA:Q4Q1H8"
FT                   /db_xref="GeneDB:LmjF.36.2430"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H8"
FT                   /protein_id="CAJ09201.1"
FT                   /translation="MQDAGRALYTVTGQRVARSELLKLIAFAQDAVAKQQQELQNGQDQ
FT                   VSSQRRSVTTSAGSKSSPDATTASDGDATRFVISTRSSSPAGESISTFSVGESPLTTQH
FT                   GTTSTFAASATISPAPPSATASVSQIRFVSPHSHLLDSSDGIDLDVFEQMVLRKLKHRS
FT                   YEEELTYTFALLEDKSYPGFITKESVRRIAAETGEPLTEAEIAEMFDPLVTGVSTAAVD
FT                   LSTFTDLQLKARKAEDS"
FT   CDS_pept        993894..994595
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2440"
FT                   /old_locus_tag="LmjF36_2440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2440"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2440:mRNA"
FT                   /db_xref="GOA:Q4Q1H7"
FT                   /db_xref="GeneDB:LmjF.36.2440"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H7"
FT                   /protein_id="CAJ09202.1"
FT                   /translation="MTLWKHICDVCHRTVCDDCAPRNTESVDAKGEKATLRVCKTCGTT
FT                   GHRLGSAVGGHSAADGAQGTGAARPDPHSEAERERRARIIEERSRAQKNRGRPQRAGGE
FT                   GDSRAAVASERPAPPARAPSSPTSAPPRASASPPAAPPPLPANSGSQERLVNPALEAAM
FT                   RRQQQQQAHGRTAPTLPAANMSPEKTRLLCEIEALLAKHLEDPPFGLRAADEAKLHGYL
FT                   QFLKKKYHLSE"
FT   CDS_pept        995958..997313
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2450"
FT                   /old_locus_tag="LmjF36_2450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2450"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2450:mRNA"
FT                   /db_xref="GOA:Q4Q1H6"
FT                   /db_xref="GeneDB:LmjF.36.2450"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H6"
FT                   /protein_id="CAJ09203.1"
FT                   /translation="MQDWQIAVLVVVIVVFVALATPLIFLIYRVGSNRRRYSSKRTNKT
FT                   TSRYADSSYCAKHGIVDAGDAFGQLFRCDPRIHPSTHLLYFLDFQGELHWIDFNRKPAA
FT                   KIDTESALQQYIFETFHPMVEEGNRVVPLRPEMLALSYMNDQQSLLVLDLNRLLARDTE
FT                   FGARMRHTAERPLLLSRLVADVADGAVFTALSRYGYTAGDASVPPVTQTSMQCRALVAA
FT                   SPPQQHQQQIEVDLSTSRANPMAAAPAVSASMPDTHVPPPTVRPPVAPHLPPPSNFSSP
FT                   YACDASGMAPAPVIHPYDTHHITTSTPVSITATSYMVVNANGSRTELDAMNTARIEGAR
FT                   LRWDRRQSLVVPFTSGVLSGYHCIIDPVTEEVTLSTESAARAANVNGMESIVCQRADAL
FT                   YYTVERVNSTQWLPFVKAFYLPAGRWCVRARATLYCDNSSKTIAKVFTVSVI"
FT   CDS_pept        999238..1001358
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2460"
FT                   /old_locus_tag="LmjF36_2460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2460"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2460:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H5"
FT                   /protein_id="CAJ09204.1"
FT                   /translation="MLQGILGSVPSTGIREAENVLRQSWPSLLELKDEAQTRFCAEAES
FT                   FLKAQLTNRPVPSDTLAIFTTVYVTAVHAIHSGLAAPIRWTKAQDSPFRRPMPVERALP
FT                   SGMEAARIVASVCERLLLANAKVAGAYFSQLLRETAMGVPLLALVLRAYGEAAVEVLSA
FT                   HSEGPQFLQSCIHHLFLSTCKFTVAMSGDALTIAHPILLHVARVSGRTQDAMQLLCRPI
FT                   YSVSPMLTGIGLSDYVAYHAEAALLLAALEQYESAMYALVPVSRLSSTHGTREGRIGSR
FT                   GGAGEGDLPPWSNEVEDEEADVRDAIPRSGGCAADASRAPVTGADSALPAQRSVVLYPW
FT                   YRTECIGETRKYTGSTDAKDRTAESNAVVWRDVLVPSAIEREMDRRAVTWANRLGIVLL
FT                   AAAFGGGSPRGVMALTASVGRRVVDDEEASSIWTGMASAIAGHVCFPHPLFRLLAETTP
FT                   VSLRSFVHVVTTDKTTSARAYADFLVAIARRDTNNAHQCLGNPANVALFTADLTVDVVR
FT                   ATVLRELPRHILLDVARMYAHVPMQMLLDRSQPTRTAAKANGATPSNERAEDEERQRDA
FT                   ATVDSRHALVQLLVKMCATGDLASSHVCVTAAPAADAAAKEHATFYPVEEVARQLNSGT
FT                   ASFCGSTASVKWTLPSSAARLQRCARVVEFHIHQYPSANLDTSLVPMLAQLQELQRVVD
FT                   ADAEEICDMGIV"
FT   CDS_pept        1002889..1004226
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2470"
FT                   /old_locus_tag="LmjF36_2470"
FT                   /product="putative acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2470"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2470:mRNA"
FT                   /db_xref="GOA:Q4Q1H4"
FT                   /db_xref="GeneDB:LmjF.36.2470"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H4"
FT                   /protein_id="CAJ09205.1"
FT                   /translation="MNVARLVSAFGLHSGRRNKPSTAPETSYPVHPPVNINWTQQSLDS
FT                   NITKAERKEILKSKLVLTKLVVLNRHGHRAPNAPFWKMCPNDINSKKRYDVSAEDLTGL
FT                   GMEEEYNFGQYVRNTYHAFLGDKFNRMLHYFRAVGEPRILQSAMAMAQGIFPDGFGPGG
FT                   YLPSRPQFVPIFSDMDTHEYLLDDVPCFRRAENDSHRWIDKRYQNFIDDPNTGRVLKMI
FT                   KEVCGEYIGAAEGYAYIKTVADGLTFNSDIGLKVAKGRLTPEMLFSIRNVSLQLLMQRL
FT                   YGTDEQQTYMAVDLPRNILQTLNHTHVGDTPEQLNDFTDTRQESTFYFMHREALYAFAQ
FT                   FFGFQYNVAGLPPGELPVASSIIMEKLVPHRDQYSHNASHIYVHITLWTPYNGIYTIPI
FT                   STCRIPELCELKELQYIHDTRVNRTGTWEQLCNYTPQEIDHTTDIR"
FT   CDS_pept        1006411..1007190
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2480"
FT                   /old_locus_tag="LmjF36_2480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2480"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2480:mRNA"
FT                   /db_xref="GOA:Q4Q1H3"
FT                   /db_xref="GeneDB:LmjF.36.2480"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H3"
FT                   /protein_id="CAJ09206.1"
FT                   /translation="MDPSKRICLKNLPEGCTKREIAELVRNRTGTPIHSIDLGLGADGK
FT                   TRRYAHFSCEGAKHVLEVLSAGVTLRDSTIYAHPAKSHYSFRYAEARRKREREEAEEKA
FT                   QLEAFWAAARQRFLDRTNGGELPRNKIPKDFYAAKRKYARIAAEIAQVSRNAHAAAGGD
FT                   AAYAEHPRGAAHAAPFFSGADCGTNSAPRATSKNHATSGGGDANAAKKCASTLTAAKSK
FT                   ALAAVPPPPPPPEPTKEERKLSGLQAKLAALKEKLKK"
FT   CDS_pept        1009006..1010487
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2490"
FT                   /old_locus_tag="LmjF36_2490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2490"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2490:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2490"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H2"
FT                   /protein_id="CAJ09207.1"
FT                   /translation="MPVATMLTKDADCEKSQQQKLEEDIKSPCTPSFHWVSDEDPKSDR
FT                   ATNHGCAKPLDWSPQTPETPPMSVAELRVTTVADTSETETTSESATHGNELRANEGESS
FT                   ASGTLEKPAGGVAAAGGAAPAAVPQKTEERGSSVPLKHKRSYGASDAVSSSSCHVDALG
FT                   DLAGSVRQHHPTSTHTLDTSSSNGVGDAAKHAVAAGHVDESLPPPLSGVFFPFTACDAV
FT                   TTASLVTLISSYCDVLTLVQLMRVNRSAHLLATSDAVWKPLLVSMNLPPLLAAYERDND
FT                   YYDFFVKDIITTRALHGHYTFQAANAASGSRESVSTTSGSRSAVMNRNYVSRDEDSLQD
FT                   DIFNIASLQLLISAASLGQSNHLIGRVQLLITYKNESMEVLQGSCRFSVHRRCFSLCCS
FT                   AFGTVKRGPVFTVAVATVTKPWANEGFQHFREHKNGIRLVMAPVLWEGPSPGSQITEND
FT                   ILVVSRPKPVPSLITSTTGSAAANSSLGAPTASRG"
FT   CDS_pept        1011834..1013858
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2500"
FT                   /old_locus_tag="LmjF36_2500"
FT                   /product="chromatin assembly factor 1 subunit b-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2500"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2500:mRNA"
FT                   /db_xref="GOA:Q4Q1H1"
FT                   /db_xref="GeneDB:LmjF.36.2500"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H1"
FT                   /protein_id="CAJ09208.1"
FT                   /translation="MGSHNTEKEEARTGAHVEGAGLDGEACCAPHQPLRVRTIEILWHF
FT                   NERNEEAELLGLQSSVTEGITSVDYNPRCHRIVTTGGDGNIRLWEVRVKAVDAWLENTA
FT                   NDMLACCRHLCRMHTSWMPLTARWSPQGEMIASAHCDGKVCLWWRDPAGGSAAAAEASD
FT                   EGSCCSGLQGASGDSDGDVEEWKAYRHLTGHISDIYDICFSADSRYLLSGAGDGSIVIH
FT                   DLQGSTMPVLQLTNLHTKFCRGVAWDPWTRFLHTFGCGPSLLCFTHVPKSEGHHRRMHL
FT                   AGQRKCQGDYIGESCALSYRRLCWSPDGLLLAVPYGKVTRAGQQQAPSTANLLALIEAK
FT                   EKAEATLQATKDHPQDTSSPTHRTEAARGKNLHDAPVTTIGDAGDDALDDMLHCVYVYT
FT                   RGAPDKIACRLGVRGLSEVRGVLWAPCFFEPLHADEVLEGCSQQPTALSTAATHGAAAE
FT                   ATTTLSSALPHSASAATAEALPSQLAALEAARQRRGAWGPAEYFMALAVWTSDAVIVYT
FT                   TDSSSRHSDFTDLHMRSITDVAWSHDASHLYTASLDGYISVIAFGDSLTAAHRLPYFSA
FT                   SPAVRSLCGLLERIERVGVSVEAGRSTGAFSAGAARGCRKAGGDASASAAAAAVAKSSV
FT                   AVVRKKRKVEKTSGGAAAPSVMAAKEVDMQQLEALISDI"
FT   CDS_pept        1014555..1017257
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2510"
FT                   /old_locus_tag="LmjF36_2510"
FT                   /product="putative nucleoporin interacting component
FT                   (NUP93)"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2510"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2510:mRNA"
FT                   /db_xref="GOA:Q4Q1H0"
FT                   /db_xref="GeneDB:LmjF.36.2510"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1H0"
FT                   /protein_id="CAJ09209.1"
FT                   /translation="MFSSTSDLAPRRLGSAGPGGDDASALRVMPSAGDPTDEVRVSLAS
FT                   LTARAQRLVSERGAEQLLRNGFGLFEASRKAAEEARHQANKCQSTSEGYAPATHASVEL
FT                   FMTQHLGFDAQAQQRLLRQLQHRHAQLGVDLGPIDTLPGAEASGFTGIADVDAVVAELK
FT                   NDILLDVQHAVHQRQTSIVRDQVDTLFKAAWHPFYVRVADDYEALSMGANELAAGKAGA
FT                   SGRLSSTGTAAPSANAFGGVGSGASSSLVDILNSGSSLATELNRRVAAFAAIVEEYAPA
FT                   QWITHFTAYVTETSLDGANDLTVLWASIVQIIEPMQRRGSEADILSYVASSRRVMERKS
FT                   LSRLLERVLRMDPIRFEEVENMSASHLMDVIARSCGATNHWMHAFVAMRVGRYDVAQLV
FT                   MDAIGIQSVRDAMAKMAATPPAERNAMPPASDLQPVYAEAKTKEDPYRQAVLMVLLAGR
FT                   TGESPAAVLRTILSLAQRVTDSLEDALWLRLSCIRGVDKSAQVTPVQSLRTLQRAVLDD
FT                   MQDLVCITQGNACRLASFLIHALLPSTGLRLLLENNITHVDGFHMALCFSAQSLLQGRL
FT                   HSALEAPIDIARHMNRYCSVVLLGVDRRIRATVFAGTAIFAYFHKSGLTEAFVECCLKD
FT                   TICARLLGSRNAVGGQDALLLRAGTGALSEELIKALMQVAEAASARSEVAKATHVLLAV
FT                   AFLASQLCRPELQQRALRRAVQMMSPALAQVLHLPSRSSVVSDVLSRAAQLQQAVNAVP
FT                   RHLSEEAVDAQDYQTFALLCRMADVYAFNVSGNASDAVDAFLQLPFVPPPNTAVTGGVD
FT                   AYVEAYCNAPGSVQLGASAVLRIAISAAGQLLQHYARNITGGGADVDEKRPRLLHRMQT
FT                   LLEWARQCCARTSVAYPAVAEEFERTYLC"
FT   CDS_pept        1018544..1019596
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2520"
FT                   /old_locus_tag="LmjF36_2520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2520"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2520:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G9"
FT                   /protein_id="CAJ09210.1"
FT                   /translation="MPRDTDRERLTAFAKDYAQLYARFANHFAIPERATIDDFAVLFDA
FT                   SHIEYLHYCGGTTLERPFFPVITSELLMLSSAYLSIPEAVAPRGVRTFGLLLSFFIYST
FT                   QPARQRPKVPASVATEGKSLPPVQSTASFVESALPRSGGPRASRIAMMADSLTSSSTQQ
FT                   PQSCSAEERTAATAPPSPPVPLSLRLPMQPVPVSVSCMRLLLSRLSIDAGSGVMSGQPS
FT                   AGVPPLRTAVAVAPASASPAQLSHTEAKVVLALRRATGWHIEPYLQQGKHISALLSAHQ
FT                   ACAVPLVQHVTPVPRSLFAATLTARSMLNASAAPEEVGGPDSLFRDPDFVRLRQGYEAA
FT                   RRRLLLGERR"
FT   CDS_pept        1020367..1022475
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2530"
FT                   /old_locus_tag="LmjF36_2530"
FT                   /product="putative DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2530"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2530:mRNA"
FT                   /db_xref="GOA:Q4Q1G8"
FT                   /db_xref="GeneDB:LmjF.36.2530"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G8"
FT                   /protein_id="CAJ09211.1"
FT                   /translation="MLGESVAPPLKAVLQDNSRNPSAWQPLRGASSAPSTDAGGEGRIA
FT                   DASAPAWSQHIQQVVRHAVLDPLRNAPSHIDGSASHDENRRESVAPPSQLDLPAQYKVI
FT                   VVDALGMPADLPRGAPQSFEDLLELSPSILRTQLQKLMERKRYRVLTPVQAAVIPLMLE
FT                   YRDVLCIAPTATGKTLCYVYATLMHLLLKDINDRPAAAAAAAGDEGGGVSLNRRQVETF
FT                   LQEKIDKGEVCPYCELNLSEVRVCPMTGFPHPSASELETDLALRSKERRAKRLEELQSS
FT                   VAEPRVLVLVPNGQLASQVSAVFRSLHCDYRIHCMVRASSAEEQRKYLQALEGGVDVLV
FT                   ASPETILPALYKHKLSLRRVQTVVMDEVDDIVSVNHFEPMKIILGALPKGVQRPQRLLL
FT                   GASLPPVAYEMIKTKMLLPSHRFVLVDLKTPAELSRAAPSARASSLSSSSPDKPNAGDA
FT                   GDPPVAALSATVTGGFLTARTNLCHLVFMVGRAEKVQKLAWLYETGKLNPDQRTLIFCN
FT                   SRHNVAYVCDKMKELVSQVNFTTLTSHASSSAREGVLKMFRTGVSTSLICTDLLSRGID
FT                   FQGVVYVVHYDMPTDMETWMHRCGRCGRGGSLQGRGYIYTFFQPENIKLAKPLVGYLRQ
FT                   HQQLVPPRLREYAKQSFIDVFNNSLFHHPTRPHRKDDPQNSTPVLGRGTRRFPDYKQGT
FT                   IHKHFRPH"
FT   CDS_pept        1023294..1024502
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2540"
FT                   /old_locus_tag="LmjF36_2540"
FT                   /product="putative C-4 sterol methyl oxidase"
FT                   /EC_number="1.14.13.72"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2540"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2540:mRNA"
FT                   /db_xref="GOA:Q4Q1G7"
FT                   /db_xref="GeneDB:LmjF.36.2540"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G7"
FT                   /protein_id="CAJ09212.1"
FT                   /translation="MVLAKKQMKIPPIHKLRPGWSAVALHTVIYLLRHDFFTAIVATSI
FT                   VQPLYHRLILQNTYLQRLSDPALFTLVFAVLCHCVPWAFFNGIFLFFDSIHPQYGIEGL
FT                   RNNALLAPLGRRMAAYKLPRKPQQLPSAALIFSTMLHTAINHYLIIPVVLYAYLVHTNS
FT                   CALRAPPPESAIVGFAPEDVVNYMSGSNLRQIPISLVTITSHFLIANVINEMGFYIVHS
FT                   MLHSSPTLYRVFHKKHHMYTGTISIAAEYATPLEGILANAIPTTAYFTFMFFHYTREEA
FT                   SKSSFVTSARAWPLFITWMWARLWETYEVHSGYCFSDTWLGKLGLLHGHRARFHDFHHT
FT                   HNVCNYGSGLFMDALLNTMDPYLIYRYPDKHPHTTALKEEDLKEPRDLEVGSEAMDQVR
FT                   ACS"
FT   CDS_pept        1027170..1028291
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2550"
FT                   /old_locus_tag="LmjF36_2550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2550"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2550:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G6"
FT                   /protein_id="CAJ09213.1"
FT                   /translation="MSCEPNSPVVDTTAAAAAPKLMTLKEAIDRDGVPATSSSKQRRLM
FT                   DIHVTAYPGLVNQHMLPKHNTAVNDFSSIDPLQYRKAHTVRNNNAASYSEKEENVLDML
FT                   TTNQCTNRMTRLGMQLREERAKNPKGMPSISSLAPRGYRSRFLSPSFDERSTYRWDYCQ
FT                   WEPDGFHDTVRRELLAAYRDDWTEDEKADVDISMKIPYLTMAVSSDRLKDKATIYRKDF
FT                   MEDATQADYRSLSYKTNLEDLGTSYAYSAYSIDDPRRKVLFDASVAALKTPHSVLEKTY
FT                   SPRNSFLEKSLSTKQQSSAREELDRLRTMRREALHLSAAKRSAAESTDDGTTTKTVVIP
FT                   GIKGSGYRRVPKGNDSYVCLSRDHFCYQQVDNF"
FT   CDS_pept        1029410..1032190
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2560"
FT                   /old_locus_tag="LmjF36_2560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2560"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2560:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2560"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G5"
FT                   /protein_id="CAJ09214.1"
FT                   /translation="MSSAEMLLDATSLTPSLSQLLAVDSVSSVLLYLVQDAIVDDPDAR
FT                   LQALSEVLAHVSTSPKSDSAVSANGLGADGTHPSSATYTRVHGARWKWADVVMRGVTDP
FT                   WSRIRSLAAPVMADLLDAEVELVLQRHDSSSSTHPRSSDSTPRSSSVARTTPRSAKKDW
FT                   KNELTATESSLPKSVSAPLEYVWHRWRGTSLWYEQDGIVHMLAKLYSRSGTPSGDALRT
FT                   DEAGLRCLLFNVIFPALRNPQLPVRESAALLLGILADRRSSTSLSPAITSFVVDHVCRT
FT                   IVRVPTPTRRHSLETLVSVEDTRVLEGNLLALNELVDADVIRVEDADVMPLLLRLSNYP
FT                   ASSVRQYVAQILRPPSLYVFTYLMQRLCEHQNCMLQHAEGNGDSSSSVPGGGENDDSDE
FT                   LSWQRLETLMMALQQHLLYLHTTSATMQDLFHVSSDTKGILTPVVFETSLSVVFQATHS
FT                   PRFEVARMGLQLFPLLLQLSLRFCPPVALPRVCEACCGSDGCVQAELNRIAACGAFETL
FT                   AKAQTYVATFVVPVMWWFLTIRRLVAEVREKMTPSPTTGAPGETRAQVEDLVRPYATLE
FT                   QILFASQAHLSGKVSSSAALPRHTATCALLPLVTYFATVMGPEEWHLCVDELLAPSWWA
FT                   ELLADPARQEQARVGPDFVRAVHRRGTSNEVQRVVELVPTLTSALADAPTHQQCLLVAM
FT                   IRVAVVAHTARTVAVEEHALCFLYHEAYAAPALVEGGDAVPLGHVWLKHFMPTQEAIPT
FT                   TALWGESVQSRGGSIVFVESNSTVFEAIEKRCYQELYQSPQTEPVVLRELRSLMMSMLH
FT                   PSMSMPSGTHVYWYAAALAAVFGRLEKVCLQWRETDTAATAAATAVVSGCEDDNECWDD
FT                   DEDGAAQGIYAAEEVRNARAVVLVLRERAAASMEARDMAAAEDRFRPEFAVLAAL"
FT   tRNA            1032512..1032582
FT                   /locus_tag="LMJF_36_TRNAGLY_01"
FT                   /product="tRNA-Gly"
FT   tRNA            complement(1033226..1033297)
FT                   /locus_tag="LMJF_36_TRNATHR_03"
FT                   /product="tRNA-Thr"
FT   tRNA            complement(1033360..1033430)
FT                   /locus_tag="LMJF_36_TRNAGLY_02"
FT                   /product="tRNA-Gly"
FT   tRNA            1033504..1033575
FT                   /locus_tag="LMJF_36_TRNAPRO_01"
FT                   /product="tRNA-Pro"
FT   ncRNA           1033771..1033886
FT                   /locus_tag="LMJF_36_snRNA_01"
FT                   /product="small nuclear RNA, U4 snRNA"
FT                   /ncRNA_class="snRNA"
FT   CDS_pept        complement(1035960..1037504)
FT                   /transl_table=1
FT                   /gene="MBAP"
FT                   /locus_tag="LMJF_36_2570"
FT                   /old_locus_tag="LmjF36_2570"
FT                   /product="membrane-bound acid phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2570"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2570:mRNA"
FT                   /db_xref="GOA:Q4Q1G4"
FT                   /db_xref="GeneDB:LmjF.36.2570"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G4"
FT                   /protein_id="CAJ09215.1"
FT                   /translation="MRRGIAFLYPCAVVVAVVVSAAVVLAAPMYKVELVQVVHRHGARS
FT                   PLVDDNHTLICGTEFPCGFLNYEGQAMLVNLGEYLRHRYTEDRSVVSTPYFPYSWYNLS
FT                   ISYTRSTDVLRTLQSANGLLRGLFPNNSDFFPAIHTVGSEGDVLLHSSMVPMIRARFNY
FT                   AKQERRAACDQVLDRLMSFDQLQAVAAEVHSQGFCANYTLRSRCAERLCDIGRAYESTG
FT                   RLGSLPLLNRHLEDVCAVTAMSSHFCFAYNASNPVHQKQGAPFYHLAKLLVSNMLAHQQ
FT                   RETAPPYKLYEYSAHDTTISPLAVSFGESSMEAMLPPFGTAFIMELLSLTDAPAASSRF
FT                   YVRLLRGHSGAKPESNFTFALSHFDMRCRDATGNTYIATDNICPFTDFERFIDSTAPTS
FT                   PMGTCYLDPGLLLRMDCPIDTSGDNRSLSEDCLFYRKHCSNYSCGTGYYLDAIDYNCHR
FT                   IPANNSTTVSSPMSSGGIAALSIVLFIIGGVASIGGMEVWKRYKKFKGQQSEVLIV"
FT   CDS_pept        complement(1040351..1043326)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2580"
FT                   /old_locus_tag="LmjF36_2580"
FT                   /product="related to multifunctional cyclin-dependent
FT                   kinase pho85-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2580"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2580:mRNA"
FT                   /db_xref="GOA:Q4Q1G3"
FT                   /db_xref="GeneDB:LmjF.36.2580"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR033506"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G3"
FT                   /protein_id="CAJ09216.1"
FT                   /translation="MSLMNVCVYGLSSQMLEAFFVRECARSVQPLVASASSELRFGLVG
FT                   AGESMGVWGLKWPVALECCQCQRTPCVRVPYLSPLPHLCEDGQESSVEHYVAQVRLTSQ
FT                   EIDGLRNQQSVAEPLSMLCRLVILEDAFFRVPRTPESNICATPGTVIAGVDQRYSQPSS
FT                   LCITPFEHEKDAFTEGSGEALQWLAVLDVCRRHDASVTVDGNPLGRSRRGDAATASVCF
FT                   GSTGEQFAFLYNLPALPPRPIPPVPVTVSSGMAFLASEADADTSVCSASDSIPPFCECG
FT                   PDGGECATVGNPGPLLSLTFYANDPTQPFDQAAWQSELTWHQSEVMRRRMRETPDGVLP
FT                   TTVCQVTDVRPIPVEGSCWCHSKLPIPALLEQQLNEMRMRRSSAAAARNGGRDGYRASI
FT                   PAMSSTSSVCTMNSSHSGRHHTHVESSRRSARGGATQPSAGFLAKGWCVRPLQTIKPVL
FT                   PLTGNVDSTGRAPLVTARTQHVWTCLLNLHELDDFAIEVTVKVPYIADGTELSLQGNTV
FT                   LFSGMLRSSTSGTVLLPVYCPAPEGAPAGVTSLWMKLYVQYLLVFPLEGCGQHGPLEIV
FT                   RSSETFAWLTVPTLIGHRGLGKTYARSPSTSRGAPFVIKCSENTIPSFQAAHARKCEMI
FT                   EFDVMLSKDRVPVVIHDPLIELMALKREGVRACPGKAEYTPVRAEVHKLNYTRLRDLHV
FT                   QCCKSVDRVFPTKDLLIHHWDSLLSWARKCQPKVMRGSSSSSQNDMCGGSSARTVESSL
FT                   MGVEDFPNGVPSLREVLEQTPPSLHFNIEVKYPFQPLIDSNLFLQSDAFEVNGFVDAIL
FT                   RVVFEFSDNGRKITFSSFDPNVCLALALKQSRYDVLFLSDTKEMRDLKDYRSFYVEGAI
FT                   QFASAQHLAGVSVNAGTLLSPEDEAVLPNIPEEPLHGSAERGPVTAELFHADDPQHAPP
FT                   TVPSSFGAYGRAMVAEMHHRRLKVWTWGDMNSYLYFAYAQAAKMRVDGVIGDRMPVFSS
FT                   TS"
FT   CDS_pept        complement(1046527..1048242)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2590"
FT                   /old_locus_tag="LmjF36_2590"
FT                   /product="putative membrane-bound acid phosphatase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2590"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2590:mRNA"
FT                   /db_xref="GOA:Q4Q1G2"
FT                   /db_xref="GeneDB:LmjF.36.2590"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G2"
FT                   /protein_id="CAJ09217.1"
FT                   /translation="MACFARLGWAAVLAAVLIACAISIAHAQSTIARDGAADAKDIMKV
FT                   LQVNVLHRHGARSGLPRENTTEICTESPCGYLSWAGIEMLLKVGSFLRTRYNTDPSVVS
FT                   SPMFESPNYDLDVAYSRSTDVLRTLQSAEAFLRGFFPNMSSLYAAIHTMPESTDVLLNS
FT                   NTQPWLKFFYSNNKALLRAVCNPLTDELFPNWKDITKIGAEIYQEGYCSDYETRSDCVR
FT                   TLFDIAAAKKAIGELNQYPLLEANFEKLKRVTTALFDYEYHYNHSDPLMFRQGGRGQPF
FT                   VQQLVTNMEGVIEGSNKYKLMHYSAHDTSLGPVWGTLGDRTPDGMMPPFAQVLVAELLQ
FT                   NSPTGAHYVRILRGNPGQSPDTKFEFEWDSKWEMQCIDALGTAYKAEGNICPFADFKRF
FT                   VKWSEPADARGYCYLDQVSIDIAGCPSEPVAYGTPPTALVSSTCQFYRSACPQFACGIG
FT                   ETLNSVSMQCVCSKDSCLGGKTNEESSGDAAVDTDKKPTLRESNGLSAGAVAGVSLATF
FT                   CAGAIIAVAATAAICVCKRRSQYQQHVRMSSTVEEGNQLNDEREGAAKDFKEGI"
FT   CDS_pept        complement(1049558..1051720)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2600"
FT                   /old_locus_tag="LmjF36_2600"
FT                   /product="cyclin-e binding protein 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2600"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2600:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2600"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G1"
FT                   /protein_id="CAJ09218.1"
FT                   /translation="MFAVVPTAAAAPTEAALYSLADSAKSVADALRPFLDASPSPTASL
FT                   MPLYTIEKVVSCKAVYSALLRSDGVLLLLSHPAADGAASSAHVSVLESGGEAVVDVAAG
FT                   ESHIVYCTVSGSVYSCGYDNTYGQLGDGSVWSSNDAADGLADEQNVGGVREPVLSAPRR
FT                   IAGFGEGALTDGAQREHLSSEDTGTPLSSLKDYRVAIDLAPLPSSLASCTRSPTAAAKS
FT                   TSTGDSAASWRHVPPPADRHIKQVACGAHHTLMLTQSGRCVYACGTGAHGQLGGSRPVL
FT                   VQSTFRAIKLLFGIDMAQVAAGDAHSFVLLRNGLLYAFGDNTCGQLGLGHTKRVSHPTT
FT                   VPLPQKEEYKAPIALDHAAATTKGHRQLDAKAYATLRAPYASTESTYYPLRVPRLQDNG
FT                   KPHAITGDDDRDSGAAFTAATKYGAHSHELEASNSSVRVVRVYCCVSWTLLETTNPGVW
FT                   LSCGVPLTRGVNRADVATTAARIDGCGVLGRPLLRNKAEAYVFQPVNWAATLFSTRQNV
FT                   DAATDALAAPLAWVGNEQQVFSADPSHGAGEGTSDAPQLPGVQIHHRTPCSISCEGDSS
FT                   SCTPVVTTAPAAGHCSTADSRISSDAVLRFSHANKGIEKAILRVRDTLVSAYPTSLLVA
FT                   FSSANAGGVGCDGVVTSMLIQSGSPAVVALEVRPDSSSGVHEVRGSPTHASMDGPLSAE
FT                   SSGTTVLQVNSTHGAVIPLPSYVLVM"
FT   CDS_pept        complement(1053250..1054863)
FT                   /transl_table=1
FT                   /gene="FPGS"
FT                   /locus_tag="LMJF_36_2610"
FT                   /old_locus_tag="LmjF36_2610"
FT                   /product="folylpolyglutamate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2610"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2610:mRNA"
FT                   /db_xref="GOA:Q4Q1G0"
FT                   /db_xref="GeneDB:LmjF.36.2610"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR023600"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1G0"
FT                   /protein_id="CAJ09219.1"
FT                   /translation="MSVSTLHPGVLAAGSAGRASPPPPPLQRAQSRVVVHNLGEDGCAG
FT                   EGATSAAAGVSKRRHRSFKDAMEVVERMTGRRPNRCPDGFETTKRFIDRLGFAPILERI
FT                   RFVHVAGTKGKGTTSAYTAALLQAYGFKVGLFTSPHLTDLRERTVVDGRLLDENAYAQY
FT                   FFDFLDKYEALQYSDSQLDRDIASPSRANFFRFIFLLSLYIFEQEGVGVAVMEVGIGGR
FT                   IDSTNTIPSEVSIITSLGYDHMDILGNTIQEIASEKAGIMKPGVVCFAAPQTDHPETRS
FT                   VLEKHARKVGAPLVLLDQNVLPIRSWPKLAIGGAHAIEDSKLALMAARRVASIPPILPL
FT                   DEVEKSVLQSMTYAGRSQIAAVDGGTNITFYLDGAHTVESISSATQWFLDVSATNTRDP
FT                   APRRVLVFYTSRDPKRVLKAFMPYVPHFCKVVIAQVANPRMTSRSADPGDVEGKMSELR
FT                   ERMVTTTEHWRNMYREVTCLPCARPFSALEDILDLVVPAASDNEDASKPAQVFVCGSFF
FT                   LVGDIIKLLKVYEAGGRRPE"
FT   CDS_pept        complement(1058459..1063636)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2620"
FT                   /old_locus_tag="LmjF36_2620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2620"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2620:mRNA"
FT                   /db_xref="GOA:Q4Q1F9"
FT                   /db_xref="GeneDB:LmjF.36.2620"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR033315"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F9"
FT                   /protein_id="CAJ09220.1"
FT                   /translation="MSADADRSPTDPFLNPRRSTGASRSRADNDGAMVVEVVHDGQTTP
FT                   SSSAAPAAPFATRGRPSATVARGESPKESMAHLASNAATSTSAAAMMPHSRKRERPAVA
FT                   LASAGSPTSTTAAPPLVQKRRIARQQKSGATPSLSRRAGSAARTIVDRGQHSAKDRCDE
FT                   DALAEGAGGECGSDHAEGYASDDDEEGDAEERALVSASIALMAGQGALTAPSAASATPH
FT                   SWLVTDAFHVCLWYVLRYAGRALSVEDLWACRALLSLTAVDATEEEDGGERATAPFAAE
FT                   QARSANMRFDDWAWSGSEESELLLRLLLRHAHSFTARHLELRYGDWLHVQLALNALTQR
FT                   RFLWWATKQASLDSAGGGAEAVCLHGAEEDAATDLTETPLIPADELACTEMAPSPLVEH
FT                   YDGARVARLLLSCCDEDWPQHRHATAVSKSASTFSSVETVIRVAQAVRATELRTFLTTL
FT                   RHCSKARALMDERARGGDGCITTRAIAPTTTSTLGTSGNVLCKDGSVGGGIMAEPTPVL
FT                   RPKSGDWTDDVACVRPGQISHNSLYDVIPGRKRDMIRYLAERRYSVWVPSSTVNSSPAA
FT                   SATTDAATTDTMMPSHGPPPTEPHALSSVPLTTRPSPRGAVRCTSVFASAPDRSPFRRC
FT                   FPTVSLEADAVAQCWDRIIGSVYVPHSGLRQHLTWITELFHVLTSNNGAGMVSGQGAKA
FT                   VAATMTVATPPTLLMVRPQLLLLLQTLGAARHQARPSLTEPSPSTAAHPDPKAFKESVP
FT                   HALLPQWCSPPPVVKATKVALPRVCGQLHRDISSNGRAANKTESQPRPDASAKLNDSHS
FT                   SLMDTIVHTSRSFQDFGAAEDGTVTQVWPTPPHVCLFSSPVTLQEYRRALSTQRELYCV
FT                   TEGAVTVAQRHRGKSSTFVSHMYDTVMAAVRAGVAAVKQHPHHARTAASASLASVKATH
FT                   LGSMHPPVPPVVSEAAPLSKHFTQSVTASLESLVYQQGCHAEHLLIFTPLYRWFACLEL
FT                   LFPLLQSARRYDDANACLHHLLYEPIFVLHHMPVSSARCPISPVTYAFRYKPHKRGKWL
FT                   ARLAQNLSHQKRYAEAFAVLEEAQAGYRELASHTADDARSVTNDKWLPCDVMSNSTAAA
FT                   LCDVLAGNHSPASESALPLKVQRRGRMLRVLWPAAASAKFATGDNNASPPAAEGLSPDS
FT                   LALLHAAWEYVRDRYYRRQDRLTLERLLAMTHRKVRQWTPLAAHLEFATRRFVDVAMRR
FT                   IGGVRDKLDRMLWREPSGQAPGCPSASAGGVAEAAKPTTPSGVLHPQRRPALPVELLVL
FT                   QHYLSRWNGTSRTTAADSNPAADPQHRRRKGTLTTNSANEQTEGRDNAGGAKLTSLWCG
FT                   VHCEGQWIACLARALLWDCYWAFPFVSSPLDSFPVSARDHESDQPLPPTSPTHEVLWLS
FT                   AFQDGPLDLTTPIQFLWRRRALIEARLAQLERCTREELIAYVGARIKVEGNTDDKALPS
FT                   KLKTQGRDAGVEAPRKEAHGVQRADEDKGYSRDEEQARRRRSRDEYGCGPHSHSYTAKV
FT                   EEEFRGSNGEDSVQIAPSLPATPLLSTGSETSLLVLGRVEQERNAEAQRVESVKDSADA
FT                   SLSPRAPTLAVPEAWKVPVRPLPLLDILRAIPLKPLWRLLRCLYLSPVTEGVPLAFSGF
FT                   PDLVFWLTGGSGGSECGNAAVQPSVGSDSAALRTSFCLMEVKGPSDFLSTKQIAVNDLL
FT                   HRCGFEVCVVRVDEVYDDGQRVSTKRIR"
FT   CDS_pept        complement(1064874..1075253)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2630"
FT                   /old_locus_tag="LmjF36_2630"
FT                   /product="putative protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2630"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2630:mRNA"
FT                   /db_xref="GOA:Q4Q1F8"
FT                   /db_xref="GeneDB:LmjF.36.2630"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F8"
FT                   /protein_id="CAJ09221.1"
FT                   /translation="MTLNQLKSWPSKYPTSALEDTAPVRLCANSPTTASASPATAPATS
FT                   KTPMSVLYSVLLRASVSRSAVAKNPAERSPHPHTVYGIDSTVREAVRAEVERLFPYRGA
FT                   FAESRGGADVDKATPAQRFFGSASTVEEGERSGCLSACVARVNVYRHISEPDTHNPRAP
FT                   EPSTTTAVAATDTPSSSAARETSTSVLQKLSGGPRVIIKSLQRKKTLAVMGATRVPAPS
FT                   KPESAEAPKKLFAPLLAENSIGVGGVIRDHKASSCTSPSAIADTSHCFTVVSATELPDM
FT                   QRHLERLFDDFAVAVEQCRAALDQQQLRSSSPAAWQTTRGTRGVASEEPSESLLGEEAS
FT                   ASQHPQLPHCTNSNHRPGNPTLLSTDVLPRHNSHHPISDLLSSECIPDEWRHDYDTGTT
FT                   TNGSRCTPSARSASGESLRMADGSAPETKPSLEAEDFSTGIFMIAHTIAEHLHAILHPT
FT                   TTLAALEEEAVAALRGQGHDHSSGGGGPTALNAVPTARRRIHTGAEGEDSKLTNPASFS
FT                   SLSPLPALRSNGLQSPSGGSSASLELRALRQLVHSLFWSRITAFLSSVSLKAPGKDCPM
FT                   WLSTAAVEQREACAYVQLPFWIWLYAACGLATDVIRAQQEAQRAFPIPGQVTEPRKTLT
FT                   SSSATASAPPPPSLSQLLPTVETLARQLQRRQYERVESTAGTLLTANTFLSFTGVRMTD
FT                   KAVMKRLFPLQSGAAASDALGFAILSPHSAQCITHEASVVTESSSESLTTGAFDSAAVP
FT                   TLINNTSSGRPISAEHTVSVLGGAGSNVIHRSSSSDGGAPVSSSRQGQVAISVALGDTG
FT                   NTAAYVAEEEAPQVYSGSYSGPSTVELYLQWLESADAARLAACSSQSEAERFPDRVDAE
FT                   ADAAGEVAAPSPTSRPYRPDTIGCMQPHVLSYAEDGQVSNGDGDIAKGNSSSREDRNSS
FT                   DSSFSYTTVQRPSEPFRVAAVMPAAGLAPCLGRVEKELHQARSAVQFARKLGTLYATQD
FT                   MNTLLQLLPAVAYEEPVSPNVNLVSTRADGGAVESFGGAFSPRSGTDSTGAPAAPATPA
FT                   EGVHSQYAWTGTPTTSSPMTGSVPPLVTPPQVAADRMPGNHALFFHRVKASATPPALFP
FT                   SVTSLSLEKRLLMERLDSCAAAIVSSSYQLFVDSARALEVSFSLAVVLLSHVMGEAVPK
FT                   GEAASAGQAAAVASGSDNSPSAISAKTGAATTTMVVLKRLPAKVAAAALSDKSKGRATA
FT                   KTAAASPPPRPLSMDLAKVFGFGRSHLRWQNLSAYVRETLISVALRALQRKDVAMTQEL
FT                   LQCITLDMAIAHHYDQVRRHHPVLKPARAKGVGDTRKVSGSTLKKGRCAFKAGGRKVTH
FT                   LSAPPHESSASFVNVWFSSFAHLADTTTHLLHGDHNAPSSLKGTVWHLAALAHYFLLTR
FT                   ARGYDMYGGQSHLCSTTLCGHGSGNSAGVGVRTSSATSSAALQSFITSQLVEPAGKVLG
FT                   VVVSFMESVCQALSAEIESGGAAERQFREGVMFVDNSSDDESLFMCRAADDSVRSGSAG
FT                   ESTSLYSDGGDGGYDMAANRLETSGLQTCWMELAIHYFLEIVDVLLDAALHLPEKPLYL
FT                   YQLTVSACNPGSPSIDFADTLSAAVLAGGAGSPLLWGLGDLSSSVAATAPQVAADSPLD
FT                   RVQEFLSMYTSMVLQSAVTHFTVESRHAHSQVATARETPLNTTSVADETSEDDWLRTFW
FT                   ERMLTSVAAPANPSALDEVKFTARQPLPSASTPTSSPAANPAVSLEAPASRSYTRRTMW
FT                   WPDVRFHRYSHLIRIVEHAQLVSLYLNSCAGNAPAQTAPLTSYLEVSRAPRDRAPLLQV
FT                   SAVTSLLNISTGPCAQLLSIPYACPPSAVDTRSSSLVSGSARTTSYERCYFHCTGSPAD
FT                   QSPPRFLAGAHRRVPADRAMREVCGGLWIRVELLRLLRLAAAPLDADTFMSFTKTATKV
FT                   ATQVRDRAMQSHYTAIASMKAGVESVLPKTYASTYVRLLFLRYVQAFYADVHALSVSRA
FT                   ATAPDHTTSERVDGTSNATPLTRSIDQRTALATHADLSTHGDVTPYRTLGSPQTRSPVS
FT                   KLQHLRQRLWTHYCHELLWALRELCCSCAEAHETAANLSVASVFGRLLQMISGRGELEG
FT                   DEVIDDYDDEPEDKFPDEPHLDLKDVGVSVIASDRALEPYSTAEGVRMEGFVDFEVSSL
FT                   DSSVTVVPGMSEGRRRPPGQPPNSGSSDDFESRLEPSWSARRSPVSKVSVEAEQQVMIG
FT                   ISDQTPVCDFKERRRLGSNDHSISGGTQAMVRGKTPLATSSTPVSTSPRSPVTAPPVVQ
FT                   RLSLTGLKPPLYFTSSGDTAAAQENDFYKEQSEQRQMAKEPMEHFLSTTGMSVVDTASH
FT                   LSQDDDGECDVKYEARPDALESTSEHTLLKSTSHEPRESYSTANASADSATRGDAPKPP
FT                   ALTIPKLFLGALSPPLYFTSTGDTAVFAERPMSPSLARPPAQVFSALNWPTAAAPAVVS
FT                   AAHVDPAVRGAPLKGAAEAANAPTLTPPPAPVLPTSSSTTVNGFVLPKLSFGSLGPPMY
FT                   FTSTGDTGSFVEAQNQKPHAVAGAAKSAQILSDTTRLQSGLTAQGTASGGAANTATATA
FT                   EAITASSCPTAATATAHFHGSHSSDESSLHPVFSFADFAPTGGKVSRSGNASDEGGSYA
FT                   GCVDEQYSERRAARRRRDSGLSLNSLTAPEGGPFSMLTGQRHCKRVPRTSRPVLTPIVA
FT                   PAVTVELILCICSIIIQQDSGMIQYAYTVSSLTQKRVLPGKSSSSQRRWHAGSGGAAGA
FT                   SGSAFTQRSDAAQTDRWRYTPQHSPSSFHVIQAMHNYLKDSRNSLVIDLLEEWVLDEYA
FT                   AMERVRMEQFESAYPSLRQQECSSQPPHPSCSHSESGGNTGNGVHHHSLHQPQAGGTGG
FT                   GRSGKPSAAVLAGRYVLLRLLLPRAITPLITQQNERRIGAGGYGTVTSGFVQKPGTGGD
FT                   TRLPPGWGQRGSRWRPATTRGSTAASGSGAGGGGTTPQSFHMGRSVAPTAERIAPGVLD
FT                   GLRVPWRTAVQRIAQAVCKCEVAIKHIPLNVQGSESGNLPLCHAEVLSMYRLRGHQHII
FT                   PLLSFDNTKDEYILVLPHYTQGSLRLWRQKHYSLGCAVLTLPPGIRDSCKSGPMPTAAP
FT                   VMTSSTPTPAAAPSTSLFATCARCLLQVLKGVAFMHDHHIRHGDIKCDNVLITATDASA
FT                   ERGEMDPPMLPSSVCLCDFGSCDTCDDDDIQSLKHDIMAGEARFLAGRWGVGRGTEAIQ
FT                   PPELMSAKRRYALFRRIVTALAPAAAATPATSSLFTLSERAERGSRASSFAGASAEDLP
FT                   LRSRGGELIESTGPQIMELLRRAELSVDIWACGCLLYEMLTGRMLFGEARLGRLLVLAA
FT                   VDDGEDQDPETAASKTSAAAGPLPGESRSLQKATVPTTPSVGADAGSIFTPSVSQKALD
FT                   DRERRDLEAAVGKRVVDFMSTLLDLDPLQRPSAHEALQYWKTIMVEAGLEI"
FT   ncRNA           complement(1077909..1078010)
FT                   /gene="LM36Cs2C1.3"
FT                   /locus_tag="LMJF_36_snoRNA0068"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1078049..1078120)
FT                   /gene="LM36Cs2H1.1"
FT                   /locus_tag="LMJF_36_snoRNA0082"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1078162..1078280)
FT                   /gene="LM36Cs2C3.1"
FT                   /locus_tag="LMJF_36_snoRNA0064"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1078352..1078447)
FT                   /gene="LM36Cs2C2.1"
FT                   /locus_tag="LMJF_36_snoRNA0080"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1078511..1078616)
FT                   /gene="LM36Cs2C1.1"
FT                   /locus_tag="LMJF_36_snoRNA0066"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1078893..1078994)
FT                   /gene="LM36Cs2C1.4"
FT                   /locus_tag="LMJF_36_snoRNA0069"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1079033..1079104)
FT                   /gene="LM36Cs2H1.2"
FT                   /locus_tag="LMJF_36_snoRNA0083"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1079146..1079264)
FT                   /gene="LM36Cs2C3.2"
FT                   /locus_tag="LMJF_36_snoRNA0065"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1079336..1079431)
FT                   /gene="LM36Cs2C2.2"
FT                   /locus_tag="LMJF_36_snoRNA0081"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1079495..1079600)
FT                   /gene="LM36Cs2C1.2"
FT                   /locus_tag="LMJF_36_snoRNA0067"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           complement(1079877..1079977)
FT                   /gene="LM36Cs2C1.5"
FT                   /locus_tag="LMJF_36_snoRNA0070"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   CDS_pept        complement(1080921..1082576)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2640"
FT                   /old_locus_tag="LmjF36_2640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2640"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2640:mRNA"
FT                   /db_xref="GOA:Q4Q1F7"
FT                   /db_xref="GeneDB:LmjF.36.2640"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F7"
FT                   /protein_id="CAJ09222.1"
FT                   /translation="MEHQYFFIEATWLEAAAAGICSRNGIILKDAIAKAEKGIPVQIKN
FT                   DSAPTMRSLIQTTHASLEQACERYLHQNARNLRLTRASKPTPAVEALNEAERASCRELV
FT                   VRIAITGALTQYQRCTRKCILQDSSSLSPSLSHPAVSASKTVQGNGVTDKQLERSFQTT
FT                   LLKGLLYAFESFQECHSMNRDHYPPRVDSNTPGTVGWDTLVLLYLVHRIPQVARHASGS
FT                   AIDDCIGQVIRTWRKLLVALQSVDAQEAPEHSRRRGALSLVNGLLIILFQRYNTHQCAV
FT                   LLGAVEHAETVAESSKEPARSILHPSRHMVSEVVTYHYYQGRMRLYERKLDEAHRILRI
FT                   AYTLLPPAGFGNEPQRLNKERVRFFLSVAGVANGRRIPDEILRADEDLLPRLFGSLTAA
FT                   IERGDPVCFSAALDSHASTFHRRGVYLILQQAKILCYLMVVARVHAAMAALSDVDNSRI
FT                   TIPTLLAAYTYITSEKPQSGKSSAESKKRSRDDEAVSPVSEARMAESVMDEDRMALWIA
FT                   KLIARGYVRGYYSHEHKTLVLSKKVPFPLLQEEV"
FT   CDS_pept        complement(1083310..1084332)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2650"
FT                   /old_locus_tag="LmjF36_2650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q4Q1F6"
FT                   /db_xref="GeneDB:LmjF.36.2650"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F6"
FT                   /protein_id="CAJ09223.1"
FT                   /translation="MSANCAGPASTPDAKKARVEADVITEADRVPAFPLPPTDAAAYER
FT                   EHVHNVYSAIADHFSSTRYKAWPQVGAFLEGLPPFSLVADVGCGNGKYFSAAQRLALTA
FT                   PSHPMTTSGASLEMKSRQQAEAQPSPPLVSFAPAHRYVLGLDYSEELLRSTQRQLVDPN
FT                   MHHAQRRRRLSGKRAKNEAEAVATPVSAEELPRTDTVRSDALRCPLRSGVFDAAISIAV
FT                   IHHYASRERRRLAVRELLRLARPHGGRVLIYVWAREQRGHTKRLVDPETGDGLVRWERN
FT                   QKYDGAQQVFRRYYHFFAEGELEQLCKDAASDDGTGSIPVAIRKSYYDKENWCVMLERC
FT                   "
FT   CDS_pept        complement(1088003..1089394)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2660"
FT                   /old_locus_tag="LmjF36_2660"
FT                   /product="putative dihydrolipoamide acetyltransferase
FT                   precursor"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2660"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2660:mRNA"
FT                   /db_xref="GOA:Q4Q1F5"
FT                   /db_xref="GeneDB:LmjF.36.2660"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F5"
FT                   /protein_id="CAJ09224.1"
FT                   /translation="MLRCRAVSKLATLAALRFLTITPIPMPALSPTMEKGKITEWCKQP
FT                   GDFIRPGDTFCNIETDKAVVSYDNATEEGFFARVITSPGEETVVGQTVCLIVDEKEGVH
FT                   SDEVKNWKPEAEEAPAAAAEEAPAAPAATTPVAAAPVAASGDRVKASPYARKMAAEKNV
FT                   SLRGIKGTGGGVGRITSKDVAAAVASGTASSAAEVAAPAKTAATAALAAPAKPAAAKGT
FT                   PPANPNFTDIPVTTMRSVIAKRLHQSKNLEIPHYYLFDDCRVDNMLALIKQLNAKGNGE
FT                   YKITVNDYIVKAVARANTLVPEVNSSWQGDFIRQYATVDVSVAVATPTGLITPIIRNAQ
FT                   AKGLVEISKETKALAKKARDGTLQPSEFQGGTCSVSNLGATGIPGFTAIINPPQAMILA
FT                   VGSAKPRAEIVKSEETGEFEMTGRVENVVSFSASFDHRIVDGALGAKWFQHFHDAMENP
FT                   LSLLL"
FT   CDS_pept        complement(1090331..1091776)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2670"
FT                   /old_locus_tag="LmjF36_2670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2670"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2670:mRNA"
FT                   /db_xref="GOA:Q4Q1F4"
FT                   /db_xref="GeneDB:LmjF.36.2670"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F4"
FT                   /protein_id="CAJ09225.1"
FT                   /translation="MTFEIVLLALRAAALRVALSKPEPFHSSPSIALVLFSLSSFLSMP
FT                   LPCACVRERGRAERCRARAQRRGGCRPITCAPPFSSILLALEADFYLSKAYGLDQRSYS
FT                   SVHFLCVFCVAMTVGAAALCEYYGYLPRLVRHTGLLPSTRTSVTSSMAATVLQSSLYEA
FT                   DPSPPVRSGEFELPSTYSLHKPLVYDIAALPPKPVSSLRLVIISDTHERHREMSVPNGD
FT                   VLVHCGDIQEGLNFVRDVKAMLIDFSAWFTDSALHPHPVKLIIAGNHDKAIAAMSTEDV
FT                   RRLFAPAVYLCEDSVVVEPAGVRFYGSPRSISNSRWSPNTAFQGKKAWKRFVFASARQD
FT                   DEAGAVSTASRCSSEQPLRSRLEGATPGGPVDVLVVHQSPDIPRAHHSVSEQPICAYAQ
FT                   QVAPRRVLLCGHLHGAHGMHRLPVPEHVRKSFRIATRGGGGQPEGVVRMDEIPHLPCIN
FT                   AAMMTGRFGQNVLLPPSVVDLEL"
FT   CDS_pept        complement(1092218..1095235)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2680"
FT                   /old_locus_tag="LmjF36_2680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2680"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2680:mRNA"
FT                   /db_xref="GOA:Q4Q1F3"
FT                   /db_xref="GeneDB:LmjF.36.2680"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040018"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F3"
FT                   /protein_id="CAJ09226.1"
FT                   /translation="MSLEDAINLLREVYASTNNDRRKSCTLQLLQWEKALRAADAVRIG
FT                   IELLKTSNEGVAVQAYGAVLLRHALHARVLQPTQLPLMDLLSWYCNEPTLGPLLRADLM
FT                   ELLIECVIYSDDAVIGQVLGSLCTGIESQLRRMLLLSEMTVALVDPDFDRVPRECIGKL
FT                   KRSVTKQGSQLLNAATMSLYTYYMTSGGEQSTALAPDLEPCVEAALKVIGALAPQLPFS
FT                   VWQEHNLAATMEVLLRWAPAQRPVLACATSLLRCYSAGDAHKAAILRVLLSIVLRKIPA
FT                   LVASGDIAALDEILNLALELPKDFVQLEGVLLVQSIMSVFSIPSILFGQEAVQLMERMG
FT                   EEAFRHVDTIEIYNGLRLLLPKNLCHPMHGTNPEGQELSREQFGFEQLFEEVFSDFRRG
FT                   ASKILTQLARMYPERTNQYLLSLLGDLPDPQGTPGDPRTRSRFVRQSSLTFVYWEATQF
FT                   MMEYLSAAFECSTVSVNACVSTLLAHEPSDAVLRPVYFNMISYFWKVRDGDVMNVWEGT
FT                   INILLNCINDESSRYTDDIDVSAARRRAHTLLVQMCVEHSRRFLPQMPSLIKQLEPTLM
FT                   RANGMERSLLYEALIALTAVLPAHESDAYLQTIVNPLVNMLATSPALKDQNAFNNIMCA
FT                   ATADDKDARGVLQGCLNTIAAVFRRCQMTPYVVEKATQLFPLVGQLLLSIHSMQPSDLP
FT                   PEYRSILEQEAGERDLFLPGKTRKSDAHVVNAVRGARATLMNIRIALYQVFGELSPILP
FT                   AERFGEVITALTTSARIPTHVTRSLTEKCLLPIGKEHPTLLIYIFQLLHRFFAQRKEQV
FT                   RQQRTAEANARNTRDDVVESKQWLYYAKDVTKFIRSHVLDSHLWKRDKTLFLATAEVAM
FT                   SIFESGADNRTAQSFLISIVNLTTDTAVLPEVEAALSEVRVVVYSRLVSYVTLTPDGEL
FT                   TPSERENVAYAISEPYVRLFPNLTPSLTMAGMSQEQQETLHAHLLIVGNFAGQRRKVKE
FT                   FLINIAKANAGVSGRV"
FT   CDS_pept        complement(1096072..1097040)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2685"
FT                   /old_locus_tag="LmjF36_2685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2685"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2685:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2685"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F2"
FT                   /protein_id="CAJ09227.1"
FT                   /translation="MRGTTSRLLFFCFLISHHLSTLPNTEAALLHERRDCAAMSRRVNT
FT                   EAVSQILEALVLLRSSRLAETSTAGSASSVSSGYSTLEPGSTSEAAVDCARRLLRDCVV
FT                   SAIEIEPTQPDPSSLLVAEADPSMAAKKSPFSLSSAAAWRPRREIGAVLEGRDLHRIDL
FT                   SGTRLSASFNRSDLSEAVLLGTYFAHCTFNLCDLRKANMAGAQFHSCTFLSTDASAAAA
FT                   RRAHFSHCMFHRADLSDWDAAGATFFQCSFTLSDLSRWSLDGQTTVVSPTDWGRCRRLD
FT                   WVMKPGSSVRECRVFGDANAANALSLAPAEKSSCHPSQRHH"
FT   CDS_pept        complement(1097624..1098643)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2690"
FT                   /old_locus_tag="LmjF36_2690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2690"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2690:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2690"
FT                   /db_xref="InterPro:IPR033351"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F1"
FT                   /protein_id="CAJ09228.1"
FT                   /translation="MPLVKAETDASFVAEVAESVGGACARMNDHISVMIEEYLRRRTQQ
FT                   VRDDVKQELDAVRVHLERKIADAEAAKAVEEERYHKKKVQVLQAAVELQKMHANLHLQR
FT                   LFHTWRRCADVRQERRRLAEEAHIHIGRLSLFHAYMQWRLFAAALRQKRLEAKEAHKRD
FT                   CREQELLGQIEGYQRQLEGERAKDASLNEKLKEAFVRGMCALNREAVHVLHGSEENQDA
FT                   DVEAIAEILSRESHSRHRSVTPGHMDSSTLSNVHGHGVCPVHHIDAKGSFYHPCFSPGY
FT                   CEYDRHSGSRAPVSSAVPPSASGPFVVSADPKSARSIDSSPPVPFRHLSKSSTTRWRM"
FT   CDS_pept        complement(1099569..1103885)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2700"
FT                   /old_locus_tag="LmjF36_2700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2700"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2700:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2700"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1F0"
FT                   /protein_id="CAJ09229.1"
FT                   /translation="MMSKARSGRSARCFSLSCKRCAGYPTQWSAVRHQSQSSLGRSRDR
FT                   QRGQPNADPNTGSQISVVESPDLTPHIQFGLNNLEHVKLPDMSDEARRRSDIDKEREMR
FT                   AKFGEYGPGERLTKSSPQMRRDMLEEQQDVDGLPWEVRWRKSLIPTSEEVIQDIRDRFD
FT                   LFVQDPIEREQEWYLHWKDRSFKIQKDRMIWPQGYTDYLDHYDENGRRRVLPTDQRWSD
FT                   SSWKHLADTRYKDRMWLIEGEERKAVHQSLQTDRALLNEEEQRQSEMGDVYHGILSGVV
FT                   DLDPDQTYQALSGTADPLEVAKTKIKLQAYGAHQALTAGKSELNPAQIDPISGFPKTDM
FT                   EPLPTGITVEQGAAIATQANIQYEMLEQGAEAARLAGHDPAVAMMKAHHNTSKQYGDRP
FT                   MLRAQVEANIQKIKELEAERQPLEAGKTADGEMVEKIESPLLEETAGGQPAVSQIHIKA
FT                   SVTTNESGSGAVGASTPGGFIHVAERPKNVEPDVPNELFRVPQSRELNEMPKWYRETLV
FT                   ETEPMIRQYGMVHDPLEEKQPEKEYYVPPPLRDDERVTLDDAPSGASAFDEVKMHKLKS
FT                   LPELVVGYKPLPLFREVSKNDSLEAAAEAQEKEAKEKKLVGKDGKPMKRSERQRLERQE
FT                   RLRKSKLSYDSDILLPNLPWETDSIVDPYRGVEAVDAVEFNKEDLEKTWRAYRDAFQQA
FT                   LTEFGNLTQVTSEDKCEKMLYDTMERFREGRVGDHPEVPKEQDEVFRLVFEAHTKHFLA
FT                   DFYKFKGNRATEANAVKAEADEILRRASAKSKLLGRNFMNFVQEMTSLELETIRKNPVQ
FT                   RYAVMVRDRKYEAISQPFMKWIKNELGEFMITEFQSAEQLEAHKEFLHRHLNDAYIRCP
FT                   SRVEGISDASRDAAVGAFYQWCRGALAFYTGKKFHSMFLDFADSRFRSRAEELYEDSIE
FT                   LFSNYAKAGKDIVQIPVPDSDPPYEYDEKEFLDGENAVFAEISGHLDKAEALWHSGSSK
FT                   RWYPMTDETEYMWFNERRGRLTLATDISDRCLENVNKKTHPSIHPFPESARVFLEGAPL
FT                   TQETAEHLWLRYMGDLYWEHSEFMQRQGRFQTSRSYRDKCLNLYHLAVRTARERLPASW
FT                   KAPLLTEAKYMLRVYKPGDHVLQHLQDVETVVDKLFAQGEPRHWVEPFSELPYRLAVVH
FT                   ANLPAYGEAITKEVHRRLKWQPSNELLMKDMEQRARGGAVTPELVPYYNTLNAVAETVF
FT                   RRKILQWRSKEYEGSDPFLFWTHMYFAFRVHPKDRDEVQRMWDMYEPAYVYIYTQCALA
FT                   SRVRGHRLINDALRRLCQILLSGDRSQKLVLMEELTKVREKMAHLIDRRELDRTINALE
FT                   AHLENPAQQAYTYGTALLYKEAVLHEKITRNPLLRTQMAAKEYTELRKRQEELRVNGTT
FT                   LDPQEAAKMQEKEGGLDDAHLDAQPSLTTKEMFAEK"
FT   CDS_pept        complement(1104954..1106669)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2710"
FT                   /old_locus_tag="LmjF36_2710"
FT                   /product="metallo-peptidase, Clan MA(E), Family M41"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2710"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2710:mRNA"
FT                   /db_xref="GOA:Q4Q1E9"
FT                   /db_xref="GeneDB:LmjF.36.2710"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E9"
FT                   /protein_id="CAJ09230.1"
FT                   /translation="MSYGQPQQQPLPSDLGTKERPIVVVSAPQKASWATRFWMFLLFGI
FT                   ALSCFISLVEEFNDRFQEGQPANKSGFARSGISGLFGSVDVKPVNLDNLEVTFDSIRGC
FT                   DEAKKELEEIVEFLKDPEKFYNLGGRLPKGALLTGPPGCGKTMLAKAIAKEAGVSFFYA
FT                   TGSEFDEMFVGVGARRVRELFAAAKANSPALIFIDEVDALGGRRSRSDHSTSRMTLNQL
FT                   LAEMDGFDSDEAVIVLAATNTPETLDKALTRPGRLDTTITVDPPDMKGRAEVAQVYLDK
FT                   IKTDSTVNAMDIARGTTGFTGAELSNLVNLAAIRAAVLNKAKVTSEEIEYAKDRVMMGA
FT                   ESKKIVPEEERRVTAFHEGGHALSAILLKDEGADPVHKATIVPRGNGIMGLVQQQPDRD
FT                   KYSQSKRQCLARLKVCVAGRVGEEILLGPDDITTGAGSDFQQATNMARHMVRQFGFSDA
FT                   MGFVDYGTPDTAEGAYISDETKLKIEKEVHRLVEQAYIETKELLLSHRAELENIANNLL
FT                   KYETLSGKDLEKIIKGEAIPERPPRLSQAAESKAAPPRGGNSDQANGRRTVPIS"
FT   CDS_pept        complement(1107311..1110127)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2720"
FT                   /old_locus_tag="LmjF36_2720"
FT                   /product="transportin2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2720"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2720:mRNA"
FT                   /db_xref="GOA:Q4Q1E8"
FT                   /db_xref="GeneDB:LmjF.36.2720"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E8"
FT                   /protein_id="CAJ09231.1"
FT                   /translation="MYTPTQGDLVSVIQLLHNNGVEVSNSKAAYAQLKQYESNPAFCIL
FT                   LSTVFGADTNPVTDMVLPVSWAQYRQLAGIALKNNLASARHALGEGAVKEAARFALKSL
FT                   TNPPDTRIARTSAQVVVKVTALTSLEWWVGSGVGDLPSILLNDLLPGGGLKTLAALYCL
FT                   QYLVEDVSKQIGESSEHIILRVSQLAASQSAPMTIRKAAFRMCFNIYEQASLLDWNVDT
FT                   LSPLQMGLSKASHSLSSVCTSLLECSCGEDSAFVILVLRTCSFLLDYFDFFGQMSQNEM
FT                   QRYENWWITNSAQIICRSPNSISGKQELIAAAIDLIATTVDLYDRNGGETTVAFLVSGV
FT                   PQLIFSLAPALVRYALLSAEEVANIMDTDDYRVRDSTAVSFEVKGGTKDISEDDMLDDD
FT                   AAAMTLRSSALKLVDVLSMFSSDATYQAFIGPIQQLWSSSEWREREAGIVLVGTIANGC
FT                   AHELRAVLDSLVDQFLQFISNQSEHVCVVSIAMWSLSRISETVLNSSPRTMDTIIPLLA
FT                   SRLQSTSKRIQITSVSALNVIYGVLENYGSTAVVMPHLPLLLDSVCACLSVYSTTNLSL
FT                   LVDFLNKLISLLNDRATAERLSSVLQGERANRASLFEQSYTAMYIREEPNVLLDKDVFS
FT                   LDRAIIAFISVYPSNEMAVANLSTWNGVLADIKNRSVTDDADLVFNTLLICSAYTNTVS
FT                   TTILEEWLRSTSWALPVSAAHFLTTSRIHEVKVAGIKILCGLLRAVGSGALPTGLHDTL
FT                   MRWATSEVSEAEDPQFKEHLVRLIGQTTSCYPGQLSTVATEALKSANAALRSDVFGDSS
FT                   YYFSAMAFDLCGALGAVPNYAALFRIDTMSQLMAQAENTVDKSEATIYLFQALVQLPTD
FT                   AFSGVFSSAIKIVYSWQQAAVNYPGTKEAIQSFLFHAGKTCPGIFQSILEGLPAAFRNM
FT                   LVSFYQLQ"
FT   CDS_pept        complement(1116528..1116986)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2730"
FT                   /old_locus_tag="LmjF36_2730"
FT                   /product="putative D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2730"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2730:mRNA"
FT                   /db_xref="GOA:Q4Q1E7"
FT                   /db_xref="GeneDB:LmjF.36.2730"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4Q1E7"
FT                   /protein_id="CAJ09232.1"
FT                   /translation="MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDTEYI
FT                   LRKILGVRVWSNEDGSKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPEDAL
FT                   KVFNALRDKLRCEYAPHKIATGNFQHYMNIHLSNDGPVTLILDSKKRS"
FT   CDS_pept        complement(1117516..1120575)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2740"
FT                   /old_locus_tag="LmjF36_2740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2740"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2740:mRNA"
FT                   /db_xref="GOA:Q4Q1E6"
FT                   /db_xref="GeneDB:LmjF.36.2740"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E6"
FT                   /protein_id="CAJ09233.1"
FT                   /translation="MDASGIAASWTDLLAQSPSSPGDSSRVALSEAAALCLALEAPKCY
FT                   AVYRPSNSGSGIHRYTSPAPALATPQHFLQLLARLREALSTSAEAARIAEVLVDLLNKP
FT                   PHPHQPGPWDLTQNEVRAVKATAIQHVMDSMQGGGDALAWITRLLRLTDTCVGEGEVTE
FT                   SEVPLLSTALSERYGLHGGSPTHRVHCGDADGEWLLTCSPVVLAAIAAAMLRSTTKGMK
FT                   AHALELLEAAALTRLSWTSLSSGKAVAGSYYRSDMQRGAPKALFDETVAVRCAEAAAVQ
FT                   GDAETVTRLIFLLYRARGALGFATLAEHRQRRRSGRGGEGTWRRTSSGLLPRTSSWFSA
FT                   RWSCRDDGAMAKRPALVEDDAADMRFELAVVRLLKSAMQALLYHPQRMSDPVVCTVEEA
FT                   LSLWDGLRGAISWPGIAAIGAELLRYLADQHARLSVAADAGNGGAASDDVHVRRAALQV
FT                   YGHLCRAAPVRQRTAAQRDELNHFTSLMLRIFSAELAVIGSAGMLVPVAASITAAERIL
FT                   RLFANLSGPRAQEVALPYALAASLAIFAAAATQKGYSVPPSLLAPLAAYFSETQSLHYY
FT                   CVAAASAEVPAHVAVSGSLVLLHLLLWSSVPEGEWARGDGELWPLLQRMQKVNETGQGA
FT                   DTVAAAPATAAAYRVTAWLRVSGDQQRSLLWLLLLSAKQRDTSWCSAVVNVFSSPASST
FT                   VVNCAVSSVYAQLPQAELKSVVELLYACGNNDNPTQASQTLDRVVSASLQLPIRALTLQ
FT                   TLDAQLQKFSAGRQATSVLVLGAASIRALAERCATTLKKDADDELTVEGFLRVLQPLLV
FT                   GPTAALPLRFTVVVLTPASLVELQRMYTGADDAPRHASAFVRTMHDALVSRATPSAYQV
FT                   RAASSWPLLPSLALALRKQKELQSVDGLREATAAARHLEHTLPKESRPLVCLWVERETL
FT                   FDSPHALSAKAEVLRHYGVREVSTHRAHVEKAKRDIFSLVRSGAAGTVHPAGAQVAGEA
FT                   ALTEAKAARRTRHHSLLSAVSERSRRQRSA"
FT   CDS_pept        complement(1122609..1123085)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2750"
FT                   /old_locus_tag="LmjF36_2750"
FT                   /product="acetyltransferase-like protein"
FT                   /db_xref="GOA:Q53HX3"
FT                   /db_xref="GeneDB:LmjF.36.2750"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q53HX3"
FT                   /protein_id="CAJ09234.1"
FT                   /translation="MSAAGVTVRRAEREDTQRMYDLIMELAIYERAPECVVVSKAQMEE
FT                   EGFGERPLWSAFVAELQETNDVKPRVIGMALYYYRYSTWRGRMLYLEDFIVTESHRGIG
FT                   AGKMLFERVLQQAKEEGCHGMVWQALDWNAPAIEFYKKYDAEIDPGWVNCMLKF"
FT   CDS_pept        complement(1127356..1129179)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2760"
FT                   /old_locus_tag="LmjF36_2760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2760"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2760:mRNA"
FT                   /db_xref="GOA:Q4Q1E4"
FT                   /db_xref="GeneDB:LmjF.36.2760"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E4"
FT                   /protein_id="CAJ09235.1"
FT                   /translation="MFDSFKHTFSQTKYVAHREACGLHVIDEVKRFRALVCVLFCSICV
FT                   SLVFAFDLFSEEFQSRFHLSDGDLSTISTVGVVFCYFVIPYGVLYDHIGPLPLLVIAGV
FT                   MGFVGCLGLGLIFDGKIKGNTVTISIFYAFMNTCSGLFDAASIVTLVELFPRNRGPVIG
FT                   LAKVMTGLGSSVISSINRGFFSNNISGFIYLIMVLTVVVALMAMLLIALPPYFVNWWRA
FT                   RNKTEGQIAALTSLKDIYAKKFVPLRRIAYGYVIVACLVIFFATTAPILAYTKVSRGGK
FT                   AVVGGITVVLCMSFWVMALPIPWLGGVNEPAEQQSSTFDDTEGSKPNVLTSVEPLETSN
FT                   KPLSTSPLSDDDAARKQSLVSVEAVIEDGPQDPRYGGTIWETLMRPDIWLILIAFVCQS
FT                   VLGTIVTYNGSTIYVARTGRPRTAELGSLYTSLLGVGSAVGRTSMGLFEAYVQQQDPKN
FT                   RKMLVTIALPVAPIIATIAGILILVLPGDALLLPYILVYFEEGVFNGVRALIFPCIFAG
FT                   HHGILYNMSFFTNVIGVICFNRFLFGLTVDKEREKMGHTVEQGCTSHACVQTPIIVVTC
FT                   TAAFAVLLATAVHLRYARFVKQCRKALKAAS"
FT   CDS_pept        complement(1133012..1135252)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2770"
FT                   /old_locus_tag="LmjF36_2770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2770"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2770:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E3"
FT                   /protein_id="CAJ09237.1"
FT                   /translation="MSAGRASSQHRDRPQSSSRRRYYEDEAYMQPRDERTSHSTLHRRH
FT                   SSPQQKPHRHSSASKQRKGLRHISRELHQYLKDDYAPEDGVPPLRRESTQPPRRRSSPT
FT                   YHYNGDNSGGGAYHRRAVASTSPRRRSTPHRRRSSSRHTASVYPALRTAPVAVGDGKRA
FT                   SPRRSARTSTDGTPRRSRRQHEPSHAGYDSVARSPRQRHRHSSASPHRSHRSKESPTHP
FT                   ERRAPSSSGKSRHASTEQHVRSSQGSVRRHRHSHMTSSTAPAPATEAAHRHDALRYRSS
FT                   HQVEVAAKREATPHRSRRHSRAKVDGSAEKEARSPRRHTSAHRSRSSQPESRHHSKRRH
FT                   RHHRTPTPDSVDEGSRRPRHTSLFGPLAEDPYVAPPPLTGSTHIRSAANSHTTSRPRSG
FT                   SHIEVISVHSACRVSANGWSHSRSNTARSPRRPYDNGPPVVIPSPRGQQIMQRIDSTRH
FT                   WLQNMKEEVKKDREREPQHVQDVARERATRHSARKEYLDSTSRAGSASRHRTLSTGSRR
FT                   HTRGETRAAAQVTSRQYAGEAIPPTASSERSHRAPEQVSPPMPEKRHCSSQRHLGRPTA
FT                   PAAAPRAPTPDPDLFREPVDAVSSSREEGIECPILSFMSFLDGNTFDSTASLCQYNVNL
FT                   ADSLSDEHLEILRAAVFNHNEEAFAELLYGDDVEAEIDGAAAALGHSDDPTVQHELVVL
FT                   QQEAVRRFNDKCAKALKALLSAEGGLAEAVQVAASELEHQAYQADGSLVAVP"
FT   CDS_pept        complement(1136862..1138334)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2780"
FT                   /old_locus_tag="LmjF36_2780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2780"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2780:mRNA"
FT                   /db_xref="GOA:Q4Q1E2"
FT                   /db_xref="GeneDB:LmjF.36.2780"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E2"
FT                   /protein_id="CAJ09238.1"
FT                   /translation="MSTTPTSHGAPYHQQLQSHIEALLILFIRDFCAEGASPTRSGYRA
FT                   SHLQAIAQTFYVLQIVQCSTAARCAQETPYSLLQTGGGTGRLDVCTERDLYYRNRPLFA
FT                   PRGQRATHESIKRLCGWLEVVARVPPHQQRGEGPVLTSLFRSPRCLLSRPWKGTQGAAS
FT                   RTPLYTRESLGITAAGKSLLAGAITLELCDPVELIDVSAHGSVGITLTYSLAARMVGCR
FT                   ETGVWQAARNGISSSRPYKLVLIEKESVHHAVLQSMMKSGTPRTYSWILLCTKGYPCVA
FT                   AREWLRRVHALQPALQLYIMVDGDPHGLDIALTVMGLLSSKGYPSPIASSQPKPTLSSF
FT                   SSLSGTTPASAETAKVKELLPLRFLGVCPSLVWSCSIDSEAPLTAGFLGGLTSSQGIPL
FT                   TMHDVQVLKRITSIVQAALASTPEASDSATSLRECDTAIVRHTLQRVLKEAEWMQRARI
FT                   KCELQFACGPIGPLTFMEQHVQRCDAEVSEGC"
FT   CDS_pept        complement(1139047..1147140)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2790"
FT                   /old_locus_tag="LmjF36_2790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2790"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2790:mRNA"
FT                   /db_xref="GOA:Q4Q1E1"
FT                   /db_xref="GeneDB:LmjF.36.2790"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E1"
FT                   /protein_id="CAJ09239.1"
FT                   /translation="MTSIFVLIRPHAWSPAVVDRVRTCLANVGACVDAEDTVSASTLLS
FT                   TSTVERYFGSIHYWAASATDAVLRHPLSASDSVTGEEEQPAFCAAEEDLKSLFYEFYGE
FT                   LWDSALDDGRLRTAFDVMRADNVSAAELASRCTSAGDDAVLALPLGLTVTRILSSDERE
FT                   RAAPLHYVVNGAHPAVLEAFRRGSGDASGAAAPCWWCVASWPSQAALEVSQEVTERLMR
FT                   LPPILAEATSTPHGIDVFTGALEALACRVCWMNMPLHDDPFARLLVQRGLPLPWVAALL
FT                   RGPTLHEHGHFTDVFDMMAGKGEDDVAVTLMALYDALRYPDNAAEGRNAVNDAAALYDW
FT                   ENGSVDMTAASSGPLAEDPIPSRTYAVALVHPRLWSRKEIVHLLEEKLEQLEVCVEAVR
FT                   EVSAEELEAKIDLHHGDVARYALDQEALRRFAVDENKAVAAEATACFEKNCGVPWEVAM
FT                   QEGRIWSASLAEDLLGAELAAAVLKHCATSTHTTHQLSATLSITVLSRQELMTELNPAC
FT                   PVDAVSSASDSANLQGKRKEAVTPNRPYSLTSESYFVVNAAYAVYRRDVLETSISACAS
FT                   ERAGGLWQLSWRADAEQQSMAVRCAAISEALCTAASVDPVSIMDGRNETLGAEHAAPYG
FT                   AAVTEPVSAAYPLVQVSADCFSAMRARHLWWGIPYEDDVVSRDLVRSQGQSWVTLHASF
FT                   SASPTAESTAHEAVLALLPPVATTAEVIKLTLATLEESGVLVVEEADIFGYDAFDYVFS
FT                   GSTALAVARQLAQKTGTGLWAMMSDDMQVTLRAAAAALADETAQPFTPENLYGGAMVCD
FT                   ALHIPLGALETGWRRTEPLCVGDNCWLGYLATYEVWVVNGHVPLLEHRYHAETARVHLL
FT                   RIQWDASAVSWNEMREALVGQCSNCNEGETGICGNSAAGSLTRLLSRIADCSPANATRL
FT                   VGEPLHIFSPTAYHALVDVLRWPRIGSSGPLSSEVALEDWLVRQPSVQRLLHRGASMLT
FT                   VVVQHVRETLKTVLQPLLPSQDSSPATPCWTSRFAQSQRAVQLHHGFIWLHPSSTTPAV
FT                   RDAVPALLLAHRVRVRDSGAVPLQVALERELLDVLHDSFFKNAYVRSAAEVPVTNAEAQ
FT                   AFARHFNLGWMEAVQLGLVLNAKEAEQKYGTVHVMMWWEGLAPEHQVKLSDSLFVGYMT
FT                   EEGLYVMNAPYSYQRSRLHVGSHEVVWYAVEWNAADMSWADFLRDVIGAADPAAAAAGS
FT                   LRQHFGAHWTRYSLAGQPDEIECVMHAAKTPLAALAERCRWLAQSPRQDPYGCLLLQSG
FT                   VHPSLLSTLLTNPSVYSRDTGVITEAFHVLPQEDVHALVRQLRDAQCTRTVLMLQDRTR
FT                   LVPPATALATPPPPDAPHPRDAEGADEGTVDLTILAQLRAYRHVVLTGAVDPFLQCGFA
FT                   TAHRQNLPSPSSPFRCSAVLYLDPTCVPAAERMPSSYHTLRSLLEQQLRINGVRIVHER
FT                   VVQCASAAEASVLYRCHQHREYRYGVAIPAIESLTNSMQWQIRFKEHFGVSYRHASVAL
FT                   YNAAEMTRVMQVSEREVAALCRRSKSRHPHDTAVVGEGCVIQRLQPGKPFYVMNGDVME
FT                   AEKEFVAAQATVGVRVWMLAWDSARADMGYAKLQHLVAELQAPTGVLRQWWAPEGGEGD
FT                   LGRASGLSTRDHDSPFLHVSESAVAAVRQRQLWWRLPVWSDPTVATWVNGVAGNETARS
FT                   STDVSALSPRTVAWALQDPLISVAARDDDGPVYLWDTVIGMDARHACARIGCCWAAVVA
FT                   DERNDETTRDTAVLTLAPQVATNSAVYHLVRSVLLDNGLRIDAYGFIADHGEDIATLKR
FT                   TVQYLYPEDWSYAMEEPQEIQLNADEAERAARTFGTSWEALLHGGRLLPASRATKRLGG
FT                   MTAPQLQLFVKTAKNSLWVRPHLHVAELEEYGVYVINAHVPYLAHTIAGAITEYPLPYY
FT                   LVSWCPSLWSWKECLAQVFGCAEPTLAAPGSIRGRLYTSWSFLGLHAAPEMAEGGGGGV
FT                   CVSEGPLQSLLSRLHVQWPPLDYFDSDPIGSVVLRQPEPSGATALLRAWLRNPVVMCDG
FT                   IGTGVLSHLACWSTREALHLVETVTVTREKASASEALLLPSALDKARNEVHEAEARRAA
FT                   EAAWEAAFQKRYDLPLLPTFSAAAAAPPCVQTSDSTAESALLHRNVSTLLFFSHQLDTA
FT                   QRALLRQHLQQHSVAVMAAANYEEEEQECTAALLDRLYATEAFFADCPNVAAVLSESGE
FT                   VTVEDQARFSAVFGDEVPWPELLARSALSQEAEHDADTSLVCSASEDLHQRSHIYSAAD
FT                   AMKIWRLTPHELWAEMRQGVSMRLSEGLEVTRLCRMTPGCASDTNERAVATDPGAPWKG
FT                   HYVVNALYAAVRDALQAPAATRDTSSASHAQAPPSLTKWNVTWDAQTLSWHDFCQCVIG
FT                   YADCAQAASSSFNALLAESIVDARASHEENKDEALSPLSCVGVMAASGPLAAFAVRRYW
FT                   CWNANHHDMYLPDPFLRAVGIAGMDHDVVLKEGWLLNPVVAVAPSMRRLRLFDWTRSCD
FT                   TPAVLDWMHSREQMLDHTSIETTEARSASPAPEEAPHDSEESASIVAVAQAVAAELRPP
FT                   SPPPRMKSQLQMAWVYDALLHASTYADCKLLWQHYRSLSAPAAAAAAAGEAASAHEMSN
FT                   TISFALFYRDFKYLDNFGVPCMSHELKKLFIDIETQRRGRMTYEEFAHAIALYHSL"
FT   CDS_pept        complement(1148440..1151028)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2800"
FT                   /old_locus_tag="LmjF36_2800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2800"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2800:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1E0"
FT                   /protein_id="CAJ09241.1"
FT                   /translation="MAHTPMYSPYDAVYGHDTTYIRRMTVEEYVQELKEEEADVRGVTP
FT                   PLRAAGPASEKNASATPTYSTPARRATRQYEQRRLALSSCNPNVVFFSKYPMYDRLGRE
FT                   LCVAFQMQDMAVQQELRRLENEDGRDSRRSGVRLSAELLMESDTTGGSRPMSVRASAAT
FT                   AEGRELTQTEEVSRVVRPSHIDGDTLVDIDVSATSHYPSVSAICTSFCPASARPSDFSI
FT                   FRDSSGTVAAGMSRGALIKRHSCVPVRSVAEEEGIRIHRSDGGGGSHRAASMPSAALPR
FT                   VPDDADGRRSQWRWRSEKRHRSRSSGGGGRHSRVRFINDDQGADDIQREEQPPQQRVHG
FT                   ALPLPPRLSTPPPVPLLEGDKTRVEETAVEDATRWTATSRASAAVRATKQLFRSTTHAN
FT                   TSTASRTTATPSYRQPIASSAYGLSATVIAASKVGDAVEHNVQVCAAAMPPQLYSEEEA
FT                   TDVETTPELQCGSVVRLGSAWYRLVHFHLVAEVYVAVRISAPAQTAGSPIQTDSQAAPD
FT                   QRPIGKELMAEAVTDTEQQQDRSVGAAAPEFPMQPSVGEGGDRVVVASTAAPAGPVTGA
FT                   ERNYVPCTDDAESCPLPTSTDSACVGEASSQEYFVYRWRVAMLPRGGDEARRAALGLSL
FT                   CAPPVHVHGIRYADGGGITVLSMPLGYRAVPMSGLPLSLRSYTTLMRVVLKAFSTMVAR
FT                   RTVHGNLSALGELFLAWPMVSEKSSSLPRVEEEKQRAEEGNGNVDAQGATRQPFMLLFH
FT                   WERWVDFSMFVDRNAGRTIPFDFEDGTSPSVTTYGKDLLGSLQLFLEHPLAAELTSEQY
FT                   ILLQKLIVIATEPTQVANYLIQMKNLMMSLPTDTEALHQSCDAAVVHHAR"
FT   CDS_pept        complement(1151611..1153551)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2810"
FT                   /old_locus_tag="LmjF36_2810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2810"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2810:mRNA"
FT                   /db_xref="GOA:Q4Q1D9"
FT                   /db_xref="GeneDB:LmjF.36.2810"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D9"
FT                   /protein_id="CAJ09242.1"
FT                   /translation="MRPSLIQCFPHPFTRQWPATSNPVTCECRQLYALVSVCCCVPNTH
FT                   LLVLHESAYLNTNLITSMPKGPKYVDFAITPRTTPEDLCSFLVRAEMAATGPPFAASAG
FT                   NGGVVGTSTSEEVSISHASPGESLYEGLAPTATPTSASQTRSQWSPLSRSTVAQRHVVV
FT                   VCLHGIADASAAVQSALMDLLMFEQVRNHHRAVRVPTLRIVAFCSSRNYAILLPETLRA
FT                   LFTLSTYVSTLASDSAVVLQTATATSSSIVNKRFMLEVMTASDGQSLLETVTLSGTVTR
FT                   YLRHLLLVVRGSVAAGMSPGALALRRIPRWMTILKALAILFMPDEELLRSRVPQTRSTL
FT                   LQSYSRVTSSTTFERTMNSATHRTETPVSRSMSPETQAVHQQPRGLQSVGSDERRQVDH
FT                   TAAATVESSENSKSGGGGDSAEIKSFSHVVVSPSDIACVLHCLVGHLMTMPREMVPSEE
FT                   ILSATSTMMGNAAGSGSLVEAYGRMLDVHRYGKVGLSLQDPAMWDAVAASWTLRNLHGI
FT                   ANPTTDPVTGLDSSLISSGTYQNYNTTLRSLESVEATGEADPGLRRSHGTRYGGNPEQD
FT                   ALAASSHAPHEQCFQTLNNRPFFSVAEAWKWTAANKFGILDVASTPMLNYWEVREAIRA
FT                   TLLCRSAPAPG"
FT   CDS_pept        complement(1155226..1157001)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2820"
FT                   /old_locus_tag="LmjF36_2820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2820"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2820:mRNA"
FT                   /db_xref="GOA:Q4Q1D8"
FT                   /db_xref="GeneDB:LmjF.36.2820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D8"
FT                   /protein_id="CAJ09243.1"
FT                   /translation="MFFIYPTPQYPRRALEFVFKSLYMFANTMHLISLVVLISDFYTRL
FT                   SNSMPSYYTNRDLVISDAILLVMENCIYTGSIRLGNVHGTVEVTAGNIGYGLMTTAQYV
FT                   TGLFVLEFLLLVNNFLVAFNYTKGNRHLRIFGVHVPLYHITVMMTQVYSIAIVVLVWAF
FT                   DGNRQLFQRALQHCAEEMRKTRYEQLLKSEFDGYTIFSTAVYWPFAATCVAELIYVSAV
FT                   VFLCYFSNDEGIILFSEADAPWESRGLLCNTSKPLLKLHTAQRNAIIEDARNAIKEGQK
FT                   VRIVRSYQLITEEAFEALVQAMREQVARALKEKQFEQLKRTFGDNESQLDNMGFAWREN
FT                   LMASHLDEVSGGVGNGLGNSFKAGPADQFFNVPFEDYFTDNGGAAGRPEVPCSVDPLSI
FT                   QEGGLGDDDGAYGDGNNGFMLDPADGGSETVDAWSPREGANMVNTVGEIYDPPQPQQHT
FT                   QHASHTKHRSRRRRRRGDHAEEDDEDYQVEPDPRDPSQQQRGDGKSDIDGGNAYTSRSN
FT                   YFDANDDMVYVANDMGGSGGGYVSGAGPGGRLDGTTGNYPLSTRESRQRQQSRGRQAGL
FT                   EQEDDVADELSDELG"
FT   CDS_pept        complement(1157860..1161126)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2830"
FT                   /old_locus_tag="LmjF36_2830"
FT                   /product="putative dead/h helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2830"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2830:mRNA"
FT                   /db_xref="GOA:Q4Q1D7"
FT                   /db_xref="GeneDB:LmjF.36.2830"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D7"
FT                   /protein_id="CAJ09244.1"
FT                   /translation="MNVVDDTVAAAGGDDDAIAEQQNMSFLMKLQELYCKTVLYEQLEQ
FT                   MMGHPATQEESDGYLDDVEGLVKLYCSEREAAKKKAPQGDGADAAAQREEVTEQHILHS
FT                   LSVAINGEAEADEGPDIPMSSIQRLCHILRDCLTTETVETGLAVGSLLLADDAKRSAEE
FT                   AARLAYQQQQRHMHGGVDTASMSTSTAERKNAMKVSPEEMFRLAQHVRSGLADEAELLK
FT                   LRSEDNEEEGGGAQDVELNDEEPRFLRNMGFSSMLHRRINYRAPLPSQQLRDARTPQHR
FT                   QAILDRLAQRQQGDSSKLNSMEVVAQMQEKTNMERRIIARKAQRTQQRSREYDFGATMS
FT                   GRDDRSVLDEDRYGRKGGALESEEYSAPPTLLHSELNALPEEGGFRPQDMPTKLAPWMK
FT                   HSFGRKLRFGLPETMQTIQEQRTSLPIYAKKEALLNFVDAHRVTVLVGETGSGKTTQIP
FT                   QYLAEHGYADRGMIACTQPRRVAAETLAMRVAEEYGCRLGEEVGYTVRFRDVTSSLTKV
FT                   KYMTDGMLLREALLDDSFQRYSVIILDEAHERSISTDLLFAIVRQALRKNAVLKVMVTS
FT                   ATLETEKFCAYFGASEPFRIEGRTFPVETYYLTEPTTDYVRVALQTVMMIHLQEPPGDV
FT                   LVFFTGQEEIELGGEQLFRWMEMLRRQVSTPLPDLMVLPLTATMPQEVQSKVFEPTPPG
FT                   CRKVVLATNVAETSITITNLYYVVDSGFCKQNIFDAKHGIDQLKVMPVSQAQAKQRSGR
FT                   AGRIGPGKCYRMYTEQQFTTDMVPETVPDIMRTSLFHVTLQLKAMGLDLLNLELMDCPP
FT                   KEAIVSALEKLRYLEALDDDGLLTPLGSRMAQLSIDPSQSKTLLTAVDLGCSEPVLTIV
FT                   SMLAVQKRGVFYRPRDQQDASDAARRQFMQPEGDQLTLMAVYDAWVENGMSEDWSKHNF
FT                   LKHRMLVEARDTRDQLKEMLVRRNQHISHENDANLDEVRKSITAGYFFNAARRVDSHTR
FT                   SYVTLSDRREVYVHPSSVLIDDPPKYVLYDDLRMTKREYMTELLAIEPKWLVELAPAFY
FT                   ARPKEGRLTKEQAAERFTPILKSWETGSSWRISRLKKQRR"
FT   CDS_pept        complement(1162256..1165693)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2840"
FT                   /old_locus_tag="LmjF36_2840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2840"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2840:mRNA"
FT                   /db_xref="GOA:Q4Q1D6"
FT                   /db_xref="GeneDB:LmjF.36.2840"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D6"
FT                   /protein_id="CAJ09245.1"
FT                   /translation="MGSAPSVQEHLQKWETALGELEQLCSVNRRLMDQDRIYGSGTALN
FT                   DIHRTTDDEATSDRGGARRPSSLVSFSPTTTAVTPEAGMGVSAGSFHRLNRSGASTAVT
FT                   APLPESRTGFGFTAYSGAPGTSTATTLNFAQGGGTALPGNATNDVTNRSAGSASVGQQQ
FT                   SKHTRQQVLEIRKARMSLFRSYEAENPDALTDLMQCSHFGAAAVALSYLLGGDANCKDR
FT                   RRRVTLEDIFFATQSPLHMLHSGSPHLPIMTGIIREFLDVDNRFKGDYSLEAVHLDVSP
FT                   TMGQVELGPNEVGDRQTRMQLPEFQRLITQDCEEETQAIRIVNYDPYVLEQAMLVDAFE
FT                   DEDELNSPLATSVLGPNPHHLERQYSPRNEGAYAAVVDVRNAVQLMVTIAEGVVNDSLH
FT                   VKLKEVPVASLFKAMMTAKEGHRARGFIRVFKKELNPEFTTDEIKTFWTPELRSGKVLG
FT                   TTQLGTNAVAISHHISPHIVGVAWAMHLLAGVRPGTHGYGNGLPVSDIIRTMKLPAEVF
FT                   VDGVLPLEQVYEYAAGYVQRSNRDVDVHLYPVLTKIFREDAVPTISVFDLESILINVKD
FT                   ANADPECPEHVMVIMYNACVAHNVLYIAEEPQWCVLAGYDQEMQTAVLIDAHPKTFSHT
FT                   WSCPLDRLHKAMTGNGYLIFSKRSTNPVSRRVGAPATMAPTVESRLELVERQHELSSSW
FT                   EGKTAFAVPKAFTFPSLPVMPTMVAMTCTRLGVPTTFDDVVQRLPFEISALVIRNLTLE
FT                   IMHVCLKQYLRVVGLQDEVQVKAYHGESNADGFLTLQLPQLEELIQTSLDGNHVLLLHF
FT                   DASRLLVNGASHPFGTLGMVVGYDAELGSVRVADANPNSFLREWSALLPEVFESVLDSD
FT                   VTRKHRTRGVLLVSRVAAAEGEAGPVFAPPCSRPFRLELLPVLNVFLVSPSPHFQGMSF
FT                   AFSQLGYYYSPEEIFYEAYLKTMDDQRRRGSQAFAWRDVEVSLSIINKKIDASFMAEGC
FT                   RKFLESRNGHQSGAQETISVQVLEDIDVDEELDELLEKSTRSSDTVLLLNYDVLRTHQL
FT                   SNLGRSVATVKSYNKEKQLVELWDAEYAVFGLSFVVTKQQLIEMGDLENVGSSPYGFVQ
FT                   LKRVAAGAAPKKLGLMSAPSTLEEEAELETAAAAAGVK"
FT   CDS_pept        complement(1166590..1166868)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2845"
FT                   /old_locus_tag="LmjF36_2845"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2845"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2845:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2845"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D5"
FT                   /protein_id="CAJ09246.1"
FT                   /translation="MSTVAELQAQLDALRARNAQEVEAAKATLAKLQQDLNYMQEDTEA
FT                   LEREEEALCKQFGKSRGTSTALSASQHTDIIAQGLSALVECDDSKCC"
FT   CDS_pept        complement(1170216..1170998)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2850"
FT                   /old_locus_tag="LmjF36_2850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2850"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2850:mRNA"
FT                   /db_xref="GOA:Q4Q1D4"
FT                   /db_xref="GeneDB:LmjF.36.2850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D4"
FT                   /protein_id="CAJ09247.1"
FT                   /translation="MFRMPAVKKPLSSHRPSEARKPTEGPAPSPYVPATPTSVKSVTFD
FT                   WVQACPIYTIKGNSVWHKGGGELPYRPVIGDLAMRPNTGKYFFSYRINTDNSRVGFCTS
FT                   CVYANDADLQNVEFGKAVTVDSETSESLLDQNPAQPSFLQAIGAVPALPSTRWEAYMDL
FT                   QTSKVFVNGVEKRSFWRLFVPISGGVASFVVDTDAGAVQMFMNGKYVGMMLDAQSGLKG
FT                   NTVYPCVGISGCDMANRSIQSGCMGAFVEPAHAFDCLY"
FT   CDS_pept        complement(1172453..1172866)
FT                   /transl_table=1
FT                   /gene="S24E-1"
FT                   /locus_tag="LMJF_36_2860"
FT                   /old_locus_tag="LmjF36_2860"
FT                   /product="40S ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2860"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2870"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2860:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2870:mRNA"
FT                   /db_xref="GOA:Q4Q1D2"
FT                   /db_xref="GeneDB:LmjF.36.2860"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D2"
FT                   /protein_id="CAJ09248.1"
FT                   /translation="MVFQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQL
FT                   IRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMGFG
FT                   KARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
FT   CDS_pept        complement(1173715..1174128)
FT                   /transl_table=1
FT                   /gene="S24E-2"
FT                   /locus_tag="LMJF_36_2870"
FT                   /old_locus_tag="LmjF36_2870"
FT                   /product="40S ribosomal protein S24e"
FT                   /db_xref="GOA:Q4Q1D2"
FT                   /db_xref="GeneDB:LmjF.36.2870"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D2"
FT                   /protein_id="CAJ09249.1"
FT                   /translation="MVFQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQL
FT                   IRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMGFG
FT                   KARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
FT   CDS_pept        complement(1175100..1180253)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2880"
FT                   /old_locus_tag="LmjF36_2880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2880"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2880:mRNA"
FT                   /db_xref="GOA:Q4Q1D1"
FT                   /db_xref="GeneDB:LmjF.36.2880"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D1"
FT                   /protein_id="CAJ09250.1"
FT                   /translation="MTEVSARKERREQRQRALGVDCVDRLTWKEWEPGKEYKRKILVKN
FT                   IDRASQTIQLSLPVNRKTFITPFPEPITLSSGVSHEIVISFRPTELVELHDAVTVTVEG
FT                   RGSFQVRLDCLTPYAKLTLPPSHDFGYCAVGATAHAQVQLQNSGTAPVEFSWEVSTPFC
FT                   ILPSHAVLDEGEIMHITLLFTPTEGCTMVAQAVCRLTGTNDVIAALKISGIGKYPYICF
FT                   QEPTAEERTLVVQMEAQQNSGSGSSKLIHVYNPSPVPVSVRIRRVDESLMCAFHFAVEG
FT                   KVAVEQDDPNGEGTFLVSRGAVQPVRIHYTPGSPGVIDFNTFQFDCAHGNSLQVELSGT
FT                   TLGPRVTASISSLDYEAVDLEHMPPEKQLTRHLTLRNASATDASFTWMNTLPGAAFSVV
FT                   PHSGVVAAQSSLQVAITFRPTHPILYYRRLYLLIEGAKDVVGVDVLGGAYTSAMRPPTL
FT                   TLADVEAARLRTERGLGLLTPEQLATVAAAAAAAEDELMGSKQENGQRGGRRCSVPAST
FT                   LEIWRRIEEDVRSPGVVMRGAKRKVRVPLSNLETANGSVSIDTPFGVDAKPLYTFGGGG
FT                   KSGSDLRGNLVTVMNTSDATAVATWSLPASQACPYTVVPTQQVVPPNGSAVFQLQCSST
FT                   VSDELPAACTLECYVNYESMSAFYLAPDACVVPPQCFTVTCTSAIISVFTSAKQKSQYQ
FT                   QQSASSHISYARQVCLPACRVGGSSYQVIALRNKAATPVRYEVADIILKQVSAVVVPPN
FT                   MKPVAPERKASAAAVEARAAPQEAGEVSEAVFSVYPTAGVVPALGRQLLVVKFSPRDTA
FT                   QYAASARILWDANAMHSTASPAASAALSAAADTTHLNLFGEVCLPQLQWRQVDEDVTVP
FT                   LSMITLPPSCVSGESQQRAWVRNPTALPVAFRFDTSAELLGVLRMEPEQGMVPGGARLP
FT                   VTLFFSPQQPRVFDGFLQLYVQEGAEEAAAPGATQLQYCQQLRVLGEGAYGGVEVEPRI
FT                   MDIGDTADTREQQAALTLYNSGYCDVQYDVRAMLVHAGKSEAAAAVVPRLHNSRGVLPA
FT                   RTHTAVLVAAQPAPGLTEFLVYAIVSGLSTNVANVPNASTAEEAERHPHCRWRLRAAHP
FT                   AVQVVDVDLPGVARPLAWQQLSLNAINAQLATAAAEPEDSSNSVHASFQHYVSGLDPIS
FT                   MDLGVAHEGDSTVCLKVSLKNTGDCPAPFDVMLPTQHEANREHWCLENTELASLYYIID
FT                   RGLVTVAPQQGSIDVGQTVQLEVRYVHSEVGVHRLPMVLRVGRGGRRVAVVLEGRTLPA
FT                   EVRALNFHHQKVYELMPVALGDMEPPLQFITATNPFDEPVEYSVDLVALQEHTREHYGF
FT                   PVFQCVDPRGTVSPRGTVYIGFYFRPLEAREYRVSVLLQTVQGEGYYVDLVGSGYHPRQ
FT                   VAATSVMQWIDHALMQVPAVPPTLPARAHAAFLSDDICKLGAVPYFTLCRRTCTLQLAA
FT                   GCPTAMRYTWHVYRPQRGDAQAVVRPSEGVVQPGKEQTFKILFYAGSTSQVLERLMTCV
FT                   VVPCAAASDGEEKQHSDSGGRRGRRTRATPLPSLNSSRDGSSSAASLSLLLQARVMPRD
FT                   DYEALYGSEKLSTAFAPPLYNSHADPVSPTLLPVASQNTTSPATTAEVCFVKEVMDELI
FT                   RSLVATPAVQSSFTALCAPHHVTYANMRVLHAAKATNAEAVSTAAAAALSRGNASSAMA
FT                   TEELLEELLCSALAEAVAVV"
FT   CDS_pept        complement(1181703..1183709)
FT                   /transl_table=1
FT                   /gene="ABCG6"
FT                   /locus_tag="LMJF_36_2890"
FT                   /old_locus_tag="LmjF36_2890"
FT                   /product="putative ATP-binding cassette protein subfamily
FT                   G,member 6"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2890"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2890:mRNA"
FT                   /db_xref="GOA:Q4Q1D0"
FT                   /db_xref="GeneDB:LmjF.36.2890"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1D0"
FT                   /protein_id="CAJ09251.1"
FT                   /translation="MSSPAPPTDRADAGLLHHLPHSPPESPESSAPPPASSHRTAVLTW
FT                   EDVSYTVSGADEGDTRILVRHVSGYVQSGEMLAVLGPSGAGKTTLLDILAQRKVKSKGD
FT                   ITGRIMLNGEPVEPAAFQLCSGYVQQEDIMHSYVTVEEVVRFSATLRTSPTISEEVLES
FT                   RVSQVLRQLGIYHVRHSCIGSALVRGISGGERKRCAVAAEMVTLPSLLFLDEPTTGLDT
FT                   FTALHLLTLLRSLSRSGVAVVFSIHQPRSRIYEAFDRVLLLNGFGEEAYFGPAADAVQF
FT                   LAEIGLSSGCSSNPADYLIDAVSVSPVEEAWLSEEAQQSAAVEAATDGNQLRLPSPAPT
FT                   QGRDIAAAFASLRLADVMRQIDELQRSSRAATAALAETGSPVRAYPRSWTTQVRCIAMR
FT                   CLRNRRRDPVATYVSVTSAIVFAFLTGTIYYQVGNSQDSIRSRMGVLFFIMMISTFSSL
FT                   GSLEMFLTDRAIYAREHRNGMYSTSAYYVGKFIQDAPIVVAINFLFNLIVYLLVGLQGT
FT                   VAKFLIFDSVGALVTLNSYALCLLMSNLSKDYATGNIITSLLLVLYLLPTGGMLVSLNS
FT                   IPFMWRWIKHISFARFAFSVMVANEFDGLTFVCDPVPSDIAPCITSGTTYAASQGMYAK
FT                   DIRSHMLVVALSMAVYLVLGYLALRGWRSTEGK"
FT   CDS_pept        complement(1184927..1187785)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2900"
FT                   /old_locus_tag="LmjF36_2900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2900"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2900:mRNA"
FT                   /db_xref="GOA:Q4Q1C9"
FT                   /db_xref="GeneDB:LmjF.36.2900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C9"
FT                   /protein_id="CAJ09252.1"
FT                   /translation="MLGLTSSKKTTKIWLLLRWVPVTHSGLSLSSWVGLRQACIRTAPP
FT                   LAAPMCPFHYSPYPLLPWRSTALSHIYRHTHAFGSGRRSKHTEDTIEAASSMCTPACAA
FT                   SECVAASIRWLDYASATLNPDRLPEHPVHLDELLDLLRSAQAPPSTLQDEWSTQVWAMA
FT                   GEPYLVYLLRCLAHQSGLTQLSPHFAVPTTEIDSDDGGAVAVVTAGHSANHPSRLFWER
FT                   CVVVGVRVEPTTKNLLQTGWETQPCSHCVSQDGAAADAHDSPSRRSRLCVLPLLYGGTQ
FT                   CGECGHALSLVPTWTRALYLVLQRRDRSRAAAVAYGEEVHRHLWLGVTIDALLYTSATE
FT                   QQQQLLVVHAAAGPAAAAPSATLPCAETTKGAFHIICQDERVNRLGLKWGDGTAFSAAA
FT                   NLHDVARRVAPQLQGQAHVKRLLLLVVLYIVYYGSHPAAAGSHRHPLHVLLVGPAKTGK
FT                   SALLREVAQLIGLEAEVLDSTVVRTGGSGGAAGGSSFSAALPIRRSAVLMAGSGMTAST
FT                   LVLDQLPSTAGGAAAMAPLLEAMERGHGCGAASGEGDAAAGGPDVHELPSTIIAAAGEE
FT                   SAAAVQLAPYFSLLAAVAPTNSLDDTAIISQDVVAASRARSSHSRATSRSMSRATQLSA
FT                   SSPHHSQRGPSISQSTSHRADPSSLSERLTHEDVCYLVRRAAEPVLLNSVVSHAACYDA
FT                   FIDKLVDCAGLLEETQPSVCHALPPPSACRGQHRVGLPSAACDSLRAAPLAIDEHLRIL
FT                   CALSRARALLEHAEVLRDAGWTAQMRDEVWALYHGHLVAFADLMQRRSCSSGAMASRDP
FT                   AEVLRTTSWSSSFFDACGGSTAAPAPAGYPSLSRFSGDAAALGRAWKGRMRAMSSREGL
FT                   GLWHPQKTPSKKRCRLMFVEALRQRQCLSAQVESAVPPPEVEHVFGLLGGSSAFGDPLD
FT                   VVISQMQEEGLLLRRPGGWRSL"
FT   CDS_pept        complement(1189067..1190107)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2910"
FT                   /old_locus_tag="LmjF36_2910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2910"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2910:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2910"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C8"
FT                   /protein_id="CAJ09253.1"
FT                   /translation="MLSSAHRAAFARPTATLWASARSFGAGPTRLLLGLEQVQDVPTST
FT                   DRKPTGMHRGPGKRQTAPKEAAQYQFIKKWDLQMRETWDELEPFKGLPKPKVQFGNEAA
FT                   EVIWPYALLLENVIKVHPYTKSIYVYYSQRQSTPLGELAARVAKRVSQAYLIPITFHNS
FT                   HVYVEAEMLLEYSETPWVVVHCLDGTHKLIPVKPQAGQTVKEGAEEVLNGIVSACNEIG
FT                   SAVKNPKEVMRLLSERPLQNQYVRVNYQWYGDTPEERMSHLVKWDYEPEEVVPQLRNRT
FT                   QHVLDWMNYDGNLPTHNSVRVNIHREAARMRKPNVSAGPKTFFNSSGSRANARTARFDN
FT                   SRSSQS"
FT   CDS_pept        complement(1191066..1191407)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2920"
FT                   /old_locus_tag="LmjF36_2920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2920"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2920:mRNA"
FT                   /db_xref="GOA:Q4Q1C7"
FT                   /db_xref="GeneDB:LmjF.36.2920"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C7"
FT                   /protein_id="CAJ09254.1"
FT                   /translation="MLRHSKDLQMCRKTAGTALGYVCRLHEGRCVICDLQFSEIVDTMR
FT                   EVHLCEDCSVVAAEGEEACIMCGSRRVTDVAYYCPYCVALEKDRDGCPRVLNQTRQQRL
FT                   AALRAAVSQ"
FT   CDS_pept        complement(1192873..1194525)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2930"
FT                   /old_locus_tag="LmjF36_2930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2930"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2930:mRNA"
FT                   /db_xref="GOA:Q4Q1C6"
FT                   /db_xref="GeneDB:LmjF.36.2930"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C6"
FT                   /protein_id="CAJ09255.1"
FT                   /translation="MYATVPILTLGPYSLALVVGLLLYWNTSLIVSRVLAAFIVSMIAM
FT                   KVDLAFHLFFSCCHRAASLLCRFRTFWSPDDSLDFLQTQSQFYSIADVVSLALLVGNAL
FT                   QFWTAALVTRIALSALATRTELSIRWWQSQSAAEHVLFALGSLLCCTGCALQWAYYTLL
FT                   PTEERTQGGTVSLLMWYTSIVYIVEVGLRSACTLATTVMRMWGYRVLESLASQVDHIAV
FT                   RALEDSGLNPFTEVHDLYMQYLYAVACAATAWYYTSSSTPMWMQCFMLVRLYFITLASG
FT                   KLHHYRQVLDRFPSVAADPTKTCGICLDDFVHGESVKCLPCGHTFHGACVRSWLIRAAV
FT                   CPTCRRPAAQSRHQHFAAAHHEHISQQPRVSLDMRVPAVGGGFTGSLQPLAPRLPASAP
FT                   LARASSRYMSRSGADALSQSPSLPVELRRLPHYEELQRVDAKRRSLALHRQQQQLFSEG
FT                   TRTAASPEERHKEGTEGCVRDQSAAVDALLFTETPLLPAESTPLPPYHGTSGRRKRQRP
FT                   PPESTAGSVTRVRNAASSGVAATEDLPSRRRME"
FT   CDS_pept        complement(1195618..1208169)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2940"
FT                   /old_locus_tag="LmjF36_2940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2940"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2940:mRNA"
FT                   /db_xref="GOA:Q4Q1C5"
FT                   /db_xref="GeneDB:LmjF.36.2940"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012582"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR037706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C5"
FT                   /protein_id="CAJ09256.1"
FT                   /translation="MDEVINVILKCITQLDLFVDGPAAHLSGTAAPTTIDTIRKCIADH
FT                   AYLFTDHHTNGQRVWELVCSANFTVAEPRAPTTAATATATLLSLFRRLTDSVAASARAP
FT                   EADILKHLVKLLCDAVKPPLVRGASPGQLRCLFEATMRLLKLLFPLKKRADVQTECLHL
FT                   LLALMQLSDLQEAHGAVVASGDEVAQVAKLCTDICGAKHDVALRPQNASMQLLGCLCEQ
FT                   PAYAHALSRQLAERILKCFLGVARNLAQRAEVNQTLGEGLLRGLAGFLGSFPLRCEEDA
FT                   AALALINNIVLSALMLGETSTNYTFCLSALFLLRRRAADTLAHFTLLCAAEYSAALRLL
FT                   WMHRNKDVRRETHAAAAVFWSTLSSQLQQHCSSEVADANTTRNTDASHKLHSIVESLLR
FT                   SLDSSADREASYALEALYHLLPAVAALSGPQALQAMSTRFEERVGALLITASAQRTEAS
FT                   FPQVPCLLATLGQLLTLLPSVSPRQQTVVRELLDWVLLLYPHPKFYNREKTVLGIVLVI
FT                   RALTHHPRAPHNTLPRLLSERTLELVGEAPGAAMMRLAGECISAEERLDRMATLWTRLL
FT                   TTREESGAEAEAESKQRLSAAFYRACTGFCERARLEVGIVASNSEATLERILVGGVDVV
FT                   QPSFPTHYSAFLSFVDFFVRLSEGLKRSGCVCRPPAEELTAWLEALVRGATAAPHVSGF
FT                   YTLLHRTVVGIEDMRPHSSTHQQPYTDAPLASGNSVVTSDGYHENYLCVSPLLRHFLCT
FT                   ECLRRVHVYSDELLYQCAMCVVVGAALVGSEERDELAGSRARTCDDHRRLDAYVRAFKV
FT                   VMAGTPTPRKAESATGSANEVVCSFGNSPAVLESNRQYGLRVLEKKSCRSPRWAAAVLP
FT                   ALTSALRSAEVVAAVRAPVQMLSARHGVAIAAELQHHSNEATFARLCRGERASNGRRDS
FT                   MPRWLATMQPVTIPLVPVDSALHIGYLVPLVSRLSLHGKQPAVRAAAAEVLYWCVVWVI
FT                   GKKVSHWDSAVFPPLLSLASLACTSTGGSGGGGGNGGSMVHQGLHGLLMQTARWFGRSA
FT                   GTPEEAESFVSVLLRGLGEQEATQRQVATEALFAYAIPPADEPQAVTPHFRAVIRQLVR
FT                   MECGVSECSRLGAAHCLHLMMRRLCKTRVPVLACTVQAVAQGAVGCLRRCTEVPIWGAM
FT                   ETVTCNEVQESLRWLCAYCHDIRQLENEEEQREADQVAADLVHAACAVLPALARRHTAC
FT                   AITLLQTLPAITHTSANAHQVLLLSQELIREQQQRLCSAAARSLDSVVGGCATLVALLH
FT                   SGYGTENNERAIAEAVPPVICAREDDCSVETELLRLLTVVLQAIVEEARVATHESRCIS
FT                   SHLVRWLLELVDVVPEQTHATHFSLLLTPTVIAQAARVMVAGAKATVENWAGDVGEDTT
FT                   VGVPLHCCAPSSRLAPTARRCVELIEFLMRVAGQRRRGAQVIEDVLCAIQETGVFSVFT
FT                   AASPARQLIDALSVGPSALATGPVALAAALCQVEAPRASGTATLWMRIVDSMKLSPKTV
FT                   VTMLLGLLRNAAALNATGGEEVCEGLLVLMLSEPDPALLRQHLRDLLASDAVQHNISFT
FT                   KPSFAVNLDDGDGAVAVSPSSRSSSVLLSRAFGSVMNRCWQQASAALPTDRLVSALPSL
FT                   TTVAMAEGALRSSSEAVSLFSLVGDWLAELQRRSLTSEHDKALCRVCANLVAAEREMRE
FT                   SAPTGAQDDGRGGARLAALLMLVQLIGPAICTDPTLSSALCDLVLFVSKPANMYSLLAC
FT                   IGATERVVWGFHVLAATVTPRPARRSLVVFPVDMRAVEVAFDLLNEVLNNALPLRWAEL
FT                   KTHREQTNGADVVHSGTALFAAVLPHNVQVLEVIAPLLAQESMPQRDSIVRQVHGALQA
FT                   LSACQQALQLDACRCASRLLRDPRTHSGIDALTEHVLLPLLQASAEAVRLRLFEEEVRS
FT                   WVTEAGRAPALGCFYVQTAAFSCLALMHRLCPLTDLRGSISTAFTGRNPNTTGVELTLE
FT                   VLKACRAAWQLPNTGGDNNSAEEADGDVGDSARADAPRRYRQAAFRCLLATLSQTQQAE
FT                   KVFCRCLFQERSVAGWNGLFLVKRRGVVVTDLLDAVGEVQLWRDMNRCQVPELFAHLLR
FT                   HFPSSSVTPGEPPEWVRHVVAVARQPQLRLPVRMVFYEMICRHERFFGTFARCIFDGVA
FT                   DSVAAMAPSERAGKVIWELIALLTRWHREGGSGALAVGSAASLKALARYAAVHLAWEHS
FT                   LTAREGSCALDPTSQKRLAELLEQIRQAQGATPTSLSTSQPLTAAEVKMLLSHPAYERR
FT                   AALEVIYMVTNACGCLGCTGDSREVGEVYDLLGACLGASASPQLYRMTARLVGLEHRLL
FT                   SEAATQKPSSAVRQPLCDALRGTVCTTLDVCKSDKKFLEVLEAMQEDRSGDLVYQLLSR
FT                   TDLLRRYSIRKDSEKLLTLRVLARAGTYVADNYDSIHVCLSGLLRGGHGELLLGICTVV
FT                   RNALPHMSMESVRHVLRDFCCLDVLQAMESAEPARVAFYNMGFAALRRWTVVREDQEKQ
FT                   DGGDSVSADAEAFLTRRGLRDASPAVQGAVLEYLDVHAQHVPDTMWGRLTCLFTAEDGA
FT                   SGDGHSGSGGWVRHVALLLLSLSKRSRNFASPSYLFPEALHSEGASPTLATSADTAAES
FT                   SVARRQPRKASLFSEAVQCGSPAEAATANAACPITAALAQIYAPPALVPQPPHHHHQPL
FT                   SGARRPRATGAGRLDAAPCATATAAAQSWLHLESGDSEQENAVVSAGVMASRQIFATTQ
FT                   LRAAHGATLRAGRSVINASSAAPLLESNTAGRLSEVRLTLQSLLVPLQVLCLHEDEVAA
FT                   RVLIDLISNAAVASPATSESPHTVSLCSALASLLPKFESGATTRQCEHAKSPFALFVAL
FT                   ELLLHAQAACWPSLASLDCAALVRLASHVQACGGSVPTASLPVADGTAHVVERLLSSLQ
FT                   PSTARGVPTRPSLAFPTLRWHAYHVAQRLRRHDDAACQAALQLFKGARRHGAPVIQLQG
FT                   ALDAMEMGGAAYSMQVIAKLLEDEEEEAAAVAVATVASPATHVSGGVFALFAAREEVLR
FT                   HYRSRASRLLLDWCGAASALQSATPAGAGGSGEVSVEGVRLRLRAQLQLMCDGTASAVT
FT                   AEASTASRHRTGFEWGACLMANGRWLDCQLHVETSVDHLLGGTASHYDGGGSSLACGYL
FT                   AANSLSQLADAAQVLRFVSTSTASSAGVALQTYLDTMPASVPVSGAYGSLFIDDVLLIR
FT                   RLIIDYHVQSTGDLSGSLQLTDNERHKLVARIHELLGTWTVQQCSELLLLPEKTSAIET
FT                   IASKADHATLSEPTRCALEFLKKRSSLFCIAVTAGEVSGASREEALAAFQATGKDVQQR
FT                   AAAGLLSPAAARQWAADVAQCEVEMSASIGSILSCPAGLTASVPKREMWVSTLKENLRD
FT                   TIPSHVALLNALEKLLPPVSRGDGTLADMRGDAKDATRASSITAATQSLWQLYANTFLW
FT                   CAQAAGDRSVDADSGGHLPVLARVPRLLSLFALPRVAEAAAQAQWRGTWEALVMLPTQV
FT                   WLPWATLLVNALLQTEHAVLARILLRLCRERGQVLYYPINCAWRSLADLGKRRNAGRAV
FT                   DDDLIRELAELHKWHRSHRMALVAEFAAALDELVEPQHRLEMRLSEVESLVKQHEQCTR
FT                   GGGGGAQAEYLMAALQLYERCKGDLMDPARWGRAQLYHRRAAQVLQELDRRNAFSAEVL
FT                   KSGEQFRSAKKEALRQVTQTLNTLTPNASNSATRSQELRLYSERLPRALGRSATAATTT
FT                   TTQLGHASDAAEPILQPVQPTHLLHTPPDGAQQCCTLVGVADRVLVLKSKRFAKKVDIY
FT                   TSAGICTYIVKGGEDLRLDQRIQEVFTFANVCLLVSPRSRLSALTIRTYAVIPVSPLVG
FT                   LICWVPRTTPLQELMKEATPPDAHDAVARFCRARGKPQEVLSLYKTAYITGIPEQEYKG
FT                   LVLRLRQSALVESLESIATDHCSWFGVRDAFLDTNAAASMASFVLGVGDRHAGNLLVDL
FT                   LNCELVAIGFGLAFGDATRKLPVLELMPFRHTPQLQRVQGVLGDSVTRCRMRRVLHVLR
FT                   AERHVVEEMVAALLMPDTDAIGDEASHIAGHQLDVVRRKLNLEHPADIILRDVARNAYV
FT                   TQDKDVWSGVKACLSERERDENGEDAGLTGTELSTLHQEDVFVQRLLRVASDPRLLGRA
FT                   YAGWQAYM"
FT   CDS_pept        complement(1211743..1212984)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2950"
FT                   /old_locus_tag="LmjF36_2950"
FT                   /product="putative succinyl-CoA ligase [GDP-forming]
FT                   beta-chain"
FT                   /EC_number="6.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2950"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2950:mRNA"
FT                   /db_xref="GOA:Q4Q1C4"
FT                   /db_xref="GeneDB:LmjF.36.2950"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C4"
FT                   /protein_id="CAJ09257.1"
FT                   /translation="MFRFGRLCTPKAASVQRRFLNIHEYQSKQIIKDNGGRVEFGIACK
FT                   TIEEVEAACAKIKTEKKVVKSQILAGGRGKGVFKDGFQGGVHVCDSAAAAVEAAKHMLG
FT                   NTLVTKQTGPKGQLVNTLYVTEAVAGIKRELYLSLILDRKSASPMFIGSAEGGMSIEEL
FT                   AKTHPEKIKTMKVNVAEGVDHDAAVAYAKELGFAGETTERAAEQIKALYNIGKSKDCTM
FT                   VEINPFVELENGDVMEIDAKLSFDDNAAFRQRGIFALEDQTQIDSKEVLAKKHDLNYIA
FT                   LDGNVGCLVNGAGLAMATMDTISLHGGSAANFLDAGGSASEEQIVAAFKIITGDSNVKS
FT                   ILVNIFGGIMHCDVIAQGVVNASKALNTTIPIVVRLCGTNEQRGKEIIRNSGLVIHPVE
FT                   DFDSAARKAVELAK"
FT   CDS_pept        complement(1213721..1214119)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2960"
FT                   /old_locus_tag="LmjF36_2960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2960"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2960:mRNA"
FT                   /db_xref="GOA:Q4Q1C3"
FT                   /db_xref="GeneDB:LmjF.36.2960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C3"
FT                   /protein_id="CAJ09258.1"
FT                   /translation="MFAIQWYTAALILADAYELLQLRQANPKDLAHGTWWFDSRANAPL
FT                   AAALYGGLLVFLMLSRLFVFLEPLNRWLLMLNTIHEGIRLVLYSLLFTQHSGATQLNTI
FT                   LLTFTLWNTLLYGRQYYITMCMLREHSK"
FT   CDS_pept        complement(1214958..1215473)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2970"
FT                   /old_locus_tag="LmjF36_2970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2970"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2970:mRNA"
FT                   /db_xref="GOA:Q4Q1C2"
FT                   /db_xref="GeneDB:LmjF.36.2970"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C2"
FT                   /protein_id="CAJ09259.1"
FT                   /translation="MLGLSITRVFQAYCAGAVLFEVPGIVRLLRGDMPLPKAGAWVDDK
FT                   DYYTNNKPLVYVFVAILACLVVSRGMACALPKSRIIIVYLVAVHTFEAGLYLYCCSRKK
FT                   DAPNSEVYIMGTLMVVNISLFAARLVQLKVQHTRAEIADLKRRQEQLAIIRKKRADYAK
FT                   NREEKKNK"
FT   CDS_pept        complement(1219490..1220191)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2980"
FT                   /old_locus_tag="LmjF36_2980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2980"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2980:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.2980"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C1"
FT                   /protein_id="CAJ09260.1"
FT                   /translation="MDVSKRPREELHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGYY
FT                   DVVETPMDLSTIRKNIEQGTYRTDAEVENDVVLMLSNALDFNEKGSQWHDLAKQFKKQY
FT                   LTLARESGLSFDADQAFIPTKKVRDDESTLRKAEKKGEEKLEDVLQAMEKDKEIPLEQL
FT                   RAMYARRTTRGKADQQSSDFSSGRGNDDSDEVVSSDEEDTSDSGSGSYDTEEDEDSLDS
FT                   ESASKDDDDDK"
FT   CDS_pept        complement(1221050..1222513)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_2990"
FT                   /old_locus_tag="LmjF36_2990"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.2990"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.2990:mRNA"
FT                   /db_xref="GOA:Q4Q1C0"
FT                   /db_xref="GeneDB:LmjF.36.2990"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1C0"
FT                   /protein_id="CAJ09261.1"
FT                   /translation="MLRRRWGAHRARHRFVDRVKVLLCSGAGGDGASIMAHEHGNEFAG
FT                   PGGGNGGNGGNVMLQCVKQHTDLSHIEDLGSQISAGAGCCGFSREAHGKRGQDLWLQLP
FT                   LGTQVVDMDTNEVQYDMDEEGMQIVLLEGGQGGKGNAAFANKWHHSPIESTKGLPGNTM
FT                   LAQIELKTIADCGLIGYPNAGKSSLLSAISASKPTIAPYAFTTLRPYVGVLHDLYGNVC
FT                   RVADIPGLIEGAYENRGLGHQFLRHVERTKCLALVVDMCNTYVPDTGLRNSSEVLQPWD
FT                   VVELLLQELEYYLPGMSQRVIMTFANKMDIEKDSTGTATQVKLSELKRRVSMPVFPISA
FT                   ALGIHLGPQHEQTGLAPALQFMCGEVFARQSQEREMRQFRFSHERAQLERAFRAKHNGV
FT                   FLPQVHALGAHGAEASQDLDDEAADRGGSLVDQQLDFLGNSGLGVKFDAYENSAARGQL
FT                   HRYRDLTMKGKYWNLTRQDGEVMKGEKWS"
FT   CDS_pept        complement(1223367..1226273)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3000"
FT                   /old_locus_tag="LmjF36_3000"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3000"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3000:mRNA"
FT                   /db_xref="GOA:Q4Q1B9"
FT                   /db_xref="GeneDB:LmjF.36.3000"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B9"
FT                   /protein_id="CAJ09262.1"
FT                   /translation="MHISRSQGTHTVLRMSDGREDEPAAKRTRREVDPAITFPYELDTF
FT                   QKTSIDALEEGDSVLVSAHTSAGKTTVALYAIAKALREKKRVIYTSPIKALSNQKFREF
FT                   SEKFDSVGLMTGDTTIKADADCLVMTTEILRSMLYRGTEMLREVGCVVFDEVHYMRDKS
FT                   RGVVWEETISLLPEGCQYVFLSATIPNAREFADWVESIHPTTKVHVIHTDYRPVPLQHY
FT                   LYPAGADGIFLIVDEKGKFRDDNFGKAIASMGAEGGANGVGAAGPGNGSSKDPRGNHKG
FT                   GGGRSHGGSSQSMMEIVKLVMDRNMYPVIVFSFAKAECERNALALSRLNFNNAEEDALV
FT                   MEVFNNAMESLAEEDRKLPAIEHLHPLLKRGVGIHHSGLLPILKEIVEILFQAGLVKVL
FT                   FSTETFSMGLNMPARTVVFTSVKKFDGEKNRYLTGGEYIQMSGRAGRRGLDRVGVVIAM
FT                   VDEAVEPNTLKQLTGGGADVLLSSFHLTYNMVLNLLRVEDVDPEFMMKRSFSQFQRLRD
FT                   KPALEEKGAALRRSIEEINVAHESAFRQYTICEDMIAKKKNEVSHILRQPKLLKNWVQA
FT                   GRFVHIIRASDQRDFGWGICRSFAAKSTNPNFSDPSTFSIQAAVICMKADASNPSALTP
FT                   CPVSEYTSEKADLYTVTFDFSDVQCLSTLKTNLPENPDSERGRAEVVQILSKLQRQFGH
FT                   DIPVLTSAQMGAEDVQLSKLQTQLSNLQKQLEGNILATSPTPELQEEFEQYKRKADLEA
FT                   QLEQVKGELAGMGKAVFSEELKQMMRVLRRLDYIDKDNIILRKARVACEITTTDENEIL
FT                   LTELLFKGVLNSMETEMIVALLSCLVNVHRTPDGFSLPQEFEQPLKDLNEIVTRIATVS
FT                   AESGLLQENSSVEKVMPSLMEVTYLWAKGAKFVDLVSKTTAYEGDIVRMMRRLEEMLRQ
FT                   LASAARSPAIGSIELHEKFLKGIQLIKRDIVFASSLYL"
FT   CDS_pept        complement(1226716..1227174)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3010"
FT                   /old_locus_tag="LmjF36_3010"
FT                   /product="putative glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3010"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3010:mRNA"
FT                   /db_xref="GOA:Q4Q1B8"
FT                   /db_xref="GeneDB:LmjF.36.3010"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B8"
FT                   /protein_id="CAJ09263.1"
FT                   /translation="MASVFTYSAVQNGKTVVLQKYSGYATLIVNVASRCSLASTNIEML
FT                   NEVQQAYGSRRFTVLAFPCAQFANQEPLNNTEIAQWCEDLGLLFPVFDRVNVKGSSADP
FT                   LFQMLRAQQGAPLWNYTKYLCDRSGVPRRKLEPGCSMDALRQSIECVL"
FT   CDS_pept        complement(1228020..1228760)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3020"
FT                   /old_locus_tag="LmjF36_3020"
FT                   /product="putative exosome complex exonuclease rrp41"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3020"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3020:mRNA"
FT                   /db_xref="GOA:Q4Q1B7"
FT                   /db_xref="GeneDB:LmjF.36.3020"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B7"
FT                   /protein_id="CAJ09264.1"
FT                   /translation="MSRQKEYVSPAGLRLDGRRPLEARRMDIAFGTLSACDGSCDITLG
FT                   QSKVCACVFGPRESLHKQEAKHDKGLVTCEVAVAAFAGENRRNPQRRSKLSEDIGAAVV
FT                   QVARSVILLSQYPNSQIHIYIEVLQQDGNEKIACVNAACLALIDANVAMRDAVCCIDAG
FT                   ILDEHMLIDLTSNELRSQCPVIAAAFTGHDTRNIIWLETASRLPPDSVTRLLKCAEEGA
FT                   TKLFEATMRKALEEHAKKILTLQN"
FT   CDS_pept        complement(1230555..1231871)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3030"
FT                   /old_locus_tag="LmjF36_3030"
FT                   /product="clathrin coat assembly protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3030:mRNA"
FT                   /db_xref="GOA:Q4Q1B6"
FT                   /db_xref="GeneDB:LmjF.36.3030"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B6"
FT                   /protein_id="CAJ09265.1"
FT                   /translation="MLSVLMFLNSRGDVVLSRTFRAGNSVRSLAETFCSEIISTKQVDR
FT                   CPVNIVKHICFIHLKLTELYVVMVSDSNVNCLMCLQYGARLLQHIQNDYEGLDEKRIKE
FT                   NFVALQGIIDESMDFGYPILTDAEAIKEFITKDGVDAAVLKNTRESERIADRMTGETPW
FT                   RVEGLAYRVNEVFVDVFEDVNLLLSQTGETLQSSVLGRVVMNNFLSGMPECQLHWNAKV
FT                   MSHGIGEAAESHGAGGIEEVVPLASISFHNCVRLKVSGEERRLTFVPPDGKFTLMTYRS
FT                   SVNVHPPMKVLSAKAREISKTRTEVEFTLRSDTPAGRVAKDVQVSVACPDNTATAEVKV
FT                   GHGKAKYDPVSHAIVWKLPEVKSGEEIAFFAEIRQITPTENTELLWTKPPIRIAFQCVS
FT                   LSLTGLRINELVVKEPTLMYTASKWIRYTVMAGDYQCRI"
FT   CDS_pept        complement(1232362..1232913)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3040"
FT                   /old_locus_tag="LmjF36_3040"
FT                   /product="putative pre-mRNA branch site protein p14"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3040:mRNA"
FT                   /db_xref="GOA:Q4Q1B5"
FT                   /db_xref="GeneDB:LmjF.36.3040"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034150"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B5"
FT                   /protein_id="CAJ09266.1"
FT                   /translation="MRVARFRLSVCQRAHTRRSCLQCLLLGLTILLKQPPPPLLAFFLY
FT                   SASVVCSHVSPSNASVHAAAMPDERILLVTGIPSKQCTSEYLYSLFGAYGGIQQIRIGS
FT                   SSITKGCAIVVYEQCEAANNAVGALNEYALSKDRVLRVSVYEEERDKKALERRKRKREM
FT                   QAEYKKHIADVAHAANEPKE"
FT   CDS_pept        complement(1233301..1233729)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3050"
FT                   /old_locus_tag="LmjF36_3050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3050"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3050:mRNA"
FT                   /db_xref="GOA:Q4Q1B4"
FT                   /db_xref="GeneDB:LmjF.36.3050"
FT                   /db_xref="InterPro:IPR037485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B4"
FT                   /protein_id="CAJ09267.1"
FT                   /translation="MMRIKQKAFVGKKICIAWEVLHDGKGWKAQGKALQILRFYAFSSE
FT                   VYLMCRIRDADDKKQICNLVKAVDGIERHRVLFCTTEKGYEAFTRQIDPSLLITNNAAQ
FT                   VAFLKRVIQTLVLVGGDGVVASNVACVPSVEAIAVDLE"
FT   CDS_pept        complement(1234408..1236528)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3060"
FT                   /old_locus_tag="LmjF36_3060"
FT                   /product="cullin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3060:mRNA"
FT                   /db_xref="GOA:Q4Q1B3"
FT                   /db_xref="GeneDB:LmjF.36.3060"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B3"
FT                   /protein_id="CAJ09268.1"
FT                   /translation="MSSLVSSRKRMAEYSTFSDKWSIIEETIRCIFKKEVSKNSFQRIH
FT                   HSVFQLCQAHYGSLVLVQLEEQFFAQVSIIVNRIDGSSTYVADFLREWQDYNDSVSHIS
FT                   NILLYFNKNYMYACHHSSIEHLGERIFCSSTLGNPEVSTCLIASIKQLIHVPAAESTIR
FT                   DIGQELYTAEGSKYFARCMETPFVDAMVDKYVVQGEQQKQALTTSGYLQWVQNVVCTES
FT                   HKYADTFFYILLDKLTSALYSSLVLSDPSSVNEMLMGPTGLVHMLEEWDVASISTFVQV
FT                   FCAMKREKDVTDIIAHVLKEKCEDIINDRDTSVFPFPGVQKMLQLIERAKALDSLFPSE
FT                   EGHSQSPFLRVIRNVLGNDTRFMETLSVYYDNGIRQGKDDIVSTVGNNVLTILQLTPDL
FT                   EAFEVAFRSHLAVRLIYAKPHAVNMECLFIDRLFNIYGSSVVNRFQKMVEDIRSATAAQ
FT                   EKLIADMKTKRISPPLEFNVLVLTSGLWPQYTNIPLSIPQSMEACKRVFQEYYRRRHNG
FT                   RKLVFQMSLGSIAFQLCHGDRTYHVSAHTHFVNSIMALNSDENLSVAVVAQQGALSCDE
FT                   VLTQFNTLCHVGLAERNGTEFRFNRNFYSSKPKVKVSAGVQKSAHDGGSASAATRKGMD
FT                   GARTMSLDATIVKLLKEHNSMDYQTLCGAIESELRDVCSPTRTDVKLRIDALIEKGLMT
FT                   RGESAHCYFYCS"
FT   CDS_pept        complement(1237402..1238106)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3070"
FT                   /old_locus_tag="LmjF36_3070"
FT                   /product="fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3070"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3070:mRNA"
FT                   /db_xref="GOA:Q4Q1B2"
FT                   /db_xref="GeneDB:LmjF.36.3070"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B2"
FT                   /protein_id="CAJ09269.1"
FT                   /translation="MLHPGVFISKAKTDSLCTLNMVPGISVYGEKRIELGATQGGDDKK
FT                   EYRLWNPYRSKLASAIYAGVSSIHMGPGSKVLYLGGATGTTVSHVSDLVGPEGMVYAVE
FT                   FSHRVGRDLVEMSKRRPNIVPIVEDARYPMKYRMLVPMVDCIFMDVAQPDQARILALNA
FT                   QAFLQNGGHYVISIKANCIDSTLEAPVVIASELNKLKKDKLKPLEQVSLEPFERDHAVV
FT                   VGVYRPVKKSKQ"
FT   CDS_pept        complement(1239201..1239998)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3080"
FT                   /old_locus_tag="LmjF36_3080"
FT                   /product="putative lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3080:mRNA"
FT                   /db_xref="GOA:Q4Q1B1"
FT                   /db_xref="GeneDB:LmjF.36.3080"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B1"
FT                   /protein_id="CAJ09270.1"
FT                   /translation="MKAFFIGKREYRRVLSLQETIFNAKIARQVSVRRGASKLPLLPDV
FT                   VILVEHSTPVYTIGRRDTTHGLPPHCSIDVVKTRRGGGITYHGPGQLTMYPIANIQLLW
FT                   KDCTAEKPRSPIEWFSWALEEAMIQTAAMYHIPTHRFKTGVWADQYKDIPAQKLGAVGL
FT                   QLGSWVSMHGAGLNVASDLHFFDDIIMCELPDRRATSLSNEMQHRGVAESPPLVQATAP
FT                   VLLQKFIESLHQQPSCAAPQLVDLSADADWHERVIDTAGISTP"
FT   CDS_pept        complement(1240529..1243000)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3090"
FT                   /old_locus_tag="LmjF36_3090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3090:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3090"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1B0"
FT                   /protein_id="CAJ09271.1"
FT                   /translation="MQTQAHKDVVKNITTASQLEGELQLSQAQHGVAVLDVYNAEWGHC
FT                   KALSDTFRRLFTDAGDLVHLRFFSVECNAVLESLKDPDEMKPHHPQQRGMVFSKDTLVS
FT                   FWKEMLEKRQNHSKPFFAFYKEGRMRTQLEGIDTPKICRVVRDLCNQQNTVSEYVTNAD
FT                   VLRFWESHFSLSENEVAASEFAHAVQAVLGASAAELSEADLTDITAEVQSTSGATVSAA
FT                   DLQSFVGDSGRVQDAILTFLAKKREMATATAAAPPPPLEEELQPTESEEKDTDEEPRAS
FT                   PQRPLSAESGEAVVEAAASDEEAEVGGEEVDADAALETLPAEEDTAEAASSVHDAPSHN
FT                   DEQNEELPETVTDGADEEPVIEPPTVDAAEADEAGADTHDLDEPAVANPVVQQAMQQPE
FT                   GNEPDSAYEELPEQQSAADVESPTPSPSLPAEEHGESSVEEASGAPADEAPTEDDTQAL
FT                   PGAAENDDDQHEELPEDACPPSSAPQPHMDTMESEDGNDEELGEAPSSVPPADTVNTTG
FT                   DQDESVVNQIFTNRWVTVTEEEMHVWNTVAALPLHYPQSTTMMADLTNDTTPAHEALST
FT                   TADLPTLAEYLTEQGVPYSDINMMCIAADQKVASESLSYGKLSLLLLSCDPEEGKGLVP
FT                   HCETFLKELSDGTLLKHQQPLAFTALALSASVAYPDECFCYCVPETAVAAFQELVVDDI
FT                   FILNALTPLKTTVPQDGQFILRIIGLPKVIELATTDESEDTMVLSQWYARLRVAEQDAS
FT                   ALTAHFVENVCDDEFQDFLSGYIERLIEDENRLDKKHGDEEKTAEGEFNDEELDDGRSA
FT                   EAATPEPEDVL"
FT   CDS_pept        complement(1246490..1247140)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3100"
FT                   /old_locus_tag="LmjF36_3100"
FT                   /product="putative ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3100:mRNA"
FT                   /db_xref="GOA:Q4Q1A9"
FT                   /db_xref="GeneDB:LmjF.36.3100"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A9"
FT                   /protein_id="CAJ09272.1"
FT                   /translation="MSEARQIQSMIDFIEREAQEKAEELEAAAQEEYDVEKMRLVEAEK
FT                   AKIRAMAEKKLKQVDVDRRVARANYSKVQRMRVMEERARTMEKLHEQTRQKIVAMVNNP
FT                   PQYKPMLVRLIHQSLMSIRTDAVVQCRKEDEAEVVRSIPELERWYKEKTGATISIQTSK
FT                   TYLDTAEAWGGVVVKSTDGRVVCNNTLSYRTKTCFDEQLPTVRFHLFNPDAPL"
FT   CDS_pept        complement(1248790..1249920)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3110"
FT                   /old_locus_tag="LmjF36_3110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3110:mRNA"
FT                   /db_xref="GOA:Q4Q1A8"
FT                   /db_xref="GeneDB:LmjF.36.3110"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A8"
FT                   /protein_id="CAJ09273.1"
FT                   /translation="MTRVLVNREDCSVQVKGDLITFLYATVAKDPLVVASRNVTQLLRS
FT                   RKDDTAAKLVADGESYVLKFESLRDREGFIESIVRAQEAEQALSNDEWVASTICHAAVD
FT                   VGVLDQEELRAIMSAAGQRGVEQAFDALETLVDRETFQLLPITEQMENDVLRQTPVLAA
FT                   IFQERVVDKETKKSFWEAVVRKYFCFSRTFLEEDIQRLEGARSVATAASPPLSGSAATS
FT                   SLSVINASSMCALPKGAATAMLDTDINEEDLLHLDENVEPLQQSFHGLFAAHRHLPVGS
FT                   ASVLPVNGAALPFPQETAEPSPVYRPRFVGFRVLHQLPSETIEKAALETLRTFWRSSVK
FT                   QRRSILAKYTRISKKGGGGFIQRMCLEQADRAVQNT"
FT   CDS_pept        complement(1250853..1252559)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3120"
FT                   /old_locus_tag="LmjF36_3120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3120:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3120"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A7"
FT                   /protein_id="CAJ09274.1"
FT                   /translation="MAGFGMAYSNVPQYSPGVLVGNWLEDIALREDQLKLYKAQRHAAV
FT                   EHPEKAATNAVARSMLASQLEEPTTVDAFKGDDVRIGQPYLLVNDKTQAALALDLMTGG
FT                   GASSQSQQYTLSGSLAPGPQVRSTWTLLRCKDEHNHSYNRNNSGVLHYGQRVRIANEKV
FT                   SAEGFLYVQSSLSSGLRSSEVQYAVAALNACADNVFVVSRAGTVREDVHFGFPVKVGDG
FT                   VVLLHSLTNLPLACNGERVATSYGMEYAVTCGYTTDYCSRSRGAVVVKPENVFYFSGGD
FT                   GTDAVLMRPRASSRHQSRSSAVLTMTAGTGVMTLLEHIRQGALEIGGRIGFRSLSIALG
FT                   VACNEQRQRRFLDRNELRKAIARLGVLLSPIETDVLMRHFDTTGNNVLCAQDFLAELRG
FT                   TMPLARMQAVIYAYQQLSIEGRGSVEFKDMRSLFCLNAATIPDVVDGVLQREEAVLDFE
FT                   SCWPGRLGYKVGTVTLDEFVEYYADVSPAEESDERFCKLLQQSWAIPVTSAYLSGEPHR
FT                   LLTVTYDDKPTETVRLPDSLVLDTQDRKAVKRLLIQRGLRGVKDFTVSTDM"
FT   CDS_pept        complement(1253498..1254298)
FT                   /transl_table=1
FT                   /gene="CYP10"
FT                   /locus_tag="LMJF_36_3130"
FT                   /old_locus_tag="LmjF36_3130"
FT                   /product="putative cyclophilin 10"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3130:mRNA"
FT                   /db_xref="GOA:Q4Q1A6"
FT                   /db_xref="GeneDB:LmjF.36.3130"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A6"
FT                   /protein_id="CAJ09275.1"
FT                   /translation="MRVWVLAPHSLPPASFRPIFEARPPSSPTHSFHLLPTPIYLYITC
FT                   TDAVDLYVCAVTSLLAEWTTTMFARSTIRWAAGAGHAFMDIAIGSQPPHRVTFELFTKR
FT                   CPIASENFLKLCTGENVLPQVSSIDGIGEPSFRDQFLPQLTYRNTTVHRVCKGYLVQGG
FT                   DIVSGQGTGQLSIYGESFDAPEEVKASKFDRMGLLGTAVSAPHLNGSQFFILTADKAPH
FT                   LNGTCICFGRVVDGWTVVKAIEAIPLTAAGEPAERVVVVECGKL"
FT   CDS_pept        complement(1255263..1256012)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3140"
FT                   /old_locus_tag="LmjF36_3140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3140:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3140"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A5"
FT                   /protein_id="CAJ09276.1"
FT                   /translation="MASVDTQWAIKSILQLGHHHLRHGAETTSSSSSCLVRPTSPPFRS
FT                   ASKAVQVTAMPRLMRASCDPSYVILLAKRPSGIAGVSLRPGNRVPWTGLPAAASSLVSA
FT                   PCSKKTRLLASYLQRRGFATIRPVATDTHSSPSQFRPVQRSMPLLLHTSHLIGWKLNDA
FT                   SPAFPVYAHTLAELQQLRSSDVAALKPQHCLIANEYCEWDNWREVLGEPGWDLFSADED
FT                   AVERLLQDGLAISALEEEAGLYPVEVL"
FT   CDS_pept        complement(1256968..1258224)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3150"
FT                   /old_locus_tag="LmjF36_3150"
FT                   /product="putative ADP-ribosylation factor GTPase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3150:mRNA"
FT                   /db_xref="GOA:Q4Q1A4"
FT                   /db_xref="GeneDB:LmjF.36.3150"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A4"
FT                   /protein_id="CAJ09277.1"
FT                   /translation="MNIRQRKSERHKEVLRKLSQNGGNKNCFDCGMRGPLYVVSDFGIL
FT                   VCSGCSAVHRSFQHKVKGITMSEFTDDEIARFSVSGNDRARKVWLSTFHDQLPRSGNVM
FT                   ALKDHVHVVFEERRFWSAQELSALQDSWEHAQGQPSHAPPSLSVTRPAESPLASVPEAP
FT                   TAQPGPAAAPTSPVRPPQEDAFDNLFSAPVQPSSTPQPTAHAAAPPLPPMTTSHAPTPP
FT                   APQQPATVTSIVADLFAGVPPPVVQPAGGYSAPHPQQQQQKQSMGYPTDGGMYNFTQDP
FT                   QSSMMAPTQLQSSQLPSQQQQPQPFTWGQPVPAQLQQQQQQQHMIGLLGSSGTVAPYAT
FT                   PAQSQSYNFKNGAPGAAAYPSANGAPAQAYQPSPFASNPPPPQEGGGASFIPNHNRIVV
FT                   LSVTKQQNDGPQNPQPQWQ"
FT   CDS_pept        complement(1259183..1260190)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3160"
FT                   /old_locus_tag="LmjF36_3160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3160:mRNA"
FT                   /db_xref="GOA:Q4Q1A3"
FT                   /db_xref="GeneDB:LmjF.36.3160"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR027684"
FT                   /db_xref="PDB:5AJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A3"
FT                   /protein_id="CAJ09278.1"
FT                   /translation="MEAKFLKLRQEREEQRRHRSKKTGAITLQRQQYEAEAELLEAEVM
FT                   QLLQEGNVTESQQRIDALRTLVQDTSNSISLTAHEMAKANVILARLQQRVDEKCSGAAP
FT                   KKFKFSSRLKAKPTSDAEPATPSFSPTGTSDTNEATATATVPIAGTVSSTNGFGNVYGP
FT                   STGTDLFISHSKGVFINGCADCAIYCLPIAGSAFLSNCTNCRVYVACHQLRLKGCTNLD
FT                   LYVWCASTPIIEECDAMRFGPYRCWVGLLSSCTEDGKTYATHAEWVSRVGEIEDTARTE
FT                   QNYVKVDDFQWVKKRASPHWCVLAREEERASTTVFGPATLPSSSTAHSTVAADH"
FT   CDS_pept        complement(1260926..1261960)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3170"
FT                   /old_locus_tag="LmjF36_3170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3170:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3170"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A2"
FT                   /protein_id="CAJ09279.1"
FT                   /translation="MSSDDECPELISARVPVTVLTGFLGSGKTTLLHYILSADHDMRIA
FT                   VIVNEFEFGKTIEKGLTLKSSEKPDDEWLELNNGCMCCTAQTQTVKALESLMEHRGTFD
FT                   LILVETSGLADPGPIAAMFWQDLPLCGHLYLSGIVTLVDAVNICRYLDDEDVMREAERQ
FT                   ILMADKVVLNKCDIATEAQQKAALAAVREINPVATVIPSDHSRVPNLRDILFIDTTRAA
FT                   TELVHLHEHHHSSISAVSLEFFEAERAFAVSSYRDVHAIGSDLLYRCGDYGFEVVRCKA
FT                   AIWCCEDGQYRLLQLQSIGDLFDVTPMVGQSVPFGCTRALVLGKQLDEVKLRDIFAKYL
FT                   KATK"
FT   CDS_pept        complement(1265533..1269738)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3180"
FT                   /old_locus_tag="LmjF36_3180"
FT                   /product="receptor-type adenylate cyclase a-like protein"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3180"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3180:mRNA"
FT                   /db_xref="GOA:Q4Q1A1"
FT                   /db_xref="GeneDB:LmjF.36.3180"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015232"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036310"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A1"
FT                   /protein_id="CAJ09280.1"
FT                   /translation="MWQPPRLVMNRCKGSSTRPSVTPVLLLLLLVLCAPASAQGGSLRN
FT                   SLDVECVLLQTTESSTVALNALDVTAQKASITCARKSLSSPLAWAPTDGSGSTLNVYMS
FT                   ALSDTLLSSVVAASSSTSCTLVTSISEGVLDTRRMSKNVYFTNADPATEMLALLSYVMI
FT                   NGAPPKIGFVYTRTDDEETSAGAAVYKEFVRRMDELAYTGTLVTYEAAEDYDSATFAAF
FT                   SKKFESGVSVVFFFPSAGKGTNDMFAELLKSSREVKVLMPSWLIRTATSRYLVATKPKV
FT                   PASSIIVSSTNPHPEDKNFEKSMGQFKKDYGNTKPTLASSSVDGIEAVAGWITARATVA
FT                   TLQYHTLWTESPTQKLYFDMLHKQHVYTIGGDIVLGAYGSSCNVGGRMVLLYSLRAMSS
FT                   GETGAYYGLASVPGANLMLKSWECHAVDVTLSISKMVRAAYVKYHGIGENSNYMTTQMD
FT                   NIVPAAMVSATFTEATIGPLDSLADTTWKAALDNSPTIAVFGAASVGVDKSPVEKVLVE
FT                   PVFLQPTLYQNASNVVYLTATNEQQLGAVATWVAQSAVAPDVHAVLLNSGASATAMQST
FT                   LQRIMTHAGVTVESVKTLGVGEKLSSKDLPKSGLVLLTGIMQNDIYTLQKHIQNNQNAR
FT                   VILLFDEVTQWYRQIKQAFAASPSSGKRLVFVTNLPPWTPKKQDISRISAEFLATAIGP
FT                   DYHSPASMRGFLAVRALSMLSYNAANPSTSALLDALYTQQVLQIKDLTLGPFKRTGCAY
FT                   STGSNQVECTGVLNGGAGGIYIWSYSDMEGGTNGPIAGPYVVNLFGYVDANDEGSSSSG
FT                   KAHSSSSKSTIIASVVVCVIVMGVVVAAVIICVLCTRDSRDNRNAPKDENEHVTLIFTD
FT                   IESSTALWATAPQAMSSAVALHHKLIRQLVIKYKCYEVKTIGDSFMIACKQPFAAVQLA
FT                   RDIQVALHQADWGSTAIDDAYELIGKPSGGTDPGECGSRPWSGLRVRAGVHYGLVEVRF
FT                   DNVTKGYDYYGNVVNTAARTESVSCGGQVICTSSVVKALTEEEQGMVQFVALGPHQLRG
FT                   VAEPIEMYELRTVPGRVFPSKGSDVSANPLASLTAGAEADAAPNGEEVDPMLTQEDTFA
FT                   EVATGVEPVAEVLDVYFSAYTNNQKIKFLQKTCKCFCLPSPPRRMFASNDAYLNSLMLT
FT                   VATRTSAVINFRHRKLENDTLRPAAESQANAPALELVAHRDAAAELRRHSSVFFSGVDS
FT                   PVAGESKRRRSVVIDRPGASLSKHGNSDSTMMLVLDNGELLTLCSSAGQSCTEKLPEVR
FT                   EATKVYQNGAPSISGDEVTPCFEGGNGLLFRIIDKATKRWAFYNDTVDFVMHVYFSVGR
FT                   TSAVKWGPSVAGKVTQAEETSRYEGELIVPPLSTEVLMTGRVNGYTMRYCAMPSSGGE"
FT   CDS_pept        complement(1273598..1275298)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3190"
FT                   /old_locus_tag="LmjF36_3190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3190:mRNA"
FT                   /db_xref="GOA:Q4Q1A0"
FT                   /db_xref="GeneDB:LmjF.36.3190"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q1A0"
FT                   /protein_id="CAJ09281.1"
FT                   /translation="MPPAPPPALLPIEEPPIGTQPAAHLASGTTSQNTSSNATGGAVVC
FT                   DNCKTRGHLRRNCPKIKCNLCKRLGHYRRDCPQDASKRVRSVGGAPHEEVNLDEEYRWS
FT                   VCRNCGSSRHIQANCPVRYQALECYQCHQLGHMMTTCPQTRCYNCGTFGHSSQICHSKP
FT                   HCFHCSHSGHRSSECPMRSKGRVCYQCNEPGHEAANCPQGQLCRMCHRPGHFVAHCPEV
FT                   VCNLCHLKGHTAGVCDNVHCDNCGRNHETVHCHQPYLAPVTHDRVSEERSASLPSEHDP
FT                   SSADQSNNSATPCDSDDGGSNRGGEPRPRTGVSCAPVVPPYIPLDGPKRDGRVAIVVDG
FT                   SYFERCVAVRRNRSDPTYYRHITDALLYTIDYIGDIFQCEPFAYWFDTDTAAFREFVET
FT                   SMPLAHRENAFREASMRKRYLTDEMNSGRSLPNVVAKLVGGMKRQRGFTEDGPGHVWVQ
FT                   TGVDVATATCVIELFQDRRQFRQVVLLCGDADVYPAVQYCNTLRRSSHQHADSNPVRVC
FT                   GTSDSMSKIYGQQQDLTDFLPRLLLDCPLHTEGGRTIEFPTSKVFMSVR"
FT   CDS_pept        complement(1276549..1279392)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3200"
FT                   /old_locus_tag="LmjF36_3200"
FT                   /product="putative DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3200:mRNA"
FT                   /db_xref="GOA:Q4Q199"
FT                   /db_xref="GeneDB:LmjF.36.3200"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q199"
FT                   /protein_id="CAJ09282.1"
FT                   /translation="MPTWLNVAEKPSVAKEMAQSLSGGNCRTVPSQSRFNPVYEFKFEG
FT                   KTMLVTSVAGHLMEDQFPPNTKNWSTYPFQGLFSAPITKYVRADLEPVKKNLEALAGRA
FT                   DTLVLWLDCDREGENICFEVMQVVQSKRPQVQVKRAHFSALTARDLLNAVHNLKLPDKR
FT                   LSDAVEARQEMDLRIGAAFTRYQTVKFRHLFAAIPGVLSFGPCQFPTLGFVVRRYWQQQ
FT                   GFVPEDFFTLQLQHGDTKFHSSRGSMYDQVAATLIYEDMLLAAAAEGHKGRITNVQQRP
FT                   SHRRPPVPLATVVMQKLAATHLRIPSERCMALAESLYQEGLISYPRTETDSYTFQESEL
FT                   LELVRVQISNADVAEYATAMLADIATRVRPPLRGGRDDKAHPPIHPTKAWNATQDERGR
FT                   LYNLIVRHFLASLSPDAVAATTQVSAEFGGELFSTGGTTILQRGWLDIFPYERWNSTCI
FT                   PNYQIGDAFQPTAVPLKKGCTSAPPHLTETHLISLMDSNGIGTDATIAQHIKTVLDREY
FT                   VKREGQSLVPTTLGIALASAYESLGLASLLQPQLRAQMELAMGDIANGAATKEQVVAAA
FT                   VQLYEEIFSRLMANTNAFYEELKRYLQPEVETDACAVQATVVKANFIPCGTCGRLMDLV
FT                   ERAGERDREVWSVRCHACNKMHRVPNGRLNTLEPVSPPHTCPLCGFLALRVANREKQTS
FT                   YHVCPHCFGSPPKAWSVTTYGCVGVAASLPDVEAAAEFRCFQCTADCPLAKGLEAIGIT
FT                   TCIACRQHELRLRSGANGFFLSCRGYPSCQLRVSLPAAASVKPSPSQRCPACSAVLLTF
FT                   DFSGRQGVPGLNMLDTICVRCDARIKDYIAVKGMPTSGANSSAVPSAAASVASTASGTY
FT                   TLPSVKPSARRSVRGGGQRGGRGGDAAAANTPSGGVDPVCGCGTPAKQLVSRKEASRGK
FT                   RFLTCANRQCSFFQWLD"
FT   CDS_pept        complement(1283014..1283790)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3210"
FT                   /old_locus_tag="LmjF36_3210"
FT                   /product="14-3-3 protein-like protein"
FT                   /db_xref="GOA:Q4Q198"
FT                   /db_xref="GeneDB:LmjF.36.3210"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q198"
FT                   /protein_id="CAJ09283.1"
FT                   /translation="MTETIKWKNVAIQDEVVPRPSDIKLPDDLAELIYMAKLAEEAERF
FT                   DEMLLCIRKYVRLNSELDTEERNLLSVAYKNVITPRRNAWRVITSIESRENAKENSATL
FT                   PFVVNMRRELEAELSPLCDDLLSLLDTYLIPAAQGGEAKVFYLKMKGDYHRYYAEIDSG
FT                   DGQRQAALSAYQKATDVANSSLAPTHPIRLGLALNFSVFYYEIMKEHEKGFQLARQAYD
FT                   EAVTELETLDDEAYHESNTIVRLLRENLNLWTDDQL"
FT   CDS_pept        complement(1284554..1286206)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3220"
FT                   /old_locus_tag="LmjF36_3220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3220:mRNA"
FT                   /db_xref="GOA:Q4Q197"
FT                   /db_xref="GeneDB:LmjF.36.3220"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q197"
FT                   /protein_id="CAJ09284.1"
FT                   /translation="MASYSELLQTCAEFQENFSALTGKYNALSLELKNTKAVCERKQWQ
FT                   LDEAAAREEQQRKELLKLKKEVDDAAGLRERFHAAAVATEHLKSQLACAHQSAVDASLE
FT                   HDQEVQQLKQQLEDMIKRVETAADGQRLREAQRQTLELEERCATMHAQLLEDRERHSQQ
FT                   LLTAHNALREQQSRNLELEQRCRAMEADLAEMRAAVRRSTELQNEAALLKERFSTAATV
FT                   AQHQVEELRAEAEEARRRLAQLKADHQAQMAQVAQDAAEAREELHERVASLTADLATAQ
FT                   SNLEEERSLYRKMQASAEEKVTQARNASVVEASALRCAQAALKEENTRLQWRLEKMDGE
FT                   LREGQQALQALQSRHDSLAAKLQQSQGQLDTAAQQEAWLTCEKQNIADQLAVARQQLDV
FT                   LNKALMNHEEVTLQVQQLTMRLANSTEEAQSHRCAALLCESQLRDVEEASALKVRELRR
FT                   ELKAYKKQCANEAARADRLRRKLMTALIEKEAELYRVSRATGRALTLEGEPATIPASGT
FT                   VLHDSAYSDVIGMLRNQSQQAEDLHTRLVQLAR"
FT   CDS_pept        complement(1287880..1289490)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3230"
FT                   /old_locus_tag="LmjF36_3230"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3230:mRNA"
FT                   /db_xref="GOA:Q4Q196"
FT                   /db_xref="GeneDB:LmjF.36.3230"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q196"
FT                   /protein_id="CAJ09285.1"
FT                   /translation="MSKAYDIIVIGSGAAGCAAARACALRHPAASIALIEQGSRAAVPQ
FT                   VMRIPLMQPYIASVRKARPFLQTLTCVAEANLAGRSLPFTLGRGLGGSWLCNDMKYMRG
FT                   TRKDYEGWADASWTYDTLLPVFKILEANSRGRSRDHGEDGPLRVTDAQRSNIDSGMNVL
FT                   FFEACEAAGVPATNDFNAGEADGFSAMQSYIDGGARVQAFHALIGGTRPRTPNLDLLDE
FT                   TCAERIHCTAGRVRAVEVSHRGDKRLLEARHVVVCAGTLRSPLLLQRSGIGAKGSVLDA
FT                   PAVGQNLITTSAADLVFRIRNSSNVYSKSISWRNSSYLYRQWREYKENRSGVFSAFVEG
FT                   AAYVRSQLQQDAPDLSILFFRTPQMGMVHWPMDGFTMRVTHHYPSSRGEVLYDGSKGTT
FT                   LIRSGMLSTREDVLAMDEGVQWVGLLTTRDGTLRSVNHVDEKGRHVSPFWSYGAALHHP
FT                   RDGLITQCGTAAFLAEHVKSGGDLYGTCAMGTVVDSQLRVKGIAGLFVADSSVVPVPTV
FT                   ASSSTLGSAIGARVASFIH"
FT   CDS_pept        complement(1290129..1291055)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3235"
FT                   /old_locus_tag="LmjF36_3235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3235"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3235:mRNA"
FT                   /db_xref="GOA:Q4Q195"
FT                   /db_xref="GeneDB:LmjF.36.3235"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q195"
FT                   /protein_id="CAJ09286.1"
FT                   /translation="MDSLYFIGKAQFHQLATHISLYHEDMSDGYKHLSTDAVMAVGLKP
FT                   HKFTYWNVPMMSGYLGKTVPLDIHGGYVMIDEEKVMPMATSYGMLRYALLTSAVRAKEG
FT                   GRWRYDFMTMNSTLAIGTAAGLGLLSFGRQRIGWIRRHPIGSVMASFVACLTTTVIARQ
FT                   GIKALGIGIVQAQNSHKRALNCLHCVDCLEDVNTYTLKQIEELKAQQIPQQAGMPPPPE
FT                   EYVRRFKKGVEMQCRLLETDMEEVRLIRKWAGASLCDVHQHLRDDPMGYKEPHGLVLLA
FT                   SDRARAAERPPLATMPDDKKGIRPAKS"
FT   CDS_pept        complement(1293798..1294673)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3240"
FT                   /old_locus_tag="LmjF36_3240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3240:mRNA"
FT                   /db_xref="GOA:Q4Q194"
FT                   /db_xref="GeneDB:LmjF.36.3240"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q194"
FT                   /protein_id="CAJ09287.1"
FT                   /translation="MDDVHASPLERDNEQVAAAAKATNSTGVRRRRMNEVYPVMKNTIY
FT                   SDGECEVVVVLTSWDCGMRFIRYISDLFQYFVRNPKAMGLIFTTVIILLFFKYAQQVVV
FT                   KAVNAAVRAHSGLEPTDTIRSAFTSFTEELHALERAAQTIGWAYMRDSVEGYDMGTAVV
FT                   TAFSSLVRNVQLSLMANMRTCVVRAFPAAASTVFTSRHWGQIGGTPNETNRSVCFCVSK
FT                   DSTVRQWDTVSNTGDGGPLMSRAYVEQCMPDLLSVATTATKGSALAASGGVDAGLHDMQ
FT                   YLPAKGLAHD"
FT   CDS_pept        complement(1296223..1297770)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3250"
FT                   /old_locus_tag="LmjF36_3250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3250"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3250:mRNA"
FT                   /db_xref="GOA:Q4Q193"
FT                   /db_xref="GeneDB:LmjF.36.3250"
FT                   /db_xref="InterPro:IPR013176"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q193"
FT                   /protein_id="CAJ09288.1"
FT                   /translation="MALTTSSDVAAPLISLAVYCPLLCADKEKHGADNILFYFPSDTHL
FT                   NLQMNQVGFCIAISSLAPLFGVHCSRRQTIRKQRSSVCLMSPAEDLWVSAHVRGGNEAA
FT                   LTTHHLLQLSCALFELLYSADTVLRLTLPDMEKGRKEGPPAGTGSSTPSTPTTDKAVSS
FT                   DTAARPALRSFFTRCATFISSVLAAQCKARDGATERMGRSGAAMSAQDWAHHLSAEAAF
FT                   GFPLRFVSDRELPSLQLGRVEEVVRHILWRPVDGCTAGPDGDAPSSLGRDSVHCCVFDL
FT                   PSLHVVMADSRLPRVVVQSLKYYLVLYAPIACTSFRCHVPPGGLCEAAVWLDGNVVVVL
FT                   VDMHEDETASVGVRAVSPSLMEHARIISSAVRQLLSKPAAGAISVEAKDAYWLSTRDVP
FT                   THQLYYKLTLKPPIAASSGLVAHWRLRGTVVEGTPFRQVVPGLVEYLRVLVHSTKLCLP
FT                   SSTSTSVLEYWTRWNSFWVYLRFAGPTVTALAWQHQQHATSVRQLAYEAQHLLLVAP"
FT   CDS_pept        complement(1298489..1299073)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3260"
FT                   /old_locus_tag="LmjF36_3260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3260:mRNA"
FT                   /db_xref="GOA:Q4Q192"
FT                   /db_xref="GeneDB:LmjF.36.3260"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q192"
FT                   /protein_id="CAJ09289.1"
FT                   /translation="MLRSTGVSLYYRATAELDRLRGMLRGRARLERKVGLKRITFLMRT
FT                   QTRYRVEQKAHWERAIVRKNVDSAAHEHGSGWQHLRNDLARQNLMLLPRTQQQLAQYEP
FT                   LAFRAVMELCASRVAPPPPPMTAQVPEEAYATRPEDPKVAHPAARRQLEECVERMLCTG
FT                   RSDVLQREGPRTTQAWMDAWKEYDLGSAAQK"
FT   CDS_pept        complement(1299978..1300367)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3270"
FT                   /old_locus_tag="LmjF36_3270"
FT                   /product="putative 60S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3270"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4420"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3270:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4420:mRNA"
FT                   /db_xref="GOA:Q4Q0X2"
FT                   /db_xref="GeneDB:LmjF.36.3270"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X2"
FT                   /protein_id="CAJ09290.1"
FT                   /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLG
FT                   NFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKDLR
FT                   DWIRILATGKGTYQLKYFNIQDQEE"
FT   CDS_pept        complement(1302242..1305754)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3280"
FT                   /old_locus_tag="LmjF36_3280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3280:mRNA"
FT                   /db_xref="GOA:Q4Q190"
FT                   /db_xref="GeneDB:LmjF.36.3280"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q190"
FT                   /protein_id="CAJ09291.1"
FT                   /translation="MLRRRVSATPSLAVSPAGPSSLSLTPSPADSQQRRSLKTLDVREY
FT                   RPLGTPIEFRFYQRYANHPNRQSGVQFLTHYNTHQRFRVNKDFIDYMHWGKEQGQARLP
FT                   HRHQRVAFDFDDSLQPTRAEGAVGAWFAGQDPTMRSHPDISASFDPNKKLFSHPEHWNK
FT                   MFSKRRPGEGDIKLNVIPSNSLLGPMVTQTDTQDMAYFKTETCGPTHGRVPGINAPFKG
FT                   EMDRKMMQAMSRPLNRSCTLTGNNGRFSNTIFINDPKRHQTLSATLAKELNREVDRATN
FT                   GLYSKLTVLTSAQSGLTDFFCGGTDLQCIGFDLTMAQLLRKEADALTKSAASGSKKVEA
FT                   KVHELLRDAERYEERADSVLRENAAVIWRAYTSPRALMTLVNGKCRGTGCGLALAAKYA
FT                   GLQDASEFIVDGPNVGLTPYSGMTRLLARPETSLKYPGLAEFVMLTGASLFAGDALRLG
FT                   WSDLFTSLPDMPYHIKDWFDSTEHMHNDAVAWQLGHLLEKCFQMKDRWHTSAMERCAMT
FT                   PIRARWVEDAFADQSSIEEILKTLSAMEKLPLTDRHNTYDPSYATPYTLASVAEGVEKL
FT                   GASRLRYTLSPWDATPPEEAVEVRQAAEIFTSYVLERRGKVNIVAHRDRHKVQAWQKQR
FT                   EREYVAYSNMKNAPHRRHVYVRLEGCEGTLVDFDFTIDPAGDAAAAAAEKGAGVDDRNE
FT                   LVHTASVERLKRAVLQAMGMPADRDVDLCWYLPTLDTCPIRNDEELVDVLHSDPGFEDP
FT                   SAQLRYPPIYFLVKRNTLHLSEWAYAVKHQLLLQSPYALKATLQLLQEVRGDGSAKAVR
FT                   SLADTLATEYRYAARLLKRPDFYQVGQHVDKSPEEWDVVKEERMRYVHKAHLPTRPLPD
FT                   YEVVFERNVQLDGHTFQLRPRWSPRTVQEVTAESLAPLATPLDFEKDGAVEFNVVVHAS
FT                   KADRLAGMIEDAGGFEVVAHLGEVDKEGNAKVPPLHGDAHVPTNVNFYEMARHPWEDTP
FT                   SSTRRDGFTAGSKEYFEQQYKKAEKAVYDEAGRGQRNYWPSKAAVDGVTGEESNALLEE
FT                   RFFAKLRDAERGVESWARQLRKKAVEGKLDNKPEIATQQEKIYDDDYYRWFIQPGHNPN
FT                   PSGLLRGRKVADSGSSSVDKDLEVFLNQLLSGAAERGADGTTGDEGEALSLPEEDTDEA
FT                   ADST"
FT   CDS_pept        complement(1306700..1307530)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3290"
FT                   /old_locus_tag="LmjF36_3290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3290:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3290"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q189"
FT                   /protein_id="CAJ09292.1"
FT                   /translation="MVSYLEGQVTRDGRKRAPRHLFGTNYRKPFPWIRVGLGLAAMAAA
FT                   ADIVYRRMSYVSPQEQFVRKIKIRPYGVMGTQMTLQGSLRQEGPKPDDTMVITDPCDLM
FT                   HIFTSAAGATGTSGAIYKWVGLTKAFPHDVVMAMSKVGDAKHHQYGLKDSEAGEQHVIH
FT                   VSAPDFREGIWSEREAAIELSRAYRNVLHEYVVSECDTLRMVPLSDGLQAGPLYNQLPA
FT                   ITHSALLMGFEQLHLFDKEYVLRDEKNIELCVFMNREWDMFNNAFENLPVGPTG"
FT   CDS_pept        complement(1309800..1312259)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3300"
FT                   /old_locus_tag="LmjF36_3300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3300:mRNA"
FT                   /db_xref="GOA:Q4Q188"
FT                   /db_xref="GeneDB:LmjF.36.3300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q188"
FT                   /protein_id="CAJ09293.1"
FT                   /translation="MSRAREVSQKLTYYGGITLPNIPRIAPDEKSRQKYLSEYEKYEPE
FT                   LRRHHLGDAETTNTIGLKDVPPDFDRTMPSLLDPTAAEVEYERAREGRKARALRKGHRG
FT                   ASARVAQAAGMVNPTPPARKSVSPQPSQIALTDEEPAQKGTPSPSSPSSAAGTPTTAAT
FT                   AAPAASEEAARLTPVEADGTRTWDAVVVEAAPAHVPQPPSERSHPMTATATTPMSQPRA
FT                   RTAPSLKPQQDGTRLGKRTGTSPAASARAAKPKSRPRAQPERATTPATAPTTPRRLRTP
FT                   FAAHEPPTAESTARVLRVLLDPPQQYASSLHLDLSSFDLGWLRNGQAAPRHLTTIANHF
FT                   NDNGASPQLRINSPRSVIAFLENGASPKDWDPRSSATSASAAALGGATQDMAAVQAEVH
FT                   EHRRAYVQAQRDAVRRTLQDSYSVLCARVPFNELVGWYRRLCEADMLADAALAQQHSLA
FT                   TAVQQLQERQRQVFETNKIRMMRQMQQAKELQERQEASVQRKLQVEAEAGELRRQKALE
FT                   EQERRRLQQARLEEHRAERQRREEAYKQLLQARLNRAETCNAERMAARERQLQAMQQRR
FT                   EAQEAERLRRLERSTAALEEKFAAEEQKRREKAAKLEQLRAAREARLAEERRALAEKQQ
FT                   RAAYLREEAKRRSEEAEEAVRREALQRQQHAEERLREFQSRRHEEAAQRAVAVAARHER
FT                   CNEIRSQALAKEELLKATVEDKHRQSEEHHRERQSRQLTEFMWRREANWEEEEAKTYAV
FT                   LQLQRIAEFNKLHTVVDLLEKRKAANAVVRQRELICEKVMRARDELREGRAVLKQEVER
FT                   SSQETWR"
FT   CDS_pept        complement(1313675..1314898)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3310"
FT                   /old_locus_tag="LmjF36_3310"
FT                   /product="putative actin-like protein"
FT                   /db_xref="GOA:Q4Q187"
FT                   /db_xref="GeneDB:LmjF.36.3310"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q187"
FT                   /protein_id="CAJ09294.1"
FT                   /translation="MTGVSASIQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTRR
FT                   PRPTLLQHPFDIATGDAAYNDGGLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPD
FT                   TSPFLFLVPADQTRLDRERLCELLFESFNIPLAGLLTNTAATLYSSGRTRGLALDSGAG
FT                   RTCVAAVEEGYTLAHSVRSSSLAGEALTDELFAALRAGGYPLSTAADRGVVEAAKEALC
FT                   RVSADAKDEEARQVGTHSHPDPADGFILPDQERIFLLEHAYKVPEALFDSTYLTYTTAL
FT                   SAERPTTPTGYSQSNPIVKKTLSGWVGMLRDAADAAPRILEQALYENVVLGGGSTLFPG
FT                   TEQRVQREIAGIAPKGVRATCVAFPERGAAAWMGASIWGCSSVFPDTCLAKATYDEQGS
FT                   SVVHLYTQ"
FT   CDS_pept        complement(1316163..1316627)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3320"
FT                   /old_locus_tag="LmjF36_3320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3320:mRNA"
FT                   /db_xref="GOA:Q4Q186"
FT                   /db_xref="GeneDB:LmjF.36.3320"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q186"
FT                   /protein_id="CAJ09295.1"
FT                   /translation="MLRRSAGRYMKPFLHAFSPGARASEKGMLYRNSYMNAHAQVASIQ
FT                   STHRTRRERTIFLLLLLPDQVFMCIIVFATGCVAVAVLFRQQPFSTNLNKDRWLSGGMN
FT                   PHEQYERNATMSQIFEMHKEAIDNTRAELTRPQVFSAPSGYHSPSGVYTP"
FT   CDS_pept        complement(1317913..1319139)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3330"
FT                   /old_locus_tag="LmjF36_3330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3330"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3330:mRNA"
FT                   /db_xref="GOA:Q4Q185"
FT                   /db_xref="GeneDB:LmjF.36.3330"
FT                   /db_xref="InterPro:IPR040193"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q185"
FT                   /protein_id="CAJ09296.1"
FT                   /translation="MSTYANSQARLNRVAPQLRPAGVHGDWTEATMAELLSSYNPNGII
FT                   TPDHIRSFHHRGCDVGEQRRHWGLAKDAPVDPNMRHGVKGKETGGADACLRPEMYADKM
FT                   TALLDAQLESQYLSNRRKPLGHAPVPRDPVPVPFGGFGITQKKGDSTQSVLAGYRSVDV
FT                   LHPAGEQLTRNYDWEKAGIDPTQHRFGKPSARSDGTTAAALFNDSATQLTSKLAKDYET
FT                   TVAKELGKSKRYGFDDPAEWDEEKRGSVTKFGATGTAASYFQTEQPTVRELLSSWAQTA
FT                   SGPRADKAASGKAGQQGLTGSADSAVTAKADASAAAPVASGPSLTEPLKDEARAHQLLY
FT                   PCHYVSLGVESKYFAGGRPLEDIRRLCHKCSFGLSDADIDAVFVLVAKGGSTCSIEEFK
FT                   NAARARGYM"
FT   CDS_pept        complement(1320420..1327997)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3340"
FT                   /old_locus_tag="LmjF36_3340"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3340:mRNA"
FT                   /db_xref="GOA:Q4Q184"
FT                   /db_xref="GeneDB:LmjF.36.3340"
FT                   /db_xref="InterPro:IPR027272"
FT                   /db_xref="InterPro:IPR031334"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q184"
FT                   /protein_id="CAJ09297.1"
FT                   /translation="MSSSREFITTGGGPAPISRRCVATLHVLFFVLATISAVSLRAPIW
FT                   LIGGLVYCSKHRNALTGQHLFPLRLWQVLLASLVTSAVCSLVANLVTTLQRNTAWVQKA
FT                   VWRTLYPLWALLGVQQWDAADYVNTIVWPGATAVVLGAYLLILKRTLAGRVLSRNDAMR
FT                   AVQDRPVPSSLLPRWAGMALAAHRPAAKPLLSLFSWAAAWTAEPSLVGLCLEIFTFVFV
FT                   AAFLYVEHRIRKPPRRAVQSGKGAQRRIPHAFGTAVAVVLVGVCVTQNSAFFFFTNARG
FT                   DWCRLLGMGPAALDTVAGLRYAMQMVGMAGVFLGAAFMHHGTESSESTLPDSGADAAVP
FT                   ASGEATPLLAAMDQRVLATPAPDASLPSTSARGEGLPNRHRRTPQVVAIVCITALLAYA
FT                   VYYPSLVSTAVWLLHLCCCAEGLVQNPMAPPSAHRIAIACVLAVLCCTILVQYVFQALA
FT                   GNPRTAAWGQWSPARPAYPDDGCAVGAQVVAEHLIALLFGVYVSIAGVSDTGGGGNSAR
FT                   EGAEPAAPPRSSLVSRVGFSTEANAHFSDSVQVTWLRAQLSDAAGDQKQMRYLFQVAVG
FT                   RSPRTIELDAICLAAAQQSGGSSPIASRGGLTVEEVTQLLVSGPFYTYAVILCMFVLGT
FT                   SSVSMDLLHATCLVVSLGVSVIGGSAMLYRRVRSVPPMCVAVVVGVQLCYTVFAAGDEK
FT                   QRQQPHQLIPRGAQPSFLKAALGNYVSLTALTWEDCAPYLCAQLVLMWCSRYTPKWLTN
FT                   WTHIAQCLAFRCSWARFIRTVYQVAGAVVLAWIVLLLPRSASVTGLILLLFTVALLQHL
FT                   RLHRLAYVWRRFFVVGYCGVVLMCMLTAEFQPVQPRLWRLLRALGCPPGSEGRCAQDIG
FT                   LPADSAMWLTPLSIPWWLIIVLATATARLHPLPSSLPSSLAAAPATGVPEASTPWFWRA
FT                   LVWWPKVLSDVLSIAILAGMVHAALQRPSILAALYLVGPGLGVFPCWTLGVAAVHAALQ
FT                   CVYQLWFSPGWLDAQTRLGVSPAQLLGLWRPLSAMGSTPNLPSTLVVAAAPLLVGVAQS
FT                   LQLQCALLARRRERDTVAACPGRVSMWCRLQRTCATHLYMLLLWVLLYLTQKIALGWGV
FT                   GVLIMMVWISAEVRSCGVLQRRRWLFAACGSATSVLMVLAYLLHWLHTVFPWWSALAMY
FT                   PYLFGGSINEDKTMTALQSVCCAAAAACVVLRVSSGAPRGNESEHLLCHSHTPSFLDWL
FT                   RRHSGQLRENHEDISASLSEMPPDEIRYFFRDVAGVFHCDEEVAEEADTSPLSRGPAPR
FT                   RNGGVVVSVVRLMPLVACGSVAVGSATASPPCVLRAALLLAGLCLAVRHPRLHWSCWRW
FT                   WRLTVALYALLPLIALVAACPCVRDAIPKLPPWVGLLIGWSVDASHVDGNALVFSHWHV
FT                   MLFLCLWLQSCVYNCPQSGTALLRQQGEERLLSETRHAALQRQLLSHMANATEKTVRVD
FT                   QEVCSYLNALRAGDDMVFTCQVCQRRSSEHVEENGDEHDSDAERVRVSMPSPPSMTPVL
FT                   EPEEVNKVLDDAVELPRPPLTFPAAAGRNNVPTPSYDQAQPPLLRCWQQRCVLWLRWIC
FT                   DKLAACTYHPSEYRLSAVVADSSTSTLWLLSQYALRAAAQVVLRHTSFALLGCSVVNSL
FT                   LTGCLWELIGLCYVVQVALAYHPHPPRVVYKALGVYLGTGMLLKEAASMWTFFGNANPS
FT                   LITALSWILLPLKGQGRSSRNSNQMWANVPYSRGALRYDMLWMDLVTIGVIVLYDRVCI
FT                   IHGVHVERDQQQSMERDRSDVMVMLEGPASSAGSASLSNSITAATTLLPSPSFLLLTPI
FT                   SHGTSIIGAFRALVADYCQNLLTVPGVGEDWYIFYTSVDSLALLMVAVYYSRIAGSNNG
FT                   TLQDHVQNNLLPGPMALLICVSVLQLVMDRMLYVQRSMRLKALANGVCAISYTVFYWWW
FT                   RNAVTVSEHATGNVYFALKVVALVLSVTQVCRGFPVHRRRHIFTTHLGSLLSYSFTVYR
FT                   SLPFLWELRTLVDWTVLRTSLSLQEYLTVEDIYVYIYQCRDRYLEKHRNNEKLGDAVAP
FT                   LSKWSFGVSRLALVLLALLGPLLYYSTYNPSTVANSATQLNFQLSFFGTYDFFATTVRD
FT                   NVTTPEGWWTWIERTRPTLGSYGFMAEGKTVQLMEFTSCSSSLWMASPQAVRQVLAGLR
FT                   AAASNASSAYMLQTLEVSRSVSSTDAAMAASLVNHWPIPQDTAQDLVAILERETSGARG
FT                   AAVVDSENSSSSVVVGSASLPFFYSPFVFNRASRIDKLTTSLHFPHRNQHNCTLELNHG
FT                   TDITLNSRVRYWCLRCAPLFPEGNIPSENSSSAAEWRCLTTGEGCDDFNYEDAAGGSGS
FT                   RTVQASLAAQMNSGVTAKQVSVYMVIISDTVVMGISLLKGIGIVALYTTFVLALGRLLR
FT                   SVLTNQTSTLLYSNMANPAALQNMVRCMEMAREYGDLRLEHTIYLELVDLLRSAERLFR
FT                   VTGPLRCMYGDAGHEDLFGLGQVRRRNIHRNPSVEAREGEAGEGHGDSGVPAAVPHLAH
FT                   GG"
FT   CDS_pept        complement(1329201..1329788)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3350"
FT                   /old_locus_tag="LmjF36_3350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3350"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3350:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q183"
FT                   /protein_id="CAJ09298.1"
FT                   /translation="MLRLTQAVLRVQSHQKKRAQHPNAGTRFGRVYNRGFVRYGFGGFG
FT                   MSVYSSKKDRTFKVMPVPPPPPATTAVEQRDDFADNRGLSATTRTLSPTFRMFALEDGG
FT                   VLVSHPSHAQIMRWNQRVHTEEGKAANSTVMDEYVNSRIQAIIADNTIENTSLSQWRKA
FT                   HMWNVIKSHGKLQRRWGTPDFVMGARSTLYNN"
FT   CDS_pept        complement(1331543..1332214)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3360"
FT                   /old_locus_tag="LmjF36_3360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3360"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3360:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3360"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q182"
FT                   /protein_id="CAJ09299.1"
FT                   /translation="MASQPGDALGKIEYWVQYIDCALKHPRPLPAGKHAHRQSLETIPE
FT                   VAELYHCIYKLYNEEESSVWFREPVNALAQEIFTYYDVVKSPMSLRHILDNIVKGDTYS
FT                   TALQVMEDVELIWKNCITFNGANSLLATEAGKCRSALDRIRRAYQDDQRITVEEAERLF
FT                   RVISSMQEQQLIDNIAEYLRRDDPTSIDETGAVNFDMLKRKHFRNLERIVDNYSKSRTR
FT                   S"
FT   CDS_pept        complement(1333310..1333618)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3370"
FT                   /old_locus_tag="LmjF36_3370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3370"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3370:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3370"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q181"
FT                   /protein_id="CAJ09300.1"
FT                   /translation="MGLKRLAKAAKITSKHMLLLNRREPYKPVTSDRVMIENRRRLEDF
FT                   EAKNAEGIVFVPDTALPPWQKSIATNLKQQATQMNFRGFRVRVADKQDEPGFPTHFR"
FT   CDS_pept        complement(1334685..1335101)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3380"
FT                   /old_locus_tag="LmjF36_3380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3380"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3380:mRNA"
FT                   /db_xref="GOA:Q4Q180"
FT                   /db_xref="GeneDB:LmjF.36.3380"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q180"
FT                   /protein_id="CAJ09301.1"
FT                   /translation="MFRRSSSVMRRAVSAFLKEPGQAKTFQETLAVCEAESRDLASMLS
FT                   SDFLLLQSKLFKYRIARLGEETRYVMKHPLGCLPSADMVLVHFVALPLVFFAAVCIGRG
FT                   SSRPLVQPPAAKMEVAAAAAATADAAAVAPEEQT"
FT   CDS_pept        complement(1335968..1336180)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3390"
FT                   /old_locus_tag="LmjF36_3390"
FT                   /product="putative ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3390"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3400"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3390:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3400:mRNA"
FT                   /db_xref="GOA:Q4Q178"
FT                   /db_xref="GeneDB:LmjF.36.3390"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q178"
FT                   /protein_id="CAJ09302.1"
FT                   /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNAR
FT                   RVRKHNQKAALKKRRERIAAFAAKN"
FT   CDS_pept        complement(1337345..1337557)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3400"
FT                   /old_locus_tag="LmjF36_3400"
FT                   /product="putative ribosomal protein L29"
FT                   /db_xref="GOA:Q4Q178"
FT                   /db_xref="GeneDB:LmjF.36.3400"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q178"
FT                   /protein_id="CAJ09303.1"
FT                   /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNAR
FT                   RVRKHNQKAALKKRRERIAAFAAKN"
FT   CDS_pept        complement(1338385..1339515)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3410"
FT                   /old_locus_tag="LmjF36_3410"
FT                   /product="short chain dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3410"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3410:mRNA"
FT                   /db_xref="GOA:Q4Q177"
FT                   /db_xref="GeneDB:LmjF.36.3410"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q177"
FT                   /protein_id="CAJ09304.1"
FT                   /translation="MRSPRLLPPLPFPFCQLSLSPLPCTSNTRPHPHAHMCARVALRPS
FT                   LSFFFFTDAEAAKHNKSTSSLSRLGMSRVAFAALLSLAVALLSRHVYRRVNRQRLQAGA
FT                   VALITGGGSGLGMELAKIFAVSHCEIVLVGRNEAALKAAAQVCREAGAPRVEYIQADIS
FT                   KAEGTDRVRSEYARLYKGTGRSLAPPLKYLVLNAGAGAIAPFTTEPAFEQICHAMMDIN
FT                   YFANVRLLQAFLPQLTQNHSSSSPSRIVIMSSLAGVLPSILRSAYTASKHAIQGFMNAL
FT                   RGETAVHITLCCPGYVDTDFHSRVLTNDGKLLGGNQRRGVSPAVCARQCMDGVLCDDAE
FT                   IIMTTGGKLAYRLRPFLTGIIDVLVKRKSLKSLEHH"
FT   CDS_pept        complement(1340104..1341189)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3420"
FT                   /old_locus_tag="LmjF36_3420"
FT                   /product="vacuolar protein sorting-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3420"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3420:mRNA"
FT                   /db_xref="GOA:Q4Q176"
FT                   /db_xref="GeneDB:LmjF.36.3420"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR028934"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q176"
FT                   /protein_id="CAJ09305.1"
FT                   /translation="MLRDELPPEKGQQSFSLWSRILRSIDGCKLEIVLDDQTEADKIKV
FT                   VDIYDKVSERFPLYSWKEPVKGRVVVTPTGSSYSHQGVVVELIGVASTFREVESRVVFL
FT                   RQERQFEPDTLNQSTPFEFTFSAPKEHESYHGIYARVRYFVQATVKQRIKSPSVKEEVW
FT                   VHRVDTALSESQTDASAHMNYFRETCFGPESIAMNVGVDNVLHIEFRYDKKIFHLAERV
FT                   LGKVEYKVADMDIAYGEVGLVRKEFLAPGQTDETMESETLQKFEIMDGTPIVEEVVPIR
FT                   LYLKSVPRLTPSYMDVENLFSVRYFLNLVLVNQEGKRYFKQQEIQLYRRTGQERSATSF
FT                   NSGLPVTPASGDVDAKGGWSA"
FT   CDS_pept        complement(1342557..1344935)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3430"
FT                   /old_locus_tag="LmjF36_3430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3430"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3430:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3430"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q175"
FT                   /protein_id="CAJ09306.1"
FT                   /translation="MPAKASGGVVAITSTDWEAQYERDFTAQKGSGPIIFSEEERRKNR
FT                   ELCSRLRDILPFDDAYKVSDCDLMYRFLIGKHWNVASTEKGMREYARLRKSDDLNNIIG
FT                   EQLHPTICSVLSPMYKGEPYPIYGLDKEGLPVLWLSPDANKLMAAMKDFTSEQLLRFQL
FT                   RSMEVSRYVCLQRRVDRCTYVIDLGGITISSVNKATLALLKGVMNLLQVAYPEIMRRLL
FT                   IFNAGWAVSAAWKVLRPLVDVRVQDKIKFESGPPSLAALEQYIAADQVHPSFGGTGSAN
FT                   VLGPIIDAEVRRIRRGVEGRVSPDPAAAAASVIHRPSLESRQSTSLLSRDALTLYSVES
FT                   TTPLSTACPSPNCNPSLAGSGHAEEREQVAIGVPSAVTAWLVKTSTASGPLNVRDMSLS
FT                   VASSSGEYACCREQASPTPAADDTTKCSYRGVASPPSRDTSADDTATSSRESVPIHATT
FT                   SIEPTAQQQAELPIVTISLTYGADGSISGYCGRQWVGCFQHGLLYAPATDDDDSAFPRR
FT                   SPSLLPSSQPYVAGGCAGRSVGVPAGELLAEAGHPLHTFLIVCDAQRRARYLVRESRLR
FT                   KRLTIYNVFGDAEVHTDKNNRHYVEGERAKLGVVVPHSNATSCGGKEDWMLYGKDVTKR
FT                   SSRNPTLPLQQFLSKTKRAVLTAKKSRSGDSLDKSQNSRWAASIFAALRFRAYSPAKRK
FT                   SKSISFKASGSANVPPPSLPDQSEKHCDAVTDDSTQLLAECKGQTVRFYKLLTKNSLPD
FT                   LFALAFAITQSWSNEMDSCKGEAAAPKETHYSSDDDVMP"
FT   CDS_pept        complement(1347834..1348484)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3440"
FT                   /old_locus_tag="LmjF36_3440"
FT                   /product="SNF7-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3440"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3440:mRNA"
FT                   /db_xref="GOA:Q4Q174"
FT                   /db_xref="GeneDB:LmjF.36.3440"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q174"
FT                   /protein_id="CAJ09307.1"
FT                   /translation="MPVFGNMFHRTTPEEEVRKWTRSLRSEQRKIELQITKIRREEAKV
FT                   KLSMKQAAKQNDQVVMRMLAKEMIRSRKAVNRMYASKAQMNSVSMQLQNQASQMKMSGS
FT                   LKKSGEIMKEMNSLVKVKEVQQSMMAMSKEMVKAGLIDEIMNDTIDEALDDDISDTELE
FT                   DEVNKVVMDVVQGQMDGARVGASRIPAQQQQQQETAEEEEDELMEKLNALRNS"
FT   CDS_pept        complement(1349576..1350433)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3450"
FT                   /old_locus_tag="LmjF36_3450"
FT                   /product="glycosyl transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3450"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3450:mRNA"
FT                   /db_xref="GOA:Q4Q173"
FT                   /db_xref="GeneDB:LmjF.36.3450"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q173"
FT                   /protein_id="CAJ09308.1"
FT                   /translation="MRTSPLWRLRMTSRPLSLERVFVINLDRRPDRWAAIQAVCARAGL
FT                   PAERTERVPAVEGSRLDVNAVHHCGFVSALGLRRLKEPPEHHIWGMDLNKAALGCALSH
FT                   IHLWARIAALGKVSNISAEAPAATLPKQCFLVLEDDSTFADSDDNGSDSPAASPSLPFL
FT                   DQLQRRMNSVPPDWELVYVSGLDTAKQCLHMQVAKGVARVPQYHRTTNAYLVTPQGARR
FT                   LLATCVPLTFQLDTAMTMNVGYPPGVVGVAGAQTLPHVLDPVCYTLQPPLMQQAAQLDT
FT                   DIQH"
FT   CDS_pept        complement(1351438..1352040)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3460"
FT                   /old_locus_tag="LmjF36_3460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3460"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3460:mRNA"
FT                   /db_xref="GOA:Q4Q172"
FT                   /db_xref="GeneDB:LmjF.36.3460"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q172"
FT                   /protein_id="CAJ09309.1"
FT                   /translation="MLRLCARHLGDAKSASHVYELRTYVVAPEKYDSFHQLSMKYMPQR
FT                   PCIGICQGCWTVQLGGVNQYIQIWRYENLKHRYDCRKQVEQDQEWLRTYVKPADDMMIS
FT                   KSNTLLRLVYREGNASTQSYKYLMQVSPHKEVELSGPSATLAATFQVIVGEEEGKYIHL
FT                   VKGHKLDDVIPVTPTLGCSSKIMGPVRWSSTMNCLWR"
FT   CDS_pept        complement(1354417..1357356)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3470"
FT                   /old_locus_tag="LmjF36_3470"
FT                   /product="putative 2-oxoglutarate dehydrogenase E1
FT                   component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3470"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3470:mRNA"
FT                   /db_xref="GOA:Q4Q171"
FT                   /db_xref="GeneDB:LmjF.36.3470"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q171"
FT                   /protein_id="CAJ09310.1"
FT                   /translation="MGRRRAAEAVPERQLLFDNDSFLSGSSAMYMDGLYQQWKKDPASV
FT                   DASWAELFSRSDLGNYNHALLDTPICVLPAKSSDEAVVKQSLADCGRLIRMIHTFEDRG
FT                   HLMAQTDPLNYVDTDVTERTPSRRYKEMVRLDLAYFGFSDKDLDRVVRVGFQNQMGGIY
FT                   DTSSPQLTIRQLHELLTERYCGRIGFELVHLTDGDAKRFVRSQIELKDGCSALHRPMSR
FT                   EERLRIWDTVASAVFFEDFFKRKYSTQKRFGCDGAESMVAGLRALLEKSSELGVQAINL
FT                   GMAHRGRLNVLCHVIGKPFEVILKEFVGVTGQELHPFQIQSDVKYHLGYRGQLKLNSGK
FT                   VMETEMLFNPSHLEAVNPFVQGYTRAMQVSLGEKGREKVLPIEIHGDAAFAGQGVAFET
FT                   MCISEVGEQDTGGTVHVVCNNQIGFTTDPKSSRSSAYCSDLGRVYNCPILHVNGDYPEE
FT                   VIRVFEFAAEYRARFHKSVVIDLVCYRRFGHNENDDPSITQPLMYERVRAMPDVFRRYT
FT                   DALITQGILTPQQSTQKAIDEKARYGSYQEAAAQVNYAEYLKKSIPDKWKCMKYSDELG
FT                   NVTQHPTAITQETVDKVLKALKTYPEGFQLHPKLKAVLDRRNETIETGEGIEWGTAEAL
FT                   AFGSLLLEGHQVRVTGEDVERGTFAQRHAVIHDQSQERTYVPLAHISDTQGRMIINNSP
FT                   LSEYGMLGYAAGYSLYDPTSLVIWEAQYGDFANGATIVFDQFLSAGESKWNQQQSCIVT
FT                   LPHGYDGKGAEHSSGRLERFLQMSSEDVTTPAYSKEERAHRINWEITYPSTPAQYFHLL
FT                   RRHQKRNFRKALVIFFSKKYLRAPNVSTLEELTSGEFQPVIPDLSVPASQARRLVMCTG
FT                   QIYHYLNKYRETKGVKDVALVRVEELSPFPVAEVQQLLAEYEKAELMWAQEEPKNMGSW
FT                   AHVEPRIEDYTKGERELRYAGRSITAAPSTGYKSKHEKEQEIICEMVFH"
FT   CDS_pept        complement(1359006..1359632)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3480"
FT                   /old_locus_tag="LmjF36_3480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3480"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3480:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3480"
FT                   /db_xref="InterPro:IPR026714"
FT                   /db_xref="InterPro:IPR028124"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q170"
FT                   /protein_id="CAJ09311.1"
FT                   /translation="MTSFKDCLREVREAATEHLEGYRGGDTEKALQHIPREEALTTISL
FT                   VAIRLLEQELPKRGAGNDASQHELHAQLRACRKALKSHSARSAAGDEGTSDKKRRRTEE
FT                   STEAPTSSSYRGSATADRSGTSNSIELGQYASSDAFDQNEQKRMKFARLMGGAKVAAQG
FT                   TGGAGGHSRHNTFAASNAELKRMNANLESQFESAMSHKGKKGLGA"
FT   CDS_pept        complement(1360552..1361571)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3490"
FT                   /old_locus_tag="LmjF36_3490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3490"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3490:mRNA"
FT                   /db_xref="GOA:Q4Q169"
FT                   /db_xref="GeneDB:LmjF.36.3490"
FT                   /db_xref="InterPro:IPR021298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q169"
FT                   /protein_id="CAJ09312.1"
FT                   /translation="MVFVVVKGTNYPDEFTVERALTDALSSPEETSRGAADVNSPPHAC
FT                   SSLLSTDTIVPGIAHILNKRHHVRLMLMSAQELAMLWPQHQHRSDGAASTEARESRESE
FT                   GVLERYQALIDSLYTRLRDAKTPVLADEFDNAERELRALTATLYSSLCTHADGPEAAVQ
FT                   QLYTKYEDPDLDEDTRLVVYHCRALLDPEWKANERVKEDDAALWFCGKPMEATLAKYCG
FT                   RNEKSKVIVKVAPRKGPSPSCEPRMRYEDQRALYRAMCQRREAYKQLEDSELRDRVVQQ
FT                   SRSTGRILLGAAAAFGSRTEGAPTLTSLASGTSSPVTLCTDGLRPIFPRKEERELPIS"
FT   CDS_pept        complement(1362351..1364813)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3500"
FT                   /old_locus_tag="LmjF36_3500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3500"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3500:mRNA"
FT                   /db_xref="GOA:Q4Q168"
FT                   /db_xref="GeneDB:LmjF.36.3500"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q168"
FT                   /protein_id="CAJ09313.1"
FT                   /translation="MADPFLDAGNPLELEVTRLTQENRELRQENARLRARISLTATPSA
FT                   TASNAVSERSSLRRAADTAAVHVGTSPGAKPIDKPGGALSHRSTRAAEASTPKQHQQQA
FT                   VSTARIEEAVQRVKKELRGEVEKYQKAAETKASQMEQLKQQFELFVTTTCEREAAYELV
FT                   HMQVFRELEEQRALARAAQAQLEEQRLEAVEMRTALQAAAAAAAAPSKCGTLASLSPSP
FT                   PSKSEDVAVASSSSAARPAKKCRTGKTAKHADDGDKSNATEAQTTQEDVVEVQQEVAMP
FT                   APNVTPEPRQLRIVQGGAALRADSKASRLKRPRASSAMSVSSATRSTRMRQSAVALAQL
FT                   HMPASPVFAAASASSADGAVEVAVTSSSGTVATAFPAAASASSPARQAASDALGDLWAL
FT                   LARHTEATHGFLPLWQHLARLRGSDRLAALRAMISLLLHLLGPADATMPLVLPVPLSTS
FT                   VAAPPTSITVLATAIRLLKVQLESEEQQQRGAAVSRADATAQQCSALFHSLFYRICVAT
FT                   LRRWQMAEAEADAVDNWATALVHLYGFQPALSKLVQYTNSTIAYERTHLAHSWVTYTAQ
FT                   AIFAQCFTSSSTSSAEVAVARWRELCDSIGWSPHSLPLERLETAAARCVARTRVSLGFF
FT                   TAACAEEALLSLRLVVLYRGFDHMERIAALLEMPGVLPMVITKEIYAELVSLAVMDRSP
FT                   FRTADAIQHALHLLREYVQEVSPERCTSAEHFVSVPRLSHLLAALALLRVESTNTAATA
FT                   RSTETDSAICEAVQAGRQTALRWLQAQKVALNMVRQSAALARDRQLLLRDTVLGQRLLR
FT                   DASATVHS"
FT   CDS_pept        complement(1365798..1366358)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3510"
FT                   /old_locus_tag="LmjF36_3510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3510"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3510:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q167"
FT                   /protein_id="CAJ09314.1"
FT                   /translation="MFSSSTGAGAAAAAKPSAGPPSVALATVTVNEDPNIEVLLASKRI
FT                   QKLTRATDALIARDFVLREEEAILDDLEAYIISLESEVRKAEFQTEELRSRSSLLRPGK
FT                   RCAIAGENVELSALWNAYGSDMGYLVKRHSLRLAVLEKALATVSTRNPELPVPKPLPPP
FT                   PVTKTSKTMSAMRDMSQRQKAPS"
FT   CDS_pept        complement(1367512..1368291)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3520"
FT                   /old_locus_tag="LmjF36_3520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3520"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3520:mRNA"
FT                   /db_xref="GOA:Q4Q166"
FT                   /db_xref="GeneDB:LmjF.36.3520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q166"
FT                   /protein_id="CAJ09315.1"
FT                   /translation="MTAAAGAHGDDSHAHDDHRGHHGAATAPYERIKAPSMASEDYLDN
FT                   LPAFDTKKPMPKPRTAVERFTRVLQMQFGQDPDMPTLGYNTERKYHSLLDYLASPITPL
FT                   RPRTYVDSHTRPNPCPEEYWWASWRWPRTKYVNAKVPPPVDGKYTDYYHYLAFKNWLER
FT                   ERDVYVAHANLVHEMTSRCLVKEGQYNAAKNCRHLYHKGFAMSRMEELNQAMLYMAMTG
FT                   NAAIRETPYPENFVEEKRKIYDDWLYRTRMRKPGDAA"
FT   CDS_pept        complement(1370931..1373444)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3530"
FT                   /old_locus_tag="LmjF36_3530"
FT                   /product="putative polyubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3530"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3530:mRNA"
FT                   /db_xref="GOA:Q4Q165"
FT                   /db_xref="GeneDB:LmjF.36.3530"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q165"
FT                   /protein_id="CAJ09316.1"
FT                   /translation="MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIVLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNI
FT                   QKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FT                   FAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVK
FT                   AKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG
FT                   KTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHL
FT                   VLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEE
FT                   GRTLSDYNIQKESTLHLVLRLRGGC"
FT   CDS_pept        complement(1374746..1375861)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3540"
FT                   /old_locus_tag="LmjF36_3540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3540"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3540:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3540"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q164"
FT                   /protein_id="CAJ09317.1"
FT                   /translation="MSTSQPIVKPFIYLRIPSEDARPVEELHFNGHNEAELRHTLTRCF
FT                   RQSLLSDDQKKDMARHLADKASESAKKHAVKGNGDASAAGSGAEPPVDVEQQQAAMIDQ
FT                   YLEQASYEIIPVTMPMRSTQYIGTSLYIDDSGAFKDLPLNYRASKLAQREIRGDAFLLS
FT                   NHDDPALDEWGRVDCPLQRYEELYANPPQIAYDPSNQAQMTQAAMLRETETKKISLEDY
FT                   EKAQKAKEDGNRLFAANDLPAAVQAYSMTVDLTDGRRDLLPNEEAATQLRLSALLNRCL
FT                   CFTRLKKFPEAVRDAQAAAYLDPKSMKAYYRLTYALCGAQEYEAAAQACEKYAQLGGAE
FT                   EDVTAMRTAVAAGETEVKKAQKQIFSKMFRS"
FT   CDS_pept        complement(1377099..1380590)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3550"
FT                   /old_locus_tag="LmjF36_3550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3550"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3550:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q163"
FT                   /protein_id="CAJ09318.1"
FT                   /translation="MQLQSRAPEHFSTPFFSSPSSSVAYESGCSLDALERLVHFTGAGA
FT                   DACLYAVHPPQAKGTDSAALTPTTEGLRYWLNPSVRARPTTATCEITNLGPPFFASTST
FT                   AVLRISATPLFVDGRCFPTRCVVSLATSAQRLDGVSLRPVVVTEWNLTASGAAGVCTTT
FT                   VPLRTLYHLAVLISSSAPATGVEEVRLYLHLRFMGCSDGSDTHRIAAVRLRYEQLGTAA
FT                   EVLPQLLQRRQRAAAHVMLPSPYDVKYHSEGRFTRAGAPLEEVEVGVIAGSSTATSSGR
FT                   KDMGDDAGKSLFVGAKERRTHTSPPSSTRMRSDGCEDAAAESAAAVAASPPRRSATRPR
FT                   AERLLSADRDSSSRIEAVGVTEGRDGPKLVCVDRALRIPPPPPKLSAAAGSAPSLLSGP
FT                   WPPRKVRTIVLAPSISPSLCSSSAGTSPRGSPSPLPSPPPTTNADSSAKAHSNTSLAGT
FT                   ARCREAESCDREGFEDAVDALMPLTQQNVQGRFLEPTKPDERTSSPVSDAGTSSQRRHC
FT                   HESSSVPRHIPSAEAQEVSQAVAESCPDPHLHPFAPQQLYAHSDPAVLWAATSLLGTLP
FT                   WTLASQHQSRISTPAVSVASSRAPSCDGSAQAMSTDSAKGAPCWQMRQLTPSKSFLDSG
FT                   SCAHRRDTRETQQRSWKRTPLGALDPNTSFHRPERTTVTAKADLAAMTRTFSTESTTAF
FT                   LQHWRRNESAHASPQLHPPHPFATASPSTSHPKPFSRPSFPQPATTYAPLQRPTSAFVP
FT                   RLLLRSRQRSNETRAASSTQRGGGVITTNRSRSIGSSSATTATAASAPPPSQNRSLWSK
FT                   AAAPSGASSSLDARPRRSATADVHERRRLSTAASPMSSSAVLSVMSSSWLQSNATVTPK
FT                   TPSESAAEMKSQSSTASQRSFRSSTAPPSSHRPQHVPSPTGAAATERMEDAVSVASGSS
FT                   APLPPSPLPPPEGCALFHSPAPTHSSRSSSPSSSSSRACAAPVLPLQEAHDGNRNRNRP
FT                   RQRSITQSGSGHGSNNSSAFRQFVVQTFAVWKHHASRRGVGRRWLRIERLPPSPSTSAA
FT                   ARFRITLDKAHPPVLARASMLLGRSSSSSGNNSDHAANPSCEVCIRRTDTVEVWCGLRA
FT                   YHSGVIHQRKVHRAECCLVIRCNAQLVTAVELESTEAVDTVRRLLSDRRCTPHAKM"
FT   CDS_pept        complement(1381572..1382750)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3560"
FT                   /old_locus_tag="LmjF36_3560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3560"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3560:mRNA"
FT                   /db_xref="GOA:Q4Q162"
FT                   /db_xref="GeneDB:LmjF.36.3560"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q162"
FT                   /protein_id="CAJ09319.1"
FT                   /translation="MRNKEATDYYRALPQNELSKEDMWRRINEASADRAEATGTAIGSA
FT                   EVDYIKLEDELRDFDLFHYRIGEMAYPDQAMRRDYYALWNLAMSLNKARWSMLEVHSQR
FT                   GMKTTGAGMKLIFWKESVGAVMEKRKMCTGEFTDSHPVLRPFAAAVERNPHMTKAFVRG
FT                   FTDARLRVIQQPGNVQQLFDHFDKFYGYFFNSLLEVTHIKDEATEHLMTHVGRATGLTN
FT                   HCVMFWKKYARLGFTMLPADLCADNHVNLGLLKNIPLASRDRAVRKVLFDVMCIVKDEM
FT                   LHAQKCAKDVPPKAWPIVMECLYANYYLGFLQRRDFNVSAMFADHNIENAGFTWYRLKK
FT                   RWEWERYQSIERLVDEAAPLPYINTCFTHRGSHYKMASGVGSGAPQAQRKRS"
FT   CDS_pept        complement(1387119..1388936)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3570"
FT                   /old_locus_tag="LmjF36_3570"
FT                   /product="putative signal recognition particle receptor
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3570"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3570:mRNA"
FT                   /db_xref="GOA:Q4Q161"
FT                   /db_xref="GeneDB:LmjF.36.3570"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q161"
FT                   /protein_id="CAJ09320.1"
FT                   /translation="MIDTLSIVSDSGVVLWQCTTHETGRRVMVNKLIQEVLLEDRAGLA
FT                   QYSVDDYQLRWALENDARFFVVAVYPKFFKPHYMHVFLRDIATTFAKKYGKQTAQQDFF
FT                   SSIQGSSNQVPAENLMEFSAEYAALLAKFNTSEEAASRHGVESEDRDEAACSGSSGAAG
FT                   EASDSGSAQGDGADDDFYRDNPQQPAAQNAGKVIVTKDGRRLTIGGGPGKGNASGASKV
FT                   APSSGAAKKRGKKPTRCDNPWAAHDPMVEKQLHQKKATEAELQAQASIHRETYIKRLPN
FT                   GGIAPVKEREWEGQSRGCLATWLRSYVGTREVDAEDLKKIIPDLREKLIVKNVAVEVAE
FT                   HVCKSVEASLAGKRLGTFDSLYKTVEDAMMASLRRILQPKCEVNLLRNVAAAKAAGKPY
FT                   SIVLCGVNGVGKSTSLAKIAYWLQQNGNSVLLAAGDTFRHGAVEQLGVHGRCLGVPIFQ
FT                   LGYGTDPSTVAAAAMAQASKQHIDVVMVDTAGRMQDHESRMRALAKLIHDNQPDLVLFV
FT                   GEALVGNNGIDQLRKFNQCLVDFAPVGSQLRGIDGIVLTKFDTIDDKVGAALSMVYELG
FT                   QPIVFVGVGQTYQDLKVIEPEVVVSALMK"
FT   CDS_pept        complement(1389910..1391313)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3580"
FT                   /old_locus_tag="LmjF36_3580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3580"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3580:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3580"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q160"
FT                   /protein_id="CAJ09321.1"
FT                   /translation="MHFSQYPLRLTDLERQKLQLIVAALKVSEYTDDVDDFMRPYGKEG
FT                   RMEAAMREFIDIVVGLAIASDAIPRSVKNSFLAGEVKVATVVPLLEDLFEIMRRHKRLN
FT                   PFSHRGEFGKLMMMLQDVQKRSLQRALEIQSTLVIPVRTVEAALSSIYCETLVDDEAVR
FT                   TDYLKRTGAEKQAGMQSLIERYGKGDEHKKEVIEHCLRSIDDVYSFIQSNTRPLRTLRR
FT                   WLSRDFEPLPSDDVYSISIRHGRSGACFTHSHATHCQYVTESLLLWENVQKNILNLWEA
FT                   AEDDMLVEGQGQYVVANTGQGFHRMCSAPKSYGVMSRLVRDTEQRMGGWVGIKVIHLGD
FT                   RDVPNPLVFIDKYTVIPRLVKPVVQTLHALRYVLHEEDEEEEGQPQVAHEYDNYPGLRN
FT                   LLRSKYHSYSELMMMILSDFFKHAFDGSGDDGGSCIDGRLTSAWNWCHQLHKKKYYDAF
FT                   VLTGFAGFD"
FT   CDS_pept        complement(1393412..1394413)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3590"
FT                   /old_locus_tag="LmjF36_3590"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3590"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3590:mRNA"
FT                   /db_xref="GOA:Q4Q159"
FT                   /db_xref="GeneDB:LmjF.36.3590"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:4AIR"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q159"
FT                   /protein_id="CAJ09322.1"
FT                   /translation="MAAPFDKSRNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECEN
FT                   PMASVKDRLGFAIYDKAEKEGKLIPGKSVVVESSSGNTGVSLAHLGAIRGYKVIITMPE
FT                   SMSLERRCLLRIFGAEVILTPAALGMKGAVTMAKKIVTANPNAVLADQFATKYNALIHE
FT                   ETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPMESPVLSGGK
FT                   PGAHKIQGIGPGFVPDVLDRSLIDEVFCVAGDDAIETALKLTRSDGVFCGFSGGANVYA
FT                   ALKIAERPEMEGKTIVTIIPSFGERYLSTALYRSVRDEVSSLPVVDASELQD"
FT   CDS_pept        complement(1395092..1396834)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3600"
FT                   /old_locus_tag="LmjF36_3600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3600"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3600:mRNA"
FT                   /db_xref="GOA:Q4Q158"
FT                   /db_xref="GeneDB:LmjF.36.3600"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q158"
FT                   /protein_id="CAJ09323.1"
FT                   /translation="MLHCVLCVCVCACMYGPYSEDHYAGPAKRHLCTPLTSSPCCVTHL
FT                   HMLFAHATPTRSDGAFFFFTAVVGAAHRLPPQTTDKRNSIARIPPPSHTGTHTHRKREQ
FT                   AAMSVDKTFGTFCAMSALQQRRDGLPVPSETSNSFSYYQWLEVAKAKYVESQPPASSSP
FT                   GQQRPPAKRAKTEDGVSDSGSALADGLAQQLVASLKSQTESGNSPAALHHAAQEEFPMP
FT                   QASADMPAFLALAEAALRLTLWTPEDERLAQLAARLRPNLRTLEERGIIRFYYGCFPSL
FT                   QVLMDLLSWRIIVHRWGRLASEMRQVAVDGVLTLCGCLDSVATAALRAAVQALPVSAAS
FT                   SSSADTLELKTLDTLVGHVSAAVPFQFATCRDLAPLYPEPAGLLHVPGAPAASSESVLR
FT                   DEQQSRPADEKRVDYDAEVQVGELLGVRCTPTLTVHASVEEESPTRRTQAAPVAALPSR
FT                   PLLKATRRTSGGIRPSAGVTQTRHGIPTRTASGHIACMSQFHARYVDPAKHASPECPYC
FT                   ATCHLMEIIFRGNKRSCLWGHWPTPRKIRLHLKQFPTVMKLAQERFAAIQRGVQLAATD
FT                   EVPL"
FT   CDS_pept        complement(1398879..1400483)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3610"
FT                   /old_locus_tag="LmjF36_3610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3610"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3610:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3610"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q157"
FT                   /protein_id="CAJ09324.1"
FT                   /translation="MECADTVLLIASYLTKKELMALSGVSHLCRKIVSDSFISYEEKKY
FT                   LVWPCLKDDYVELAPPSQILALGVLEKEQRLLVLVRSGTDTSRIDEMECYLYTQLVDDD
FT                   GCVVEHQKELPACFAFPSSLVHFSGNRYLLCKTREGDLHVFDCLIEAMVEVPVGTDGFY
FT                   ASPDGDHFLLDYNRHVFFCTASVHIACWWEMTPVDLKRHGGTYNAASNLPPSALVATHL
FT                   RAQIVPLPDPFSSCANSTSGNAPAHVDTTHPAPPLHFYLGTSSAAWRTFWMGSSSALCA
FT                   NEDGVSLLKTGNYPEMVAERLTSLSPSCSDFVDRSCGDVYGTPCKDRDEYAVMNCREVR
FT                   LHTVSYWPNRRPTTEVRAIDLNAIVPSRATIKSVRIAVSRVTYLVYMQHQGLDRVLLLS
FT                   SDLTLTRWISIGHSSCYVLWRQQVSLVTASLSDGAGDNFHPLVEAVEGGLGCVYTFGMR
FT                   LPEVSSTAAADPFVTTVKVTSAVDGGVGPAGAGRFLILPHSITGVEALSWMAFGVVSSS
FT                   LLWTVSALCYNGWWLHL"
FT   CDS_pept        complement(1402403..1402714)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3620"
FT                   /old_locus_tag="LmjF36_3620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3620"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3620:mRNA"
FT                   /db_xref="GOA:Q4Q156"
FT                   /db_xref="GeneDB:LmjF.36.3620"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q156"
FT                   /protein_id="CAJ09325.1"
FT                   /translation="MQQSLIPGHNNNRHLTYDEVENNIGGLPVTDNRIQDLFDSLDVDH
FT                   SGTVSVEVVKKFYMGLEHYGVDLSDKELDEMVRKYAATHDESLSYEEFACFVLSLAQW"
FT   CDS_pept        complement(1405224..1406096)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3630"
FT                   /old_locus_tag="LmjF36_3630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3630"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3630:mRNA"
FT                   /db_xref="GOA:Q4Q155"
FT                   /db_xref="GeneDB:LmjF.36.3630"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q155"
FT                   /protein_id="CAJ09326.1"
FT                   /translation="MHRVFLVRSSDAMATTTSTDSDVDCNHGVWNATTLTCDCDAGWNT
FT                   DWLNQDVLGGNYVYCNSQASTPPPSNSSAATTSFLADKSILIMIVALAVVLAALCGIVV
FT                   FYCYWKRLRRAKEEAKGAQIVAAANEEAGRQEALQLQQMQEAALQQQLWAAQLEAQRQN
FT                   QALLNHLVSMSTMPAASSSQLSASSRHRRHWHEMLPRHQGEVAYACDANYEGGNSLAET
FT                   FDGWGSQEPLVQCPSSYRRGAPLSTTDGYNNYSDILPSYYTTTTTEAPRREAHSPPPYA
FT                   QLASRHPPF"
FT   CDS_pept        complement(1406576..1406941)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3640"
FT                   /old_locus_tag="LmjF36_3640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3640"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3640:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q154"
FT                   /protein_id="CAJ09327.1"
FT                   /translation="MALVISDEATREAERILACSNSFEVLELSPSNCTKEMVLEQYETK
FT                   ASLFKGLFRNKLAMQAKAKLGNAKVRLADAQLREKEAAALKVLQSDVHKDYAELQALEV
FT                   RTRVLEMRAATIQGEAA"
FT   CDS_pept        complement(1407462..1408640)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3650"
FT                   /old_locus_tag="LmjF36_3650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3650"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3650:mRNA"
FT                   /db_xref="GOA:Q4Q153"
FT                   /db_xref="GeneDB:LmjF.36.3650"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q153"
FT                   /protein_id="CAJ09328.1"
FT                   /translation="MQEIIDTVNRYTLRSAAFRDKPTPGLAARQFLCSLLLHRKLDSIR
FT                   LSSIARYMFSTEALIAVSRDGIQTISCEGNTLWPICTIPNGLTSEISGVAVTPEGTLVC
FT                   SSNGICYLEGENLRVAEDCASSSYAQNVLCISCTPDGRYIATGGGTATVTVWTSDLKPL
FT                   HHFAGHTDWVRFVKFARGRSPALQLFSTGDDGVICQWDVLAGSLISRVDYSLGESIQLF
FT                   EVSYYSGLMAISSGTSLIALYCPQSDNTTRAVGEDVLRLQPMALITGAHEYTPTAGKFT
FT                   DDSQWLASASEDETIALTYVLDPQTCFVCKKFVTRRRCFSFMNIFNSICILAAPPVSSV
FT                   IVIAACSSDGTVVQWVVDPRTNRASYTKKLQLHLGSFLGMDLIPGDDLNHLL"
FT   CDS_pept        complement(1409103..1409696)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3653"
FT                   /old_locus_tag="LmjF36_3653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3653"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3653:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3653"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q152"
FT                   /protein_id="CAJ09329.1"
FT                   /translation="MLWCTGPRRIVFHNAPSVYPFTKPFHDTPYDQDRGRFDKTKNILR
FT                   ENKWPAWMDHGADGTGFGIGLNRTHPLSKLRGNLRRNPSEIPRVLNMMIQGVWHKSGNK
FT                   LYFRGGKPPNPSTHPYLTGEPCPVYGWKVTDPGVIREFNLPQPEDKTRYKPYVALQERK
FT                   IMGMQAPTKEHSAASTSAASTDSKPLMKRLFFWK"
FT   CDS_pept        complement(1410604..1412361)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3657"
FT                   /old_locus_tag="LmjF36_3657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3657"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3657:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3657"
FT                   /db_xref="InterPro:IPR011677"
FT                   /db_xref="InterPro:IPR040354"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q151"
FT                   /protein_id="CAJ09330.1"
FT                   /translation="MLQGLLCLLLLTTSAFAYPIVVVPVDWANVPNSTPEARNLNSPYL
FT                   GECVCDVTRGICDPFCCCDEDCDASARAAFSYCLPEKYSSPYLDYCYPKDRATSLKRIN
FT                   RKDATFIEKKLQGYNAVCVIRTNHPSELYRYFRVPTDVRQPLLPTAPIQPVTVSQPYAV
FT                   GDPLTTAKYVVVSGSPSYRRVAPLQLPTTMSDGSCSALGRNVGFLDSIKGTSCTLNGAQ
FT                   ICLLFPLAKYQNLFLQATLGYNSSAPEFVPVTLNLHDSSGALLNSLGPTVVPASSTYAT
FT                   ISDGKTCNNAIVDLHAHFSYSSNKSGKLIEAALNVTLRNVGLTQYVALSFEAAFTSENV
FT                   ALPNNIFAATPGYLPGDKIRSGTLITHGGKSTILERKSGFAVPAGGRLCGSNQWRRASF
FT                   LHSIISSGCLVLMSESDLQDVCSAGTGRLLAGLINVTVDGEPTILDQIGVTNDALTNDT
FT                   TSWIAISGLSNALTSPSGTYNAYTRQCSNITVGLHYQFVVARAGAEYNPQDIIVGAFAS
FT                   PIIGTLQIWNETNFDENALSYQQFTFKVSFSRYDPNSQATIMRRVVAPPILPPLDDSIF
FT                   YPFRRSHPV"
FT   CDS_pept        complement(1412672..1413340)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3660"
FT                   /old_locus_tag="LmjF36_3660"
FT                   /product="nudix hydrolase-like protein"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3660"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3660:mRNA"
FT                   /db_xref="GOA:Q4Q150"
FT                   /db_xref="GeneDB:LmjF.36.3660"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q150"
FT                   /protein_id="CAJ09331.1"
FT                   /translation="MKHTYVRTGLEVVSGLKFTRLCSLLYTATDDGAQPGNKWEMVQRT
FT                   TRSTALSAFERSPAPIPVDAVEICAVVRRSSKRFIVVVAQYRPPVDSVCLEFPAGLVDD
FT                   NENAGQAAIREMHEETGFVVDETDIVSISPPLSTEPGLTDSCCVLVRLDVDGERAENQK
FT                   PKQHLDDGEDIEVLLIPISQPKNALNALSDVVKRYAEKGQRAIVDAKLYTFMEALAWGV
FT                   "
FT   CDS_pept        1414163..1415185
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3670"
FT                   /old_locus_tag="LmjF36_3670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3670"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3670:mRNA"
FT                   /db_xref="GOA:Q4Q149"
FT                   /db_xref="GeneDB:LmjF.36.3670"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q149"
FT                   /protein_id="CAJ09332.1"
FT                   /translation="MITSATRSFSFCSSTYHQKQSGTVVCLMKATSGRSPLLRMLDDCR
FT                   VLSCQRRWHLIKGDRKQNEELKKVEFAPTFERDQIIKSVESGPSAGSSTTGNEPMEPLS
FT                   KGLMNTMEETPYRVSWYDFQTVSPAKRFTYWVYRRLRDLPPEWQEYYRSMVYQEISASR
FT                   YVNQTWDCFMMVVDGYRKAKWVLRKYGVKVDESLIPRPYNNFWEETTHEERVWAHRRSH
FT                   QMKELQALQRDDDEAVFGASIMNRNEVSYTSIKNLQTGMQGGTPLHAHDLPAPKESELR
FT                   MSRQDEEMSSALMSSIEDDKLWNPVLRSRLHTQRQRAEAELYGFEDEYDDEAPAEIQRK
FT                   "
FT   CDS_pept        1415556..1416023
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3675"
FT                   /old_locus_tag="LmjF36_3675"
FT                   /product="putative calmodulin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3675"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3675:mRNA"
FT                   /db_xref="GOA:Q4Q148"
FT                   /db_xref="GeneDB:LmjF.36.3675"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q148"
FT                   /protein_id="CAJ09333.1"
FT                   /translation="MADLLSLQQITELKEAFSAFDADCDGSITVDDLEQVFSSIGHKVS
FT                   RKKLQSILCEADLDSNGVIDFPEFLTLVATKLNDPEEKELEMRRAFRMYDLGNTGFITV
FT                   PNLRFVMGRLGCFLTTEQAFDMISEADADGDGKLSFDDFRRVMTEGWGATP"
FT   CDS_pept        1416592..1419525
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3680"
FT                   /old_locus_tag="LmjF36_3680"
FT                   /product="mitogen activated kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3680"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3680:mRNA"
FT                   /db_xref="GOA:Q4Q147"
FT                   /db_xref="GeneDB:LmjF.36.3680"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q147"
FT                   /protein_id="CAJ09334.1"
FT                   /translation="MSGASVRIPIEKYDIYDVFLALSVLRKLPEYTRELEEGSSETLYR
FT                   IIDSSICTARWYYRRYSRCGAFVHLLNTYAECIAAKSSNPALRAAELLAAHTSQLNTPQ
FT                   LWQRLPLPIVASLLLAVICCIATVILIGIGDDCCRKVDVAALILSCVSVLCLCALFPLI
FT                   HASLKWRGYKGQERLVDRIVRMACDNAQNQNSYYNPLSGQIELTERVVVEDADAFLVDA
FT                   DTAHRNRRAIAKLLAEATEDEGSVILRSRGFPPAMIGLNAIYRHAIIIMTDFDGKVVMW
FT                   SDGAATCFGFSARDVEGNNIISLLYGERSVELYTTMTEAAVKKLDLSEKVLTMAHMGLG
FT                   TVSISATVVVSREAKSNQPVGFTLIGSVRSDELSQTQAVLHSFFVKELSQLSVKDSQFR
FT                   QIVDCLRWKNLRDLSALAMHWRSAHIRQLLSEVIKSRQRYVSVEVDPKVTELPPILCDT
FT                   VGVTAVLNRAFELFCEKIRVRVEQKHTTSAVYQLIVAYRHDMSGLNRNTLIDITRSAND
FT                   LGGIVVDCPGTLKLLLPFMVKDEAIQALKPQDAAAQKPIGHDPLIVLLLEKNAVHRHNI
FT                   SASIWSCGHSLRLIENVRKALQAIEELTDIGCAIVDVDVKGSDRVIEALLAKHIYIIET
FT                   SEALDGGAKRGDALLKKPISNEALRKELERATYKREEAKRAGEELLKRREVFGKVRNSP
FT                   WTQGRLLGRGGYAAVYEATSTLTGGKMAVKIIRVSGNFEERIDEFMNEIGILCQLTHPN
FT                   IIHYFYCERTETTLNLFMAMADQGTVADLIKRCPRLPENHVATITKQLLQAVNYLHECG
FT                   IIHRDIKPGNMLISQGQLKLSDFGTATTNIREGIVGTISYMAPEVVDGKPSGKESDIWS
FT                   IGCVVCECLQIKRSGDGLLGYGAPEEYPSDVSAQAIDFIKACMQRNPSERATTGTLLLH
FT                   DFIVHLDQEVSQLAEVLAEATPNEEGAKSPKARSSLSDSTVISWSFD"
FT   CDS_pept        1420244..1423462
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3690"
FT                   /old_locus_tag="LmjF36_3690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3690"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3690:mRNA"
FT                   /db_xref="GOA:Q4Q146"
FT                   /db_xref="GeneDB:LmjF.36.3690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q146"
FT                   /protein_id="CAJ09335.1"
FT                   /translation="MVAGQSGSTAQGSSPSLSTSLQEVFLRYDPKECRHSANGPAVEEV
FT                   RPMLGNRYFNMDHLALWKPSLLASLGETCRRAVYVNEYHALLCSRRLVLVNNKGRYIVF
FT                   PPFCDTLNDAYVERVSKTCTLVLAAVASGVHVALVRDSDSRKADTLQSAFCSTASAVAC
FT                   IHHLGKNFYGLCCENCSVEGLAITFDNTHSLHPELHANLLPSRHSWAQAAYGYLSPKRY
FT                   VHSLFDRHRGYLLMLSSRNVSLWLYSDETHLQLECSAALPQEAVAAIVPPLQDEYGETQ
FT                   VAALITSSGGRVPVHLCTTAGKRGNLRSLSVGELRGLPGGVTNTVVSLACACGSSLLLA
FT                   DQLTSSLLLVTRCEPFCEAPGSSTTHVVTQHFLGKPICGVGVEKSVRDGGSFLTFVVYC
FT                   GDSTIVRLGRMPRGQLLQRQFAASVTSGIDALSKLQPQARVVLLLDAVLSGLPISYLSQ
FT                   SLEPLLQPWAATVRGVRLSDGARGIIQHAMQGLSELSRLCLSFHYWRLTEELAQSRSRL
FT                   EKSCTVLTEVLNRGGWLDCPTRQRLEWDDDVLVRADGKLTDISAVDAQAEVLQLLLSSV
FT                   KNATTIAWLYDLLLQTGTTYRFPGRLEDLLWKSDPVTVQVSLCKDLLARHDKDITEKLL
FT                   QKEHVLPQRCRLAATLLSLVLDRALEPVMTYTRRHILDIVQYDLLSYTTDLLESSFPTS
FT                   QPRIRLLVYRYPYDHSVSSDILSMVEAISSTGDLYNTLVTILGDAACDSELSSVLLDWM
FT                   ECHTLADHRILTFAKVVVDMGLCVDPAHTLTGRFFSSVKQQANGNTQQAALRFAELARS
FT                   NLSVPLDGRLLAIEHAITAVPSDDNRLVQFLLLLQQQLASLIAEHLAVGKDLVFARGTV
FT                   EADLRALREHYVDENSLFELAGRYKVLGGCSIQLDLLKIHSDSPEVLIANALTGVLTFL
FT                   KAVGLSAPQAVQRVLREYLGTFQAPLPLFPFVEFLAFDGQSPALAIDELEKVGVPLPTI
FT                   FDTFMSLLDGHRNPLFPIGDTVLALGQLVPKISPAVQHICAAHLLECSRSMLAGEQRAI
FT                   ALTEEDVHTVKRIGDDMRKLSQRS"
FT   CDS_pept        1424866..1425450
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3700"
FT                   /old_locus_tag="LmjF36_3700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3700"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3700:mRNA"
FT                   /db_xref="GOA:Q4Q145"
FT                   /db_xref="GeneDB:LmjF.36.3700"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q145"
FT                   /protein_id="CAJ09336.1"
FT                   /translation="MLRLCLALRSASVQRKPHLFRIDLTSKHTPGHLYLADRAVKSTAA
FT                   DPCFVCLDNAMTCQTVDSNAAVVLRSCMTKGRELFQYGRMRFQGMSAALVFRHNHLVFQ
FT                   GIGDASVQALEMSLQHKDVFALLGGISPHENIPEWARAVEKAIAEGDVEYVAEEMLLQL
FT                   RCPTEGCTSVVAKISKFSAGLPEPPNYSHAM"
FT   CDS_pept        1433430..1434788
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3710"
FT                   /old_locus_tag="LmjF36_3710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3710"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3710:mRNA"
FT                   /db_xref="GOA:Q4Q144"
FT                   /db_xref="GeneDB:LmjF.36.3710"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q144"
FT                   /protein_id="CAJ09337.1"
FT                   /translation="MPPKKRSSRRLTLNAGEEYTLVGDGAVQITLQSGLLDVAGVMLDA
FT                   NRPYTFYLHTDRQTITLFTLEGAACMLSSDNRVDTHRGVARAGKLVQMTRRTILSAKRT
FT                   KVLVIGRPRSGKTLAAHTLCNLLMRYGTDKKSVFLMDLNAESNCLFAPGCVSCIQVSEA
FT                   PLWPGLTASPKLLPISLYAGAAVRPSASNVNSLLHYYDQLHETVMGYIQELSGAAAAAA
FT                   QQQSPSPYAPSLNETHSHVVVDAPAPLADLQEGVWYKKLIEILRPSHVVIVSSREDDEE
FT                   RWSTFLQEDVQRVLPDCEFLFTDPVAHPCERSSSRELLREYFTGTPFYSLGCSKVVVPL
FT                   KSLTFVEEASEGLVPGSADGVLMRVVHPDASFQALVCALSHAELLEEAPLAPIAGLVTI
FT                   VYVDEKNEEVAMLIPAAEEPLLRRLIIVPQSRYRDTLRMSSVQVTTMEEYVAV"
FT   CDS_pept        1435844..1437727
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3720"
FT                   /old_locus_tag="LmjF36_3720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3720"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3720:mRNA"
FT                   /db_xref="GOA:Q4Q143"
FT                   /db_xref="GeneDB:LmjF.36.3720"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034095"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q143"
FT                   /protein_id="CAJ09338.1"
FT                   /translation="MRASVRVRDTHTIGWRTRAKRAVERAIHKYVSDPRDNPLTELPMN
FT                   SEAYSKTHQQQEGSVRIGIRPGQSIEDYMAERDRKWLDQQRLIFEQRVKDDHLPTTKDG
FT                   LPFIGAGSREHYMDVDSANKLVHTPEPKDYEIDEETALLRRQLQVEKEAEYRKFVAEAK
FT                   RSDIAAKETCKRRLPHPSDPNYDPFKLTPGYRPQDSTALAQWLKRQRESGKSASGLSMQ
FT                   TKEGQERFYNEEKMATQYNANPFANRIETPRGMSTMRITAYSPDSVFINDREVIGSCIV
FT                   TEKGYYHWNVGSFEEVNERTLAVLLHMYPVPDVVFLGTGRNLHFIDEDLRIAFQKRGTV
FT                   IHCLTTPQACGHFGVQLSVSRRSALAIINPIPTNGYGVECFGDFVENDMFSLSDTQLGI
FT                   SPMRQFSPSLFRQNKVAEKYRATQGTGIGPQYHQLSDGRLVRPGTSHTKLLPMLEPGET
FT                   VDWEKLPSYYHWYPKEELHDYIENTTWREIKGRPTGEPLEKRLRKAITGGTFEKDEAPA
FT                   PDLMPWNSATIPITKFPHERNDEEIIVVDPKTGRIIGMERETYERWKRMMEERRAGLPE
FT                   SDPVEYDQERYVTNKDGVVFDLSKMKYRPIFEGRWNPRRQQSTGRTNPIMT"
FT   CDS_pept        1438844..1439389
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3730"
FT                   /old_locus_tag="LmjF36_3730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3730"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3730:mRNA"
FT                   /db_xref="GOA:Q4Q142"
FT                   /db_xref="GeneDB:LmjF.36.3730"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q142"
FT                   /protein_id="CAJ09339.1"
FT                   /translation="MLVIEGTNGPLFSVAESAAAIAYLSTHYPQCKKRGSGWQLSVEEV
FT                   SLLQAQLRRTGGVHFASADTKEQFEVLRKRYARDCVVYAALTTDHGYRLRHGSQFGANY
FT                   IGYQDVGTHGECLLFTGPLAELEQVRAVRIARSVGKRAMLVTVQEGDSGCSSTVTVTDL
FT                   MADSFADLRRPQKSCRKE"
FT   CDS_pept        1440236..1440742
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3740"
FT                   /old_locus_tag="LmjF36_3740"
FT                   /product="putative 60S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3740"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3740:mRNA"
FT                   /db_xref="GOA:Q4Q141"
FT                   /db_xref="GeneDB:LmjF.36.3740"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR038562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q141"
FT                   /protein_id="CAJ09340.1"
FT                   /translation="MSCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHT
FT                   PWVLGHKRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQRIV
FT                   KQALKEHSKMKLSHKRTANKKKSKQSKKEAIAKKISTKTVSKKKALAKKATTTRQPVGS
FT                   KLVKK"
FT   CDS_pept        1441482..1441742
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3750"
FT                   /old_locus_tag="LmjF36_3750"
FT                   /product="putative 40S ribosomal protein S27-1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3750"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3750:mRNA"
FT                   /db_xref="GOA:Q4Q140"
FT                   /db_xref="GeneDB:LmjF.36.3750"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q140"
FT                   /protein_id="CAJ09341.1"
FT                   /translation="MGFFDADLSYPTVRTERMKHKRRRLVQGPNSYFMDVSCPRCRQVT
FT                   VVYSHATTSVECKGCSKKLCRPTGGKALLVEGCGYRRKPDH"
FT   CDS_pept        1442435..1443079
FT                   /transl_table=1
FT                   /gene="RPL10a"
FT                   /locus_tag="LMJF_36_3760"
FT                   /old_locus_tag="LmjF36_3760"
FT                   /product="putative 60S ribosomal protein L10a"
FT                   /db_xref="GOA:Q4QDX9"
FT                   /db_xref="GeneDB:LmjF.36.3760"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QDX9"
FT                   /protein_id="CAJ09342.1"
FT                   /translation="MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKR
FT                   FSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVPTMNQEELKKLNKNKKLVKKMCNQY
FT                   DAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVLCLG
FT                   TCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY"
FT   CDS_pept        1444056..1444367
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3770"
FT                   /old_locus_tag="LmjF36_3770"
FT                   /product="putative basic transcription factor 3a"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3770"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3770:mRNA"
FT                   /db_xref="GOA:Q4Q138"
FT                   /db_xref="GeneDB:LmjF.36.3770"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q138"
FT                   /protein_id="CAJ09343.1"
FT                   /translation="MPITQEQLKRRAEMVRTGGKGSMRRTTKAHHKSTGDDKKVQVTLR
FT                   RLGVTPFSDIDEAVFYRQDGSTYYFSKPKVQASMQTQCFVVSGDYDVKSADEVDAKKD"
FT   CDS_pept        1446160..1447110
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3780"
FT                   /old_locus_tag="LmjF36_3780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3780"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3780:mRNA"
FT                   /db_xref="GOA:Q4Q137"
FT                   /db_xref="GeneDB:LmjF.36.3780"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q137"
FT                   /protein_id="CAJ09344.1"
FT                   /translation="MDAIKTYTYKSGAVYEGTFNGNMRSGRGHWTHPQGERYEGEYKDN
FT                   KQNGLGIYIFSETGKKYLGNWEAGQMNGEGLYFFNRDCTAYYFGNYTKDKKDGDGHYMY
FT                   ETGVMTTQKWNMGALLQEEETPPSEIVECAVKIKELMDAVRAVAPKELGEMPPPSEVRT
FT                   FQFPSGATYTGQYFGTKKHGRGYWLHPEGDSYEGQFDNNHHSGWGVYVIGRSGKKYVGH
FT                   WRNGKMNGIGVYFFNPQETEYYVGLYRDDVKNGRGMYHFAESGASMVQMWENGVLRQET
FT                   EADKATGKAYEEAIRKIVEVVKPYAPNYEPVTFGS"
FT   CDS_pept        1449509..1452340
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3790"
FT                   /old_locus_tag="LmjF36_3790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3790"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3790:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3790"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q136"
FT                   /protein_id="CAJ09345.1"
FT                   /translation="MRVISESILLGKAELLAWAASVTGISPCDKYGDLKDGLIYLALTR
FT                   QLFPDEIDNAIVRLQRRGTRDAAKNWSLLISCLRRHGIPTHLCSQQAVERGHTRYCFNL
FT                   LVLFYFLVRLARGHQFAVDFAQPVDPQLAAFLQSPESVLAVERRTDMGFSECSSSNTGV
FT                   FAIDEEESRGQADSGAPRSVTRLSSPPSVATAPTTATPAAPLRLPLRSTALSADTSSNH
FT                   LAPPPRWMRTHEQSSARAFQDAGAWCAPSRCSNRGTEASKHSPRGAFDSTLVHGAARAP
FT                   ATSGGELVMATLPPPSTLLRPFPSTACTPHLYTQNQLLREELQHVKAVSQLLLTQQRGS
FT                   EAAVEMRASATLHSQLAKAELDHLHAIRQLEVTLTAASVHDGGANAAPSPQQWAALAQR
FT                   AEAAEATAVQLYREYHESQQVYDSTLQQLRQVFCSIADIAAAALASVPTNSDSADAAAY
FT                   EETVTAAMMAQLTGVPAMRKDAFCAQMRALLLTLSSLRSSNARLQMDAASVPPYCGTGD
FT                   ASRDCASSFSVLHASSSLPFEQESLKTACAEARSACHGANPVVQRALNRLTRLVDILSS
FT                   ALDAAHQDRDRWEQRCRRAETATAEADEASQGARAEGEAQRQQDLAAQAHQEVSQSLCN
FT                   RVQEVLAMAFSTAGTHEVQWASDELVALLGAYVRERASNPAMEAALAEQAETIAALRAD
FT                   LRQQREAWERAEAQLSDGERRRQVLEHKSDALQAQLRSATEKLGTQRNDSQVHTATLHR
FT                   TLLEQTFTPSSAALASAPLAEPSAAPTRGTQEHIAASGAAPLTDASRHAESTPYRSTAH
FT                   SLYSSLHLPGALRSPATSDDEMDDAEERRLIDHHRFHSGLHNQHVSPSPSPSTSASLPS
FT                   SRATTAEADVPRGVTTERVVARAGLAAPTVSPARSLRSSTDHPSAASGPSLLLSAAELE
FT                   RRKQAILRKYDVA"
FT   CDS_pept        1453421..1454605
FT                   /transl_table=1
FT                   /gene="GCVT1"
FT                   /locus_tag="LMJF_36_3800"
FT                   /old_locus_tag="LmjF36_3800"
FT                   /product="putative glycine synthase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3800"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3800:mRNA"
FT                   /db_xref="GOA:Q4Q135"
FT                   /db_xref="GeneDB:LmjF.36.3800"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q135"
FT                   /protein_id="CAJ09346.1"
FT                   /translation="MSASLKKTALHLFHLAQQAKMDAFAGYHMPISYGRLGVLKEHLYT
FT                   REVAGIFDVSHVGQYEVRGADRERFLEHVTPVDLQRIRAGHGALTMLTNAQGGIKDDCI
FT                   VTKMADHLFLVLNAGCKEKDVAHMESVLRESAMKGADVQLVPLDRSLIALQGPQAAAIL
FT                   SEFMDDVPGMGFMQCRQRVNIKGMEVQVTRCGYTGEDGFELSVSNTDIVALVELLMSRK
FT                   AEMIGLGARDSLRLEAGLNLYGHELTEDINPVAARFMWVISKRRMAEGGFIGYEPIKYL
FT                   RDNASKGAVPRLRVGLVSTGPVAREKTVIEVGGKPVGEVTSGCPSPCLKKNIAIGYLDR
FT                   ELAKDGVKVDLVVRGRRVAAVVVTPPFVPARYYRKPPVKGTEERRTPTIKNIAS"
FT   CDS_pept        1458907..1460040
FT                   /transl_table=1
FT                   /gene="GCVT-2"
FT                   /locus_tag="LMJF_36_3810"
FT                   /old_locus_tag="LmjF36_3810"
FT                   /product="putative glycine synthase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3810"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3810:mRNA"
FT                   /db_xref="GOA:Q4Q134"
FT                   /db_xref="GeneDB:LmjF.36.3810"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q134"
FT                   /protein_id="CAJ09347.1"
FT                   /translation="MSASLKKTALHLFHLAQQAKMDAFAGYHMPISYGRLGVLKEHLYT
FT                   REVAGIFDVSHVGQYEVRGADRERFLEHVTPVDLQRIRAGHGALTMLTNAQGGIKDDCI
FT                   VTKMADHLFLVLNAGCKEKDVAHMESVLRESAMKGADVQLVPLDRSLIALQGPQAAAIL
FT                   SEFMDDVPGMGFMQCRQRVNIKGMEVQVTRCGYTGEDGFELSVSNTDIVALVELLMSRK
FT                   AEMIGLGARDSLRLEAGLNLYGHELTEDINPVAARFMWVISKRRMAEGGFIGYEPIKYL
FT                   RDNASKGAVPRLRVGLVSTGPVAREKTVIEVGGKPVGEVTSGCPSPCLKKNIAIGYLDR
FT                   ELAKDGVKVDLVVRGRRVAAVVVTPPFVPARYYRKPK"
FT   CDS_pept        1462413..1462808
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3820"
FT                   /old_locus_tag="LmjF36_3820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3820"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3820:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q133"
FT                   /protein_id="CAJ09348.1"
FT                   /translation="MLAKAPSQNRGLSPPSPSPAALHQLRCENAMLKKEKQFLTQAVAS
FT                   GPSTSARVNGARYNAGAVEAKLMMAYRMASEMRDAEGCKTVELQMQQRVAEMLAKVDKL
FT                   HQLLKMVQKDVEEVLAASGGWDRQAAA"
FT   CDS_pept        1464482..1465420
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3830"
FT                   /old_locus_tag="LmjF36_3830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3830"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3830:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3830"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q132"
FT                   /protein_id="CAJ09349.1"
FT                   /translation="MGCCCCYPSGFRAARQASSPLQRRPSSVEHRSFEQNVFHPAKQPA
FT                   KTRYICDLCGVEVDPTLLDGHQEVCRTNHLRTILAKNAALLSHASIRPSSSVKFHDDAA
FT                   SGDKELCLVCMDRPRSYAFLPCGHISCCQECTKSFDQCPLCRQPREGLCHVSPNVTAQY
FT                   ECKHCHELIAPTLFDGHREVCSLRQRQTQREAGEAAAAAGAAAVAVGVPVEAAENSAAW
FT                   QNSTKSMPSRSPPQAAVATPPNPMLSTATAPARNPTRSLSHVCLECGKTYGQLVVCAPC
FT                   GHRVLCYTCSQKRTTCPVCLSEIRDIIVAFD"
FT   CDS_pept        1469348..1471234
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3840"
FT                   /old_locus_tag="LmjF36_3840"
FT                   /product="putative glycyl tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3840"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3840:mRNA"
FT                   /db_xref="GOA:Q4Q131"
FT                   /db_xref="GeneDB:LmjF.36.3840"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q131"
FT                   /protein_id="CAJ09350.1"
FT                   /translation="MPAASSLPAKLEGFVRTEFEDTCRRRFFYGLAFDPYGGTAGLYDL
FT                   GPTMCAMKSNMLHFWRQHFVIEESMCEVDTTCLTPEEVFKASGHVTRFNDVMVRDTVTG
FT                   ECIRADKFLEEWSEAQLEKDGITAEQKDEFLHLLHDAAGMNPPQIKAVLEKHAIKSPKG
FT                   NPFSDPFPFNLMFATHIGPEGDRLGYMRPELAQGIILNFKRLMDSGNAQRMPFAGACVG
FT                   TAFRNEIAPRSALIRVREFTLAEIEHFVNPSNKNHEKFDRVRDVEIWAWPRHFQASNED
FT                   PIRMTIGEAVEAKVIDNQTLGYFMGRVALFLTSIGVRFYRFRQHQSTEMAHYAQDCWDA
FT                   ELLTSYGWIECVGIADRSAYDLTQHSNASKKDLCAREEYDEPCMERQLLRQLTKGLIGK
FT                   TFGKKAGEVMAYLNSAPVEACEAIRAAHAAGHPATVALPSGEEVSITAQMVSFEEKDVK
FT                   VTGYSYTPSVIEPSFGIGRILYCLLEQSYWVRRDDGGKNDKRAVFSFSPLLAPQKVALL
FT                   PLMVKPELLATISEIRQELVMRGISVRVDDSSVTIGKKYARVDELGIPFAITCDFEGDG
FT                   SVTLRERDTASQVRVPKLEVASVVVDLCNPLQPLTWDSVKAKYPAQAAAAEK"
FT   CDS_pept        1473727..1474404
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3850"
FT                   /old_locus_tag="LmjF36_3850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3850"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3850:mRNA"
FT                   /db_xref="GOA:Q4Q130"
FT                   /db_xref="GeneDB:LmjF.36.3850"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q130"
FT                   /protein_id="CAJ09351.1"
FT                   /translation="MFNRLFGREKQVQPSRSSGGGSTTTAKTMEDMDAAIELLEKREAA
FT                   LEKRMEGELAKARQLYAKKNTQGALQCMKRKKMYEEQLVNIGAQKQNLETLKFTVQNQS
FT                   MNHEVLRAQIRAKDELKRSNKQMKAEKIEDNMDDLMEEMDKANQVSDALRQPLDNNFVD
FT                   EEELMNELEMELDGMNLEETQVADAKLPEMPAVPSQKLPAQPVKTTTQEDEDALAALEA
FT                   ELA"
FT   CDS_pept        1477852..1479582
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3860"
FT                   /old_locus_tag="LmjF36_3860"
FT                   /product="similar to leishmania major. l411.4-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3860"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3860:mRNA"
FT                   /db_xref="GOA:Q4Q129"
FT                   /db_xref="GeneDB:LmjF.36.3860"
FT                   /db_xref="InterPro:IPR018928"
FT                   /db_xref="InterPro:IPR040326"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q129"
FT                   /protein_id="CAJ09352.1"
FT                   /translation="MGGTATATAYVRSCDGASPPTPPGCGLKLVVDLTLDDSILTGSVL
FT                   ETEVMVTHALHESLFPRDAASDAAGTAATSLQVSLPPITVAMRRGAVQMRYGLTYLRTF
FT                   PAALRDSVRVLKTAMSCDDGVTRCPSYMSMTGTLVSAPLGLCCLCTSVECALTSDLCNA
FT                   SMRAHFCFRTGAAGITCVQSEGITYHGWAVGSSSPYYMMHLSASGRGIAPTTLQLTTDA
FT                   PEVQKGASALQILRASGVLPGESNPTVDISGRVLFVPSAEHSSASRSISTGPVRDDDPA
FT                   EWLLLPAPLVSVSGNDCDKVGISPDYFYSLSSTKQCNAQKGTCVRHQLADYRAADLEQI
FT                   AQGVGGRYIAASLGTFTRQAMREQEFLLDAVERTGGAMLRWTVNADGLVFQPLPVHGVL
FT                   DAIKFDSSTGILYVTVRNNNTYGGLYYVAVGQCRGARASNCDSDGVTHECGRTALVAGA
FT                   NTSSLLQFSMVSDLPEEVGSTASCTVVFRDAAAALLASANISWTVEHTTTTPAPNAPKA
FT                   EQCRRCAFRDLRCLFSTVCEWQMLLWTAVAVAVTWTPYAILAYWRMAWHVGAKLLACLN
FT                   "
FT   CDS_pept        1480817..1483342
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3870"
FT                   /old_locus_tag="LmjF36_3870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3870"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3870:mRNA"
FT                   /db_xref="GOA:Q4Q128"
FT                   /db_xref="GeneDB:LmjF.36.3870"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q128"
FT                   /protein_id="CAJ09353.1"
FT                   /translation="MERPSLMERYFAQCQAHRTSPHPAFVAGLREGVMDINFAEIPLAD
FT                   IRLFACALLDVSPAARAARSPAAPSRNSSGQLSRRGAASDTSPSSRPRTIGAFSRTQFA
FT                   KLHFAYKDTVPAAQLPRGAASPPASRTWFTQNEPMLRRLAQAVAQAVKESATTLSSFSW
FT                   CGMPLTSMAVQGRAPLQQQRGIGQVPPSLTRVLPLCHRLTSLRLDGVPLTHAQFMQLTT
FT                   PSPKSSEASADGGVTWPALEEASFVGCGLTDACKTGLVHLIRAAVPTASASTWQRSLRG
FT                   GYASLDDRPLPRPAGGTMSLGHSATRGLKGLDASQNPLGDETARAVANAVPGSALRYLN
FT                   VSSTSITWMGGSLLASRPVLEGTAMELLDMSNTGVSEVFAHAGSAAEAKMLAESSAVAG
FT                   FRVLARGMGQLLILRESDRSPQHSWLIQTTTAIAPQPSPAPASAPEPPHVESPTNPTNP
FT                   PASVMEMERVAPPAPPATPLPSSESGDQHSAPQSVHNSAAAPGPAVSPYGPWWPMFASW
FT                   YAARDITIPTSSADAAAAGSSAAGLVKGYVPVPVPFPMLAPMPIPYTAPHGADLPFAGA
FT                   ATAATAAATSPHTAGAVAEDSTPSPERRVSTPPADDPIDAAAETSEPLPSPTSSGERHD
FT                   EEGVGSLTGGVANPPDAASTASQAAAVTASASEDLVHRVSEAAGDRKFLLALISRLEAH
FT                   ESDVTERLEAQYQRTTAQLTSLEKDMRFRLQQLADADRKERAAAADRQTALLESLAALR
FT                   GEPAAVSAEGMTETMLRQLIHLIEAGMGKVQAALGAEGAVGTKSTRAGEGRVSPQLRSS
FT                   EAATHVGEATITDRDLVKTASQRLKELGW"
FT   CDS_pept        1483808..1485067
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3880"
FT                   /old_locus_tag="LmjF36_3880"
FT                   /product="putative eukaryotic translation initiation factor
FT                   3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3880"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3880:mRNA"
FT                   /db_xref="GOA:Q4Q127"
FT                   /db_xref="GeneDB:LmjF.36.3880"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q127"
FT                   /protein_id="CAJ09354.1"
FT                   /translation="MMGPRSRLQPGPSAAVSPLLNTPSPFFFWCLLLSHLASLLAAFLT
FT                   ETKKSKTQLIFVSRTSATMTAAVDLEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTNCS
FT                   ACCWQVKTGKLFGSYTTVGQVEGRTYDAAMVALDVNRESTLLATASAGEEVLLWSVESG
FT                   ALLGSVSRSLSSGASVGFSHDDTLMMVATKGRSSTNSAIQVYNVPFTVPKAGEDIAPVK
FT                   TPFTTFSTFETPDTITWAAWGPTNETIYYSEGGYMNILDVEANKVIRSRQIHEDENEVI
FT                   NRFSWDPNYLALATASTDKTSHLIDFRDLATIQVYRSDVPVNDVSISPNADHVILGGGM
FT                   DAASVTTQGGQSIFEVKFFHKVHGHQLGQLRCHFGTINAMSFHPDGRGFASASYDGLIK
FT                   MYRFGDSYDSTPGAQPLWTL"
FT   CDS_pept        1486527..1487711
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3890"
FT                   /old_locus_tag="LmjF36_3890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3890"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3890:mRNA"
FT                   /db_xref="GOA:Q4Q126"
FT                   /db_xref="GeneDB:LmjF.36.3890"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="InterPro:IPR036561"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q126"
FT                   /protein_id="CAJ09355.1"
FT                   /translation="MWCLKRVPRGPSLARGSAAMVGMLRRFGAVQEASALCSVAVVAYG
FT                   RRSLSTEELVDEETQWTRAMGSKYGSGNYQLFRALYKDLCDEIRREYYTKPPPPPPATR
FT                   TTGASPSLVAAEAALEVHGSAGSGANDTSSGAAKQRSMAGGAGATSSSTQGGGMTAGSE
FT                   REGSTVEAAHAARETAATPPSQPEETYGDGSWSVQHRPEDNVAVFHRGAVKRGRLAAVH
FT                   AWARIELKDPPRLNAVLTFADWIPIEVCVERNGIVIHFSMAANEGGMHMRNVRVYEPKS
FT                   AEERAALLDPSDDGEYARKNFYYDGPCLWHLELDMLNELYDVMQDHGVTLDWIRWAASW
FT                   VFYLEHVNYVRWNLGMLEELIPSSLRGPEEDFLLPVEKALLAEPVEDWLRAHSI"
FT   CDS_pept        1488618..1489445
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3900"
FT                   /old_locus_tag="LmjF36_3900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3900"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3900:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q125"
FT                   /protein_id="CAJ09356.1"
FT                   /translation="MLGEGLDIGFYAEDAYAAYVTDLATSLHLVPHCRNARGATLEVVF
FT                   TGPFHDLSAYEEAVKQGKLVPYAELPWPVAEERGVQGVSGATLSVTLHGWIEKLNAARK
FT                   VQLMEPLFPAAELGATIAEICVMGDAGNSAPCAFASTSPPCVAESAGTSNEKGTHPSLK
FT                   PSRFRILGSLDFLLHLSSRDWLMGESSVPADSPSADGRDEANPNFAVGADDATRAAHAC
FT                   RDALEQRDDVALARNAVNTVIKMAQMAEEHPGEVGSVFVDAKERVEYIQFSAQ"
FT   CDS_pept        1490398..1491711
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3910"
FT                   /old_locus_tag="LmjF36_3910"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3910"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3910:mRNA"
FT                   /db_xref="GOA:Q4Q124"
FT                   /db_xref="GeneDB:LmjF.36.3910"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3G1U"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q124"
FT                   /protein_id="CAJ09357.1"
FT                   /translation="MADYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKGA
FT                   KIAGCLHMTVQTAVLIETLKALGAELRWSSCNIFSTQDNAAAAIAKTGVPVFAWKGETD
FT                   EEYEWCIAQTVKGFSGDGLPNMILDDGGDLTNLVIDRYPELVPKIFGISEETTTGVKNL
FT                   YKRLSKGNLPISAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKTCCVCGYGD
FT                   VGKGCAAALRAFGARVVVTEVDPINALQASMEGYQVALVEDVMADAHIFVTTTGNDDII
FT                   TSDHFPHMRDDAIVCNIGHFDTEIQVGWLEANAKEHVEIKPQVDRYTMENGRHIILLAK
FT                   GRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGKYPRGDKAGVFFLPKALDEKV
FT                   AALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY"
FT   CDS_pept        1494528..1494929
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3920"
FT                   /old_locus_tag="LmjF36_3920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3920"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3920:mRNA"
FT                   /db_xref="GOA:Q4Q123"
FT                   /db_xref="GeneDB:LmjF.36.3920"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q123"
FT                   /protein_id="CAJ09358.1"
FT                   /translation="MLFFIAAAAAIFVLAACAVLLYGATSILAGGFIRLALGALLVGMS
FT                   LSVVFSATANLLLVTFSRYDLEPRPPIIFLRSFLAAMGQPTLTGIIGLSLVALISLAAS
FT                   KVRVMVEEMDILIRSHAAYAARSDRTAAP"
FT   CDS_pept        1495874..1500229
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3930"
FT                   /old_locus_tag="LmjF36_3930"
FT                   /product="putative telomerase reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3930"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3930:mRNA"
FT                   /db_xref="GOA:Q4Q122"
FT                   /db_xref="GeneDB:LmjF.36.3930"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q122"
FT                   /protein_id="CAJ09359.1"
FT                   /translation="MSASFPSIPGFAGPLSLKAFLEEYFGLHLTFAVETASPSPRAAAT
FT                   AATPSAAEFRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPPTPALGRAASA
FT                   TGFERLRQPLTHQTVASSAHDTCMTRCNPADRQNSSWSSSSFAGKHGSTRDPWRASAFR
FT                   LLYTNTSHRPLTDALLRHPWWASFAACLGPAAMGFIEMYCPIVLQLEAMAGGVQVLGPA
FT                   LKHTAFERSFSAAAPSSEMKGPLPQGSGCISSRGVKRALDTRECSAPLPLQKQRRVEAP
FT                   PKAKAGRRLQRGVAPDSRPCRDDPFSSSVNRAAMAATWAAALTRTDVPRTRLYSARISD
FT                   GDGAGDGSGSALPLPAGFLEAQWLRRHPHSLHRALQAALPKRAAYGASTRRYSVGASER
FT                   GTGCTSVEDIPMWHVTHVFRWLVLQPPQSSADASPTTPPKFDLPSHLRRLLSTVVDQCS
FT                   RLDLRGAALKHTGYLEEAFRRQQQGVEPWDVQRLSTPVDVVVSYLRTLLSTLRWAPLKE
FT                   TDNGSFWGRDAAGSERVLDALMRAVRGWLIAGRHAVFPVSRFLDGVPVAQVPWLNGFYT
FT                   TAPSLPFPAATSSAARHARRERSHVQQRVWLQFALFLTQDILPFLLRASFTITWSSKNT
FT                   HKLLFFPAVVWRRLVRREVRRTRSCGAPRSQMPLAGESARRIGAEPAALSSAPSACGGV
FT                   VTAALLTPHSAVSKASAAIAAPRDVWRAVRTGGALTHRGARATLATRGGGASCLYAGVR
FT                   FRPDRRKLRPIAVVRSASLRSLKEMARGSPSPYSHASAIARLLRRLGCSDTDGQLPAAT
FT                   ATLLRRVQARSRHNRRAGVHRFPHPLPPHLPHKAALRDALRCLVSGVEEQRVRDGLPRL
FT                   SNLSHQDEYAELRSFCEEVRGRHALLCEGPAGTAPAVSSAPPPGSAACCFAPYVTLVRS
FT                   DASRCYDNLPQERVLAAVASLVKHDAYRVLRFTAIHALDGEGACRGGCLLRRTFTTRTI
FT                   PCAEAECGVLARIPRGHIYWEEEEEGHTQGGLHTTAAVSRTTDANRRCGANLISGAAVR
FT                   ALLSEHIRHHLVVVSGGSLFEQRVGILQGSPVAMLLCDRLFSDVVDTALSGILSEHAER
FT                   SLLLRRVDDVLVATTSPAAAERCLRAMQCGWPSVGYVSNPSKLTLSTACGRLVPWCGLL
FT                   LHDTTLEVSVEWRRIGVLLASLRVGDPHYVHRGDHDPLYLTQRFLAVLQLRVAPTALCG
FT                   RMNSKTRQLQTFYEVGLLWSRVVLEKVQEALPVARNRCVAVLLLRPLAVCVGRLCRLLS
FT                   GHQRFLAARQSACDVSAAEVRACVLTALHRTMQAKLRVLQARTVCVVTAQRGRTPRGTS
FT                   LKGRRNHFCSHEALSAGRKCCERRRKGRNRRRNTRVCLRSFWWLAAAEVESQWRRSLSA
FT                   LHRAAPRLGEARGPTALSPSPGASASLLMDDGPLSMHARALSATRLSQT"
FT   CDS_pept        1501448..1504726
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3940"
FT                   /old_locus_tag="LmjF36_3940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3940"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3940:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3940"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q121"
FT                   /protein_id="CAJ09360.1"
FT                   /translation="MSEAGGYSTLLELCTHMNAAAPAPSRHASHSDAPSTECLSSSPLA
FT                   EASTIMAGASAVNSKPSGSVAAAAASVASLPHFHFPPAKRAPQFTSLVFDSEVEQGRGD
FT                   EKFDLHAKKGVTVSSAPFNPMSRRATLPFTAAATCHGVGGATTSEGALRLALPTLGCSS
FT                   KAICGQNPTRSVNHTRVGLAPAMVADDAHQQWRLDRLAFPGRAVAGEDAAEDAAVAEQG
FT                   RPSLIDNLMSPVGAVCGDGEDGQSIDVASTPDSFISEADTFLGAVEMSDEEDYLSNLGA
FT                   TRRPRASSSADSVATAAADVCALGNGIDSSPPSCECAYMRGCPDPNCVSHMLGITVSPK
FT                   AAQTGVPPKASAPAASAQFTHQRLSLSTPGRGTSATTILITAAATPSAAHAGDDVHPPE
FT                   SFPDAGQGAAPFPHSDREDTRMGGEGVLDVSGDPTAAACMQAKLPSTAHDALTVQHDAS
FT                   GSDEQSAPCPGVSAVGVGMCTEHDARLSFTIPINLLQPNTLLLTDTISEVCTSSFATVT
FT                   TSKSTQESSSSTQLLGSREGSSIAASVSAPRSLQQHNSFDRSITGPKLGSPLQLTEELQ
FT                   GQKQEPRHPSSSPRDAFGIDKHSASQVSGGAPAAAVTGPLSSPSPFYRLSPGSPSSPPF
FT                   ALAQRRGTVAAFAEMELLPKEVVVKRREIPGKQKTTTINAVRPPRLLCRGPDRAAEDCR
FT                   DLSDAVPTAPAMDSSSDARAHAESPGDDADLVDSVGAFFSAFQSKLGKWMTWVGRKYHG
FT                   VVRRTSDAAGEEQSLPPPPPQQPLESPPRRSCAPQRESNDGSSGHRVSFSPGDSAEAVD
FT                   SGSASFYDARSLKRKSSHLSFAPSLSTSQVNSSYDGERSRHPVVEEALCGLATPWNGGG
FT                   NSTWYSVGWQVEPRGTGRVTNGFMQLRRSITASPQSPSTRDSPFPTPSGERLCGSTTPP
FT                   NLSLSAESLTSTFDALTTQIFSGGALQRLSRSLGDALNSSASGTSMSGDHYSLSFPSSN
FT                   DRHSRMSDFNTSAIADDRYRDTLYRLFRHPPSSLIGDLTECYEAYKAMSTSSNGHHVLN
FT                   WGELGLLLQPEDYIDYRALFPPYHFVTFDDFVEFVEVLSLRYHR"
FT   CDS_pept        1508462..1509214
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3950"
FT                   /old_locus_tag="LmjF36_3950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3950"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3950:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3950"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q120"
FT                   /protein_id="CAJ09361.1"
FT                   /translation="MEIVRGQVEQVNRRQRKLNEMLEAFKEEGLLGGGGIGLHDERQID
FT                   ALVKRLRARLHTDDASELETLKINNSNLKHSLDEITLAMEKKNSEMEVLRANYARKLAR
FT                   TDVENDAVRAKVEAALHASILDVERMKRELSHRIDIACASIRTPRYNTSMGALRELVQQ
FT                   AQEEVQRHHDELTRLVVSIGAKDTFLKHESETMHSNLPSAYRTELRKMEKDQLLNLLDV
FT                   LSFQEGVVDTIGKAIYIITEAQHKTAVV"
FT   CDS_pept        1510736..1513789
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3960"
FT                   /old_locus_tag="LmjF36_3960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3960"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3960:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.3960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q119"
FT                   /protein_id="CAJ09362.1"
FT                   /translation="MPRNHCRVTLKQQSNVSAASQTTPAPANDAHENTREVAPMPSISA
FT                   LAARAKHRGRGRPRIYPRKTSSAHSLHPHLAPAEPGSGDLDDALTVAAVPPAVSDQTSI
FT                   TAAIVNSGTAVSQHEVAQSAETFGAGAAVSAELPLPQRLSPLGVPFSSSRITSASPLVK
FT                   ANPAGAAQGGEETATFSSRPPLHSSTRIKAAVTAGIAVDEADRATLGAQPFLPSMAACM
FT                   AACFGWRLKRCSVGEGAQITFVLQHRAIPVVRVTIESTGGAFTQACGASSETDAGAVRV
FT                   NGTPMSFLQCTAHLQELTHALFSLSDTTRSAPLTDRAPAAEEGDSEGEEDGRSVSSPTV
FT                   PAPPLLSPSEQAKAAERRANKRARSRSPMRRTDSTASVSRATELLSCATVPSLTEGSAG
FT                   AEADGEEASKKGSQPYSTPLNSSDVTLSPAPPTRPPPVSLAAAGVKVDAELSLLATTPP
FT                   RTSEQENGADTRSLSALSTLVAAMEGGESSTLLPRAPPAPRTNTGKPSVASRRAVASAD
FT                   KGAVKRESPTSSTVFASPTMRQRRTLAPATAAAAAGPASAITGEHHAPLASLTPPHAAL
FT                   RTATFTMPLAFHHTSASPLAAGAAPEEFDVASCNTDSNGGHQSVWCDSAGWSTDSSRLW
FT                   LAHTHAVSRAFQCMSVPRCRVSATAKATQPLGDEGADGHGTSTATSASSTVPLTDSAAA
FT                   AALVRMTQLWRWRERSSMWTAMEDSLRMAVGSGHLRGDALEAGVQALQASEEEQRQYDG
FT                   RGADAGEDGSDLGPSCGRTALDVGQVGHGAERQQTRSFPACPPRALLPVSGRAVVEAQH
FT                   RITDSEEGRGGEEGAHGPRYVTCAGGIPSAERIVIDHTYSTRGSYVMASPVTAQGTTAT
FT                   PCRLLALQRNPQEDLHYHVYKRFMPTDMRLAMEAEGTLRVGPGDMGPLHGASAELSPAY
FT                   KLPREQSGGEGDDNEDDEERDDGADDADEKKACNSSTASQAAPRAPAATTVADASGGGP
FT                   FTDMDYVLRHRPSIRRIPMPDVESRYGP"
FT   CDS_pept        1515078..1519142
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3970"
FT                   /old_locus_tag="LmjF36_3970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3970"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3970:mRNA"
FT                   /db_xref="GOA:Q4Q118"
FT                   /db_xref="GeneDB:LmjF.36.3970"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q118"
FT                   /protein_id="CAJ09363.1"
FT                   /translation="MTSRERVTQARHVMLLSNDAPVLNRCAKEDAHLKHRLAQSTAACA
FT                   LMVQKSHAAAAREERSRESRLQAQFRALLSGTPGVVMPPFVTSSPTEGFTDASERASGY
FT                   AATAANDRSVPDPTTRTDAALLSSLGLKSSSTVTADGSAASAASLPCALGFPEAYESSG
FT                   FKSEIHWASVAHDETFLTAYGPRRIREEAQARAIAGAGGSPAAREAKPHRLMTAVACYL
FT                   LNQVLCADAAVSELWREKLRQPIFDAVFSSQSIAMGHERSGAQRSGSLGDAAVTNAIVH
FT                   RTLGHASSLLSGTATHSDPTTSFPPRTNEYASRRDFASLRLWTEEVTLEHLEKASVCQR
FT                   VRNLQNAMARRQLAVHLFQRRAHQAELQAVFTVWRTYTRQRRASRSVLERYLVKRNHRH
FT                   VEETIFLRWRRFALRSKVEAVQRRLLNVAADRDYAARKHATALQGLQDQLASERRKHVQ
FT                   EVFERDTLHAQVLESHAVEIEALQLMLQMERLKTAQSGKWAMRWERVAKTFRPAKPCPA
FT                   VPRPIWTLARALLSAEEELAATILTRSRDQRALLQIPYSMILQARRRLEQLLLTWVNVI
FT                   MEASPQASTWVTVEAFTHSRSSHPRGILLSQKQSSSRKAAARRSGTTAGAVATGKDDST
FT                   CEFSIYTLMCLVRELRRFYAKAGLIEKAEDWGTPDGASVADCYQELTHLFAVQSCGGLY
FT                   PPLLVHCPTSPLWFTPEGVFSGPVSHLEGSKRQKRQQHTTFTWLLASLLVGHIQTMWML
FT                   PLGDIGVPPGRRPMKGTATLRCKHEAEMTKLARISFPRRCGAPPAGLTAAPRGTSVVAP
FT                   NTLLPKKRSVAVSAASFSGRAAAKTSMASASVAEDVEGAGVVTTEMTLEALLRARSKST
FT                   HDSTSSDSKRTLAGKDLMAAAEDSLSDIEAFLGMAPSQLQSLKGGAGANGTDDDDSDDD
FT                   DGDRWVNGLLRRLFEAQDAEAHQRRTKRLQCSEFLKDGAEDGHARSAATIPASALGDDE
FT                   EGEGGSGDNDAAAAGDAASTIYGDLPKSTVALTGDQLRLLRSLPGRSHAFDTLRPIAIA
FT                   RPEAASVVVGLSKDDSSTASYASAAPLYSFLLNTLDDTVARQQWSGLARVVTSLVVRFH
FT                   VLDESEDAAQRAAVLTPEGEESEELKSGSVSRQSPVERAGSSALPSTTRLPPVSVGCAP
FT                   SVAAAGKGGDGAAGVESPRSGGRIAARLVPAAPPQRPQPPPCPTTHGAQRRLPRARSPP
FT                   CVSTALDTEATSAQRATEPGVPIFSRPKPRDVQGATATAAPPSATAVTSMMLGEELRRR
FT                   GTYQTNSARNSFSFSSPTDLSGQGAQSPEPSSSAVPPISSEASEPMVPPPTEEVHTPMI
FT                   PTAVLFPSQGD"
FT   CDS_pept        1523278..1524369
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3980"
FT                   /old_locus_tag="LmjF36_3980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3980"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3980:mRNA"
FT                   /db_xref="GOA:Q4Q117"
FT                   /db_xref="GeneDB:LmjF.36.3980"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q117"
FT                   /protein_id="CAJ09364.1"
FT                   /translation="MATTSSPAASETAVRTVWFDAIDATAAMISTDPLQPAAEYTADSY
FT                   LPPLSLAGDQADFFAQLRELDRGFIEAAPSLFLPQMTLEEACHAKPSFYQTFLGEREIT
FT                   ETTFQPLLLKQRDEAEQEADGSAMNGRHGARRRRQEAPVLPRGTAPLYGGFLGQEAMSP
FT                   STAVQRKPDFMPIILVPSAATAPLQLMNIKQFLEHGAYVDPATLYVDRETGVVNIRDSK
FT                   PRSVIVKPGSFHDPHKYHVAFRQFRVVDDQDEVDDWSHVCGCIVEGKLWQLKGWYPHEQ
FT                   PQSRDPSRLFSRIRAFLAYFEEDKVPPQCREWNVQSLALTRNLLKDQVHIALASKFWEQ
FT                   LYTFLDEHPMFSRYTIPLTDERL"
FT   CDS_pept        1526757..1527401
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_3990"
FT                   /old_locus_tag="LmjF36_3990"
FT                   /product="hs1vu complex proteolytic subunit-like"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.3990"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.3990:mRNA"
FT                   /db_xref="GOA:Q4Q116"
FT                   /db_xref="GeneDB:LmjF.36.3990"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q116"
FT                   /protein_id="CAJ09365.1"
FT                   /translation="MFRRLATRSTSLVTGAAVQARHTTILSVRKGSKVILIGDRQVTLG
FT                   ERIVAKSSACKLRKLNDNVVIGFAGSTADAFALMEKLENKLNDFPEQLSRAAVELAKDW
FT                   RTDRALRRLEASLIVCSKEETLEIDGQGNVITPEADGIIAIGSGGTYAKAAARALIDVD
FT                   GYDAERIARKAMRIATDIDVFSNSNWDVEILTRDEEAVKKDEAENEAQGKE"
FT   ncRNA           1528894..1529631
FT                   /locus_tag="LMJF_36_ncRNA1"
FT                   /note="spliced leader RNA (slRNA)"
FT                   /ncRNA_class="other"
FT   CDS_pept        1531053..1531637
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4000"
FT                   /old_locus_tag="LmjF36_4000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4000"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4000:mRNA"
FT                   /db_xref="GOA:Q4Q115"
FT                   /db_xref="GeneDB:LmjF.36.4000"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q115"
FT                   /protein_id="CAJ09366.1"
FT                   /translation="MPIHQYEGWSYERLRQQRNRAHFLLEDPYRYVTVLLISKPGRPEE
FT                   LKCIDSPCYHAAGPLGEGDIVEIEDLLCLRCPWHRYLVNIENGEEILLRVDPASAQGAG
FT                   IVGRQAALPTYPMHFTDPSAEGVTVVHGEKVQRVHRAWLEEATGILSIEVAEEAVMRQH
FT                   PVKSDKPAGNVKNGGICMQIFDIKLRGLDKL"
FT   CDS_pept        1533128..1534708
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4010"
FT                   /old_locus_tag="LmjF36_4010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4010"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4010:mRNA"
FT                   /db_xref="GOA:Q4Q114"
FT                   /db_xref="GeneDB:LmjF.36.4010"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q114"
FT                   /protein_id="CAJ09367.1"
FT                   /translation="MDSLPNQLMSRITEISLSDAQIQSYGRWLAAAMGAYYVVNAWQKD
FT                   TPADVQAAITGHMVQGYDRSTITTRLEQRHTRQLLQQIIGLNELRQQLRSETDREAKLR
FT                   GWQRVFRLTLISIAATTYTHSLTISLLSIKNMVRVLVFLLSRRESAALSKSRSGPISTL
FT                   RAWWTGGRRAGLTGIMMESMMAKMAEQVSQQASPFVNAELEEEVVTEEVRQLPVPPPPL
FT                   DGRTAFAQAQQQHEMLEAAHGESQSQVEQAFSVRAVLEVAVPRIVACAAAAVDSAIAAR
FT                   PAHLFSVSGIVRAVDLCSLLRDIALGMERRACVSEWVHRSHPSLVPMPRARSGASISPL
FT                   ASLPKQLETSKGRLPPDEGEELLDEPDQSATSSEDIIEFPHGSTTLLRPDGRPVRRRAG
FT                   DRSEDKILDGLLNRRLTAEEEALQEETIRRDHLLKRQMAGFFTELSHSASFGELCITYA
FT                   AELLAAQFKEACDIKRVKTYDSATDTAKMAMVIAALDSCRLAALEEECEVKSYMRLFCE
FT                   ETIRSTCAR"
FT   CDS_pept        1535612..1536442
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4020"
FT                   /old_locus_tag="LmjF36_4020"
FT                   /product="putative Qb-SNARE protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4020"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4020:mRNA"
FT                   /db_xref="GOA:Q4Q113"
FT                   /db_xref="GeneDB:LmjF.36.4020"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q113"
FT                   /protein_id="CAJ09368.1"
FT                   /translation="MNPEARQVAVWERLRNEARQTDQLIDQQLRRLEVLALFDEERMIA
FT                   SAAASSSMKGVGTSSSVTPAVPDSSSSLLHGSGAYPPPASTMSFEDVESQYRGADRDID
FT                   EFLRRLEQTVLSMEDACRELGPTSAAARHTERFRGMLTEKQQARRRLATEFRQRKDRYE
FT                   LAASRLAGDARRRGGPVDDDARGGVRILMDEQVAIQHTLNRVNGLLEQAEGTRDRLRMQ
FT                   RERFSQIGDKVLHIAEHIPFVQNLVRRIDVRRRREVVVLGTVISSLMFMFFFFL"
FT   CDS_pept        1538739..1542575
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4030"
FT                   /old_locus_tag="LmjF36_4030"
FT                   /product="putative zinc carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4030:mRNA"
FT                   /db_xref="GOA:Q4Q112"
FT                   /db_xref="GeneDB:LmjF.36.4030"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR040626"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q112"
FT                   /protein_id="CAJ09369.1"
FT                   /translation="MSTAVDPQRPNMAAVLLPTQQLLEDGYYVASDESANSSFSDTPRS
FT                   ARRISLGSSSSLRTTAQRLDLNSSGAVGGGRSATVVTGASPSGINSLRDSRDPNGFSRG
FT                   NGGDDNSDIILEEENDAGNFDEEDEEQAVLTYMDSGVEGNLPGRPSSSNLAPLPLSTRQ
FT                   GPLSASGAGDGPSIDPGALSVSVEVGDTDYDIGEDPPSCTSASSPPQLHRRGAPALRTA
FT                   ACSVRSSAAADWRAQTTARRPISVSKAGGAPSFQAAVTPAKLTAVTAVPRMLSRQHSTV
FT                   NAATSSRPTPLTTAAAHTSLTATSSSPRFASFSPHLQLSSINEEELRERECKQLSLYEA
FT                   FFFNPTRSMWLVDDHVLAKVLEYVRIMGYEHPALKRDRLKGQPSLWSSSSAIASPIAPV
FT                   KTKKKAAGVRNANSRVPQSTHTSSSSAVAEAAVEALAQPISADASPALPTAAGDSADSA
FT                   TFATKQFCLKAVKPRCARQCVNKSPATAASHLFLTFSEAMRWIAEQEYVIGTVLLCCAR
FT                   FVGDPNADGAAVLGDGVADTALWHPRRAMLQRRKPCIPLRFHPIHFAASLVCSRFPQWG
FT                   GMSAFTRAWETQIRLVLGSASPSHQCLFKLPDGALLLSSDCEAGNLHRVERAGEPYSFL
FT                   IWLEPDFGSDKRIWFRFSVAGAKEGRRLRFRLMNAAPHVKLYRQNGMVPVWRDGLSQPN
FT                   WGPVDSCSFRTTNRDLDGEVSFSINPRNSTETIQIAFCVPYTYADLLCHVCHWHALVKT
FT                   SGCDMRFEERVLCRSPDGRKLHLLIVTSRVGGAPALAATEDKSTADAAILGGRGHTGVS
FT                   ADGVAAAGASSFSGWTSPGVASPTMTIPPGKGKGGAAKEAVRGPYANFASGKKVVLVSG
FT                   RVHPGEVTASHGVHGLISFLLSSDVRAIQLREHFIFFIVPMLNPDGVSRGHSRMDQFGN
FT                   NLNRCYNDPDAETQPTVLALRRVFEHLQHTYRERFIMYLDFHSHASQSSGFMFGNNLPV
FT                   SVQHWNLFFPRVVELHARHVFSFALCRFGRVHMTSKDGASRVLFGSSLIHSYTVELPHF
FT                   TDRRLYADEYTAMNNGSSVLFEVTWPPLHQTSGQAGSVDVNEDGAQDAEKGSEEKWRDL
FT                   DPSHGRAVHPAAGARGLDKRSNMSLAGRGRACRPNRESSSAQSRDDSSPKKSPGAAPRS
FT                   QGHANSTGVGEHCRGQSSATQIGGTRAASFLQPISTPSILCQSAEVGQACLLALRDYCS
FT                   IGACPSPELTMFGGMDGVLRDSKRQVKLDSSRKCKKSQSVATYAGINPIYKQY"
FT   CDS_pept        1543743..1545035
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4040"
FT                   /old_locus_tag="LmjF36_4040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4040:mRNA"
FT                   /db_xref="GOA:Q4Q111"
FT                   /db_xref="GeneDB:LmjF.36.4040"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q111"
FT                   /protein_id="CAJ09370.1"
FT                   /translation="MSTSLDSSLAHMTEAAQQQDEAQHLMLEEEENQVPQAEEGASEQS
FT                   SQEEASSTSSDEDEEAEEAEDGVGDDEDATFQFATDEEAEAQRQAGLAAYNEGRYEDAL
FT                   DVQYRVVRHFSNKYGSTSAKCGKYFLDYGLSQLRLLQGQTTVDDVLQPRDEDALMTCYV
FT                   NLEVARVCFQKLEDEVGDEDVEVELALAEVHNALAQLSLEKEDYDAALREYEAELLQYR
FT                   CLQDAAPEEGKLTVVPAGRVIGVLYGIADCFLKESDFEGAEERLRATLDEIKLYPAGTI
FT                   AASLVAELEDLLADAVEMKGGKFQEIQNAIKQQFAAEAEQIPTPQEFFSVDKDGKHPFL
FT                   SAVPGGAGDEVAENSYLSMPMSANGQVLATNEHSNSLSVSLFPPQGSRSGTPTGPLQHA
FT                   TVRKKQKRTGDDSLSNAQPENKRLRAESASA"
FT   CDS_pept        1546339..1547643
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4050"
FT                   /old_locus_tag="LmjF36_4050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4050"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4050:mRNA"
FT                   /db_xref="GOA:Q4Q110"
FT                   /db_xref="GeneDB:LmjF.36.4050"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q110"
FT                   /protein_id="CAJ09371.1"
FT                   /translation="MSSDTAAASEEEGDMLRSTGCRLVYGFLYDSHCHLRRVSPVVSGV
FT                   SVSTPIASVDCAGRKCDDARCSVTGLVLCGTHPSIDWDDVAQASAMRAATLIGFGVHPW
FT                   FVPNRVGDENPASSLSPEYSSGEACCCLSRNSAEANASLAACSAAAQSLSGILRLLEER
FT                   LQQHPLAIVAEIGLDKLRGPPESVQVEAFAAQLRLAAAYRRPVSVHCVRHYGLLLRVLQ
FT                   DLPAEHTPPAIILHAFTGSLEVAKSLLSLKRKKRRPALDGSATPAQDAAATAGSGLPVQ
FT                   RTTKRGGTTSDTVRIKDRIFFGVGVSTSFTVKNFSTQTLPFLLDAQRVLLETDEHYSGI
FT                   EALDTASSGEFPAEAEARSSVRGGGRACVSVDPQEHVTKLAGVMERIHASMLQNHEFVQ
FT                   KAEASSMPVESVLQDTLMHAYAAAFCSVSEKTGAS"
FT   CDS_pept        1548381..1550453
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4060"
FT                   /old_locus_tag="LmjF36_4060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4060:mRNA"
FT                   /db_xref="GOA:Q4Q109"
FT                   /db_xref="GeneDB:LmjF.36.4060"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q109"
FT                   /protein_id="CAJ09372.1"
FT                   /translation="MFFWGSYNFQEPQLSENPDRPPLRFPGYLPPSPAMLRCSAPASQN
FT                   ATSSSSSLQSDAASVQDALRSIRALRMQAHHIACGAKHLVAAVSLVPAAEAAPAGNSEA
FT                   VIALYGMGNNEYGQLGHHVANYATTLTHLRLEDLMEGTVVSVACGARHTIVCTSTGCVY
FT                   VTGDNSFQQLGLPRQMVKPLPRGGTYAPSFTQLKSLVHVKAVYASGNASFALDRRGQVY
FT                   SWGEAKYGHLGHNDNGERLDTQTLKTVSTNVATPQLVRWLERHRVTIVEVAVGRSHMVC
FT                   RSEEDVYTCGEPFFGKLGHGDIDPRLEPTRVTFPPRKQVERLLNIAAGDDHTLVLKENP
FT                   LIGTVVYFFGKLNNGDGQLQPTIVQLPTTAVRSVMAGRGTFCAAITQEGQLYVWGKHAY
FT                   TKVYNGTNAAASRMQPSKVQLLEPYSIGGAVSGGTFMVAYAATGTVVRPVSDPAAAGDG
FT                   KGEVKVEGDTASEETVAATTAARSWDVVVPHNARVGRDGLGDPKEEYEEGLRALLRQYL
FT                   GPALGNAYVAQLPAAPPRTAAPVYQFDHIAVKDLRCGQKVRLWMTNIYALGTIVDELAD
FT                   QRRGASSSHVGEASTSSGAAATVDPSEPFQRDKRSQRGAAAPSGAAAEEDADGHSPSSP
FT                   KGKRVKVEWQRDDWDDEVVTLYSEDETLDEENANRWQPFWFEQNPDGEYVVPKSK"
FT   CDS_pept        1552559..1553602
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4070"
FT                   /old_locus_tag="LmjF36_4070"
FT                   /product="putative phosphoglycerate mutase family member 5"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4070"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4070:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4070"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q108"
FT                   /protein_id="CAJ09373.1"
FT                   /translation="MSFTFRRFFCSVGIGFAASPLLRGAAVALCETVKPAAPPGMSSAA
FT                   HISANGLVNHLFDEDPLPTKKELQYVKTWGVPWVEDWDRPGNRGIRADRSASHQRQIIM
FT                   IRHGQYGNEGVNDDNIHRLTPLGERQARETGVYLRRLFEESNKRKKLKAIYRQARQAYK
FT                   QAKSDGASEEQLTQLERKMDEARLVLCGAGGIFVDTMPMAVHVSDMTRAKQTADLILEA
FT                   FPEDVRLRKDVDPQLRERIPCAVQPVRPFTPSAEDMHIAEAVFERYFHRPVESGTSTEI
FT                   IVGHANMIRYLTMRALQLPPEAWLRTSLPHCSVTTITIRGTGHVSLVGMGSYGHLPPDM
FT                   VTVSNVK"
FT   ncRNA           1554776..1554845
FT                   /gene="LM36Cs3H1.1"
FT                   /locus_tag="LMJF_36_snoRNA0074"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           1554881..1554937
FT                   /gene="LM36Cs3H2.1"
FT                   /locus_tag="LMJF_36_snoRNA0076"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           1555105..1555195
FT                   /gene="LM36Cs3C1.1"
FT                   /locus_tag="LMJF_36_snoRNA0060"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           1555516..1555585
FT                   /gene="LM36Cs3H1.2"
FT                   /locus_tag="LMJF_36_snoRNA0075"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           1555621..1555677
FT                   /gene="LM36Cs3H2.2"
FT                   /locus_tag="LMJF_36_snoRNA0077"
FT                   /product="H/ACA-like snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   ncRNA           1555845..1555935
FT                   /gene="LM36Cs3C1.2"
FT                   /locus_tag="LMJF_36_snoRNA0061"
FT                   /product="C/D snoRNA"
FT                   /ncRNA_class="snoRNA"
FT   CDS_pept        1556743..1558341
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4080"
FT                   /old_locus_tag="LmjF36_4080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4080:mRNA"
FT                   /db_xref="GOA:Q4Q107"
FT                   /db_xref="GeneDB:LmjF.36.4080"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q107"
FT                   /protein_id="CAJ09374.1"
FT                   /translation="MQAVARMEAGSHFIFQYSTREGHSCLERDVMSRKYSLITPAYGCS
FT                   LVNAVLSALEDAAAHASVELDAAVKIQATFRMYQQQKAFLMLRHHACLIQRVYRGYATR
FT                   KRLDVERATVRQMAYLQTVFDMFATRIQACYRGYQSRKTRSNYYAQQAYLNVVTARSSE
FT                   VLVQALRTQIEQDALRNAEAKRVHDLSYARRTAHMHYMVSTCSVPSVYQPCAAPSTAKQ
FT                   PTPNTSHTCREVRCHGEECGSVSPVPPAVKSAGEGSDGCAANDKLMAQAAAYASGQKLE
FT                   DDIRRHARAARLERNTVKAKASHGLVVLTVPATASSPSPDKTIAEGPEAEGAPVSAPPQ
FT                   VSGMRLPALTPSQPAQRSRPVNSTAPTAIAAVPWEVSSARPPQKPLTPRAPSLTGPSFS
FT                   QTAPPATFRTTQAGRKPRKAQQAAEDDSCHAAGTAAAPTAGPAPSAASIDPSMSRAAVS
FT                   SFHRRFAVKRHDCLEHQLSITNGVVSDGNDSHALRSALLSAKEDAAVQRSVDHKVMQAL
FT                   HGDAIFKVSARRGVQ"
FT   CDS_pept        1559627..1560925
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4090"
FT                   /old_locus_tag="LmjF36_4090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4090:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4090"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q106"
FT                   /protein_id="CAJ09375.1"
FT                   /translation="MRCISPRSYESTDLLTDGTAAVQQLTGSRSLLPPSPTADELLQLL
FT                   HESGHPCTSSTAPDSDMGVFGWPPTSFSAACIKCKCPTSRRVASSFAAAGAHSMLGEML
FT                   QFFAESVTRLFTTGVADPSVRAFPSEWDRRLHAPAAASLRQHHLYELQGFSTLFTYIWG
FT                   QVAASLPLLREQHGEEKALRESTERGMASSTSVAMRPTRGSSAKSPAAQQPPSRLPLSA
FT                   SAATAHQPQPFHRTARKGGSGGLESGNASAHARPLLSLSPAALHLPNAEMAPTYCRGKR
FT                   QKDGPIAAVSSRFAAQPPTLAVLQHALTAQARAQRPFLPSIPLEGLVPSSGARMVEGPH
FT                   PENSGAANDYAKRLLASASSNSNATASYPASARTLSLEQAMQLDRQRELQKKLGVRRVR
FT                   NYAAEDDMRNYLDNYQANMRSVLDGDDVTEDGT"
FT   CDS_pept        1562821..1567230
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4100"
FT                   /old_locus_tag="LmjF36_4100"
FT                   /product="glycosyl hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4100:mRNA"
FT                   /db_xref="GOA:Q4Q105"
FT                   /db_xref="GeneDB:LmjF.36.4100"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q105"
FT                   /protein_id="CAJ09376.1"
FT                   /translation="MAKRPFGFHRVRCWRTRRLLRTPLALAVLVAVSLVAVLWFSVYEN
FT                   TGVTEISSDRRFFLPAKYDEGEEVDANGKIEFRRLSSASTTALAPVEETRNGVDTVWFS
FT                   PNTSNFLDRNTSSLHSVFTSAGKVRVALPFGVHADTGAFVAQKPRLFAFLASWSTYERA
FT                   LTARGAQSADAAAVADINEELQVFARRKVVPVKHVEVRLLRQRASRSTWATETEAALPI
FT                   VGILPRESTTLVSAEELLVESAVDQEGLAPLVAAVQPGSDNKESTVVGIDTHLRVSPAK
FT                   GLGGGANQGAGGSTSPLPFPLLELSSVPRRRATSPESATPASPDTSPATALLKWRTSRM
FT                   TASSSGEALEITLDIAHPSRSSSAAPLRAEEDERTRPGARDDTYTAALEATVCSARLVR
FT                   LYGFSSSFSPADTHGGSADVSAAVEAGGLNLIPLNMSEEVELMVGGEMQLPSGGARLSG
FT                   VVPLLYLELSNNSAAGVQQGAGTARRQTVGLLWLHPASFFVSTMTLPSPTGGHEPPRTC
FT                   VRLRSTAGATGLYLLPGPTPVEVLRQYYTLTGFPTLPPRFLLGYHHGLRGAVATTQQAA
FT                   EDLSEAFRSAGAPLDSVWITDPAVAASDTPFTWSHSRFPDPLALQSNLWYRGRRYVVLR
FT                   SVPTIPMTTRSPLLLEGRRGGFFVSLSAADTAGWPVLSVDGVPSHVVDFYNPAARKWYG
FT                   DMLKYRRYVGSSNHTFINLQHSGPTVLSSAAPPKGKEALLCRPPGLRARGEQLPMDVGH
FT                   YGGVHHRQVHQLLTVHFVRATHDGMLRRTRYHRRALTFTESYFVGTQRYAVVRVETRPR
FT                   CASAVRPSSAAILTEAWRALQTAVHQCAQLGVLGIPFSGANLADGLVSRLLLLQLAKSA
FT                   STTTTLTAPLAGVAGEGGGDAGAVGANGELTVPPALSRGAMEEMEQLLVRWYQAGVFFG
FT                   AMYADESAAAVDATDPGVVVSLQPSATGPWWMRLPVTAATRQAIHANLHARYALLPYLY
FT                   TAAYHASEEGAIFLAPLAFTSSEASLLSQETTMPTCYAAGSALIVCPVTQPVHPPRDIS
FT                   RSHSTRSADCKGFFDLWTGAWHSTASSVARHPSWWEGVAQYSAQNRALASEELGWLAAD
FT                   DAVRLQDLPVAASLAPVLLRSGHIVATQNVVAPRASGRHVEDSEIVGDAHALHSTHVGA
FT                   NWTLTVALPPLPAAQGVAAPSPVLLAEGDVFWDEGSHNSQHRPPNMKPCSSVLPDMPHI
FT                   PANVHHCALHMKCLYEEAEASEATARLTVEVTQTSESCAEALAELVSHWNEEPQGFAER
FT                   LANAKAHRDARLHELQVAQNEQEDKGLRGGRGGANDSPDASTFTGEDLRGLHLPNAHDK
FT                   AARNDIWASYLLQRLRFLFQREEDAARLSPRSSTSRATTVIVERRSSTGGTPGAQADED
FT                   SAVRASVRASHDMPDAHVVLVHLMSDAQDEGVAGSVFGARKVVLEDGSVGVRVPPRHTW
FT                   RFTFSLMN"
FT   CDS_pept        1568533..1571598
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4110"
FT                   /old_locus_tag="LmjF36_4110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4110:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4110"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q104"
FT                   /protein_id="CAJ09377.1"
FT                   /translation="MSLRAIPRRLAGPAIHGRAQATALSSSPKKDQQQVAPLLQFPQFH
FT                   PTPFPQDKFLSIKSRSLETYTKVRGDVLQRCADLCAQLQRRHKQSGQSGRGTAALARPV
FT                   GEETSSSPAAGVSPELPAHPLTPHQAEELLLLTKKVEDLVHYQGFVLTDELVWRMLHLC
FT                   IQCGAPQLAVDGWLQKHVIAEKRGPPFPLFILEDLAATLRASLLPRLPESGASLACSSA
FT                   VIATSAGSTDANLSIAFEDGLAAAQRFLRRHLPHSGWPISDAVTTEFLGAAQTYTTHLL
FT                   AEHVWPVWQALEAMNLTFADLRAKNIEDEEEQDATNDEGGSGRIPDRGSSRMSRGEHGR
FT                   YPTWLPDAAAQTVAVRAALMSVTPLYSFHAPPSSAPPPSVAEGRRDSSKSANTASTRAH
FT                   ALLCSDPPFFPSETAAIVAPLRALLDTWLVLAQCAAETKDVSLLKALLRTVCLGFFTHP
FT                   ATTTGDEHDAAEPEDGVQLPPVCVNEAAWCQYVTPGSEQTKDAVHQRAAEQQARAMVRE
FT                   FINGSLSVLQYGLLCAEQEAALWQLHDTFALISAVAASLRNLHGPQKKRGSRSVITNDA
FT                   RLHRMSAVALAQPASAEEADGLLRLALPCALVSSFARGQQAAGDGEHASATAAMHTFVC
FT                   DALAHPAEMTAHPYAEAGLYVALATGDEALLAQAATVGMAMNNSGATLLLPHARALHAY
FT                   RRAATRLVTAHEGHKEEAPEDDAWDAWTATLRQSVSQATSGSGDADITQAQLVETCLTI
FT                   LTLGVARRQAQRAAAYVQCVQQLTTISAAEEGDDTQDDSHNSYDKAEAEKQRREAIEVG
FT                   WAQLYDGAAACAQDMLTAVEQLLDASNSADATASCLSPLSLSTLAVLTRVGVYAEEEAQ
FT                   ARRASASTTSEDFSKPAGAAPPPLPLSISLDRVLTRVVRDTCIRLRCASAASPTGVAPA
FT                   ATSSAVGNWVQWVLLTLMARRAWTDVLAVLRALDGEASGESAANVAGTSSTLLCSTTVD
FT                   PSVFAALYARAVEDGAARVCAFLRPRRERLFF"
FT   CDS_pept        1572171..1572725
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4120"
FT                   /old_locus_tag="LmjF36_4120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4120:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q103"
FT                   /protein_id="CAJ09378.1"
FT                   /translation="MRRTRLVCTATPEKFSILGTTHPKPKRNGMGRNNKMRSKPSDNVA
FT                   WYDKGPVEWLPRPVRLTYDQLDQLRDWMMRETIAGRTEEFNKIRHLHREWSQHPLMPVL
FT                   GDVEPKFPLNLYKQNHRAKRRFLVRWHKANSPTYWMWMPRGPAVATPLHRSSPSQFPEH
FT                   WKSLARTSSSSSSSGSSSAAP"
FT   CDS_pept        1573477..1574190
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4130"
FT                   /old_locus_tag="LmjF36_4130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4130:mRNA"
FT                   /db_xref="GOA:Q4Q102"
FT                   /db_xref="GeneDB:LmjF.36.4130"
FT                   /db_xref="InterPro:IPR009944"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q102"
FT                   /protein_id="CAJ09379.1"
FT                   /translation="MGRLDHRREDKRSCGGRVVDALCGVFSLRIALSIIYFILVVLLCV
FT                   MQDLSLFSTPTIRIMNIEASRIVGAKTFIAATWFKVDQSIYGANVTGRIDVKLWVTKMN
FT                   MHVEIPYGFLPQNISQVYHVQDLPCAEFRNFFRCMQIFSLLSIFTGFIVWVFTVSNFFT
FT                   RMFLPLLWLFLWVTIAFTATTVAMMFRVLCDGACDGEVGEIPPFTTLATPMGGFALAFI
FT                   SLQTYLVTSLMTVFL"
FT   CDS_pept        1577185..1577784
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4140"
FT                   /old_locus_tag="LmjF36_4140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4140:mRNA"
FT                   /db_xref="GOA:Q4Q101"
FT                   /db_xref="GeneDB:LmjF.36.4140"
FT                   /db_xref="InterPro:IPR009944"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q101"
FT                   /protein_id="CAJ09380.1"
FT                   /translation="MLIIRFVLLVLIFVFFVIALVGTVSLPLYSNRITSYNQDGKVEVS
FT                   LWKIVVGKVTVTGENSTNVPASTPVRINYAGCEEFRATFRAMQAFAIGGTVFGFYALLV
FT                   SCLQCFCRLKVKLPLFLFLFLAMLCELCVVFIGGAAYSKEFCKNLEKNGNLTTIIFKGA
FT                   GYKLDTAFILQVVALVGYAICTIITPFTQQLWCGKC"
FT   CDS_pept        1581430..1582194
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4145"
FT                   /old_locus_tag="LmjF36_4145"
FT                   /product="transcription factor S-II-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4145"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4145:mRNA"
FT                   /db_xref="GOA:Q4Q100"
FT                   /db_xref="GeneDB:LmjF.36.4145"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q100"
FT                   /protein_id="CAJ09381.1"
FT                   /translation="MVGQFVVGPTPPPPARCRFAQPPLPSFSPSFTRCPLIAVHYFVCR
FT                   HIEARLLNNAAAVITHATNAMSASSRAAKLQTPPQQQQVHYISDNVYSLGTLSCAVCGQ
FT                   TFPIHTNACQRSTCGWCGTLHEPGTHSALQQHHRAMRRTGDSVKMSSKVCSLDTSAALF
FT                   FTEKEVTAAVEYIRQTLGDTSPFGTAPGAAGGAKRAGITEVDNRIIEEAFCEMCGVHRP
FT                   CKTFARQTRSADEGQTIFFQCTKCSSEWQQNS"
FT   CDS_pept        1583088..1584935
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4150"
FT                   /old_locus_tag="LmjF36_4150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4150:mRNA"
FT                   /db_xref="GOA:Q4Q0Z9"
FT                   /db_xref="GeneDB:LmjF.36.4150"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z9"
FT                   /protein_id="CAJ09382.1"
FT                   /translation="MTKSATRGSSTASPAAANAASAKEVSSTIGDLAATTAPVECVLQI
FT                   GQPSFSTQLDFIKVNRAVASLERAVERLELLSLLDAAGPTPGREGSHHNANGTRTASSA
FT                   IALAAASTASFYPHNSPRGPAVMAGIAHDASVATAQKVAEVLAVTQQQRDCGHASVLEL
FT                   LAELRVLERRYGELLTQAQPTVLLHPGEPQLHPKCFAHVCDPSKAALQRELALVSNRLR
FT                   DTNRLLCTQLQDNPQDADNWAKVCNGRRELTALLREAIKELTVGYKEALQTQQLRQQQH
FT                   QANAVLDGGLRRSTAQTGVGADAHFSHMAFNGTGASGPARSDSRPSSTIGGGAVSTESE
FT                   SRASVFLKCFGSSLQRPRASRVVQQGPRIPLSSSYQQFAVKILQEEASQRWADDVLAKE
FT                   RALNQNVKQLQVDLVRERELKDKEVGERLSRISTLKVELRKLKTALQQRSEAAKACGEA
FT                   ATENLQREGAAEVRDVRKAIQQDEQLLSIGATTHEVFSAYLRERTAAMDSLAGEWEAKT
FT                   LHELKKKEAAKIDAEGSRQACAQRLTDLEHERDAQQELKVQRDSVQKAEEDARRRAEEQ
FT                   RDAEYAAASVLEAALKAMMTRQTISKLQKSSKKKKKAAS"
FT   CDS_pept        1586076..1587065
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4160"
FT                   /old_locus_tag="LmjF36_4160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4160:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4160"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z8"
FT                   /protein_id="CAJ09383.1"
FT                   /translation="MSKNKRPRLAKKAGKASHGKRKRATSLPAVAPDHRTPRVQHAEST
FT                   PAAPKSIEDVARLFIGVGRSSDNGDKAYASTESISLQMKKAKGSMKRLREGAENGTGGR
FT                   NSSMKRQKGSTTGALSFAITNNTVTLERKARRQPKVAERCEDDDDEEDVELSKAVQAQT
FT                   LSFLQHLNSKSSKTFWELRDVAQGKLSAASATTATSSSSQLPSSSRTKAAKGNAKGAKK
FT                   LADDGEELWRVGGPYISGDQADDTDESERECGRTSDSELQSSTSSSEPSWVTDSSEEED
FT                   GGGSDDEAESAPVAAGATSRRSAAEPPKRGGGGGRLFQGGGDGVWDED"
FT   CDS_pept        1587909..1588931
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4170"
FT                   /old_locus_tag="LmjF36_4170"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4170:mRNA"
FT                   /db_xref="GOA:Q4Q0Z7"
FT                   /db_xref="GeneDB:LmjF.36.4170"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z7"
FT                   /protein_id="CAJ09384.1"
FT                   /translation="MSSPSNFKKLQVVSLSKDFRNSTSVVEAQLPEEVPEGMVRVSVKY
FT                   AGVNASDLNFTNGSYFKNARPPFDCGFEAAGTVVKIGAGVANVQEGDPVVLMQYGCFAE
FT                   FLDAPAEMCIPVPELKPEYIVLPVSALTAAVALGEVGHVKKGDVALVTAAAGGTGQIAV
FT                   QLLKHVYGCTVIGTCSSEEKAQFLKSIGCDHVINYKTENLDSRLHVLCPKGLDVIYECV
FT                   GGQTFNDAVRHVAVQGRVVIIGSVSSYKSGEAVPFSHPSGTSLTMLLLAKSASLNGFFL
FT                   PQFHGVMPKHMASLLKYLKAGQVKLFVDKKVFHGLSSVADAVDHLYSGTSYGKVLVEIQ
FT                   "
FT   CDS_pept        1591299..1592699
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4180"
FT                   /old_locus_tag="LmjF36_4180"
FT                   /product="putative
FT                   UDP-N-acetylglucosamine-dolichyl-phosphate
FT                   N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.15"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4180"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4180:mRNA"
FT                   /db_xref="GOA:Q4Q0Z6"
FT                   /db_xref="GeneDB:LmjF.36.4180"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z6"
FT                   /protein_id="CAJ09385.1"
FT                   /translation="MTLGLVESSCNAAFAVAVHAPVLGLILLGSIVAYVGTMRYIPNVA
FT                   RTLLERNIFGIDINKNTEEQRQKFAVKRRAGQTEEKEFQKQAIPESLGILVGAVYLSVV
FT                   MVLTVCLRFLGTAGEGLDNPYASLPGPLMTITLMLLLGFTDDVLDVKWRHKIILTTLGS
FT                   LPLIMTYDGSLSVLMPCVFGRFGLPTMNVTKTWLLGLAAAQGEPTTTFRVTAPSTWFSY
FT                   VVSHRSYVKVSESGTVLIYLGPIYLVYLSMLCIFCTNSINILAGVNGVEVGQSIVIAVA
FT                   SVVYNLFQMRLERQATPALSSVDAVAADARDMRSDHRLRALLLLGPFIGVSLALWRYNR
FT                   YPARVFVGDSYTYFAGTVLAVSSITGVYSKTLLLFFAPQVFNFIISLPQLFNIVPCPRH
FT                   RVPTWNPRTNLLSNSHNYTILNVVLYLFGDMHEEKLTWAILKCQVIACVLGFVVRYVLS
FT                   SFLYDEVR"
FT   CDS_pept        1593747..1594778
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4190"
FT                   /old_locus_tag="LmjF36_4190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4190:mRNA"
FT                   /db_xref="GOA:Q4Q0Z5"
FT                   /db_xref="GeneDB:LmjF.36.4190"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z5"
FT                   /protein_id="CAJ09386.1"
FT                   /translation="MSSSTRDGAGGGGGSSSNGGVGLAVGSLADEWAFSNYHVSSFMAM
FT                   EVLATIVPRFVMDGVDCLGGRYGPFAPNYPIDVPLWLALYFRQTNTCAIQPPDYLRVEY
FT                   LRDVIERERTNDQGFESLPFYFYEIAKKLTERGGGSSSGGGGSDDGDTIPHVVEVIRLV
FT                   NEIHAMRQQKLKNLMTVFETEGSPMFIPGVLLTNIVCHELHFLRASFGIVLQQAASMER
FT                   QRQQLIRLPPVSAATPGRLSSTMGRTTLTSGFSTARTTTTLSSTGTPDGATAATDLTSK
FT                   MGSDSFLNDGVANSQVSALTATTSMTTAMAVTSDGETQPIAAADVTPLAQPAVKKRRTL
FT                   RQT"
FT   CDS_pept        1596509..1598938
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4200"
FT                   /old_locus_tag="LmjF36_4200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4200:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4200"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z4"
FT                   /protein_id="CAJ09387.1"
FT                   /translation="MFRKRDSSKEMEPEVVLLLRHQSRYPGDLLQGVVIVDIPFPSDIL
FT                   ALEVRVCGNERSILGGLFVTDKNPEARKTTYYEQFITLRGVDHDLLDSKRSLRNCRRIA
FT                   EAQGLRTGLNSAPRRQSVPAGDVVPELSASVIQSASEAAVHLIPGTYSYPFSLVLPDNL
FT                   PASCELYRGRDGHCVLRYHAAASLIMTSGKIHTSEARLRINPLPVQVQRWYQLHEDEQQ
FT                   LCEAAVGGGDASHNETESRAGVLSRLMSSAGTMRVDKAEWDAEIAPQRRIRHYRQFPED
FT                   QLIREAAVYAETAGERAERKKRRACERNARERGSLLVAAEATAMTDGRARILQNRREQE
FT                   GAENRSLDTRDGAADAMNESNDDAAAKVYDFGLEVPSSTGAASITGEQEYRNGRFHSNS
FT                   GGTNAGRRRALENRDKKKRHHHSHEKDAMDSPAHTAMVEKNVDKLIFTPPGGELPAPMA
FT                   VQRVNQTEAVSHKTAHGSSEEEREGKQPRGAHPHRRRSRFQPPPWNQEFSISLRSGFLR
FT                   TGKVRVLLSLRSPLVTVGIGKVGATVLIDNSDGSGAISRVKYSLVTQCYIRTKTEVYNF
FT                   PVDTVETSSDVSVEKGKVVKLPEVELPVPKSTPLTMLTEGMGTLTFLSVRFYVNTALKT
FT                   FSRSVSTEVVLVSGQDVLNCSRRLLRWTCFFRRRNGEDARDFTLRPPTINLSEKNSKLR
FT                   VIDGGIRGAAKEQRGPSLQSNDADTSITAASAVSRSMRILRTSQRISKAAPPIDVRLLA
FT                   KTLNYEEALFVPRDEDDGSSFPRHVDPLAGLNPFAAPVSDVISNLAEGDNYETLCH"
FT   CDS_pept        1601293..1604223
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4210"
FT                   /old_locus_tag="LmjF36_4210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4210"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4210:mRNA"
FT                   /db_xref="GOA:Q4Q0Z3"
FT                   /db_xref="GeneDB:LmjF.36.4210"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z3"
FT                   /protein_id="CAJ09388.1"
FT                   /translation="MESFDPFRVVGSICGPLPISPTLLYGTPVLMVATGRTFQLYKGKE
FT                   LAMMRGGPTFQDSVRAVAQAGKYRAVAEGPRLHVYVHHKPLWSSHHEAATKPSITLLLA
FT                   QDDLLFSVGNDKRIVVWELKTGTVLQAMSVENTETVTCLALLTGYTNKMLLATAEGTLQ
FT                   LWNFRSGACLWYSLRGNGSSSGQASRATADGAAAITALACSRYKDIVAYGTTEGKVVAC
FT                   NVATDEVITTFDHSESCAVTSLLFRTDKDGLLVSGTSRGEVVIWDLENRCMDGTLTRSK
FT                   QVRSELEALERPHVDVVHSLVMFDLPEYTSLLITGGADNALMQFRFDTVDGLGVLVRER
FT                   RGHMGSCTNAIFYNTDLLVTAGNDRALRVTHVFSDRASWELSQGKLGKRGREKNLGREA
FT                   VKLPPATALAAAITRNYQWPSLVSLHAASALACGWRMDTRVMEFKLSGIQTSAHTARAL
FT                   ALSDCGNYAVVGYSSGNVAVLSLQNRSVRHLFDADLGADRAHDSSVECVEVACGNTVVV
FT                   TAGLDGVIKMWDLWTGKLKAAIPTGQPMTKSCMHEASSLFIVAQHFTIRVYHANPDVGL
FT                   TVEELSTPVRALEGHNSPITALALAPDTYRYVASTSGDGALLVWDLAAAACVGQYRFAS
FT                   PALSLSFHPDALFLVTTHAGERGAYLWVNNIRYGYVPEVVRSPKANAVETLPWLHFPTA
FT                   HGAAEETAEESANGSVPRTSAAAALTEAEEEAREAAAAEANLFDASQDIALARRRQTEA
FT                   QQAALDAITTEGMQLAGVPQRLWFNLTVLDQIKEKNQPLLPPKKKDVPFFLPTTQELRP
FT                   TFLVMVSDNRKNDTENAKRRLMHADMEELTPVQEMLVNEKHDALMDYFLSLKTAQAIDL
FT                   ELKRAVDYVSGSSYTAAELARMQACVKGLLSFITAWLRRNKNVDFVQGLLADVVRSHGA
FT                   LLTRFGDALVPALEELAEVQNTLRHSVDHLVSYPACLAGTFSGSIF"
FT   CDS_pept        1605302..1607311
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4220"
FT                   /old_locus_tag="LmjF36_4220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4220:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4220"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z2"
FT                   /protein_id="CAJ09389.1"
FT                   /translation="MAASPFARHWVPQDWANCTTPTSASLLVPPRPSERAMLVMLQFSP
FT                   IPSQPTAIQTHAMEDACLFQPQINPRSRRLARHAPTLRERQEQDAQRRSAGREDHGEQP
FT                   QRGAPMPSPGPEAFAGDTESDIVESVWGLWRSVAIREARETEAALVRRVPSVNDDDRLL
FT                   QRRPRVVYVTAVLGMLNALGITSPRHDALIAKFLKAMAVEGGASEATKRDEAVDAARFV
FT                   YVFSTVWRAAVTHRTPRSPVSTRVSAPPRSPPAAQQHGNSPDGATMRHAYSREVSCRGA
FT                   PPSHMKAAPATEVGSSGGSGSAVSARSSSSPSAVWSSSEGGEGAAHSHTESASPLTSCG
FT                   GGDERRSDAAESDADFLRTNISDASSSIPDSSEKPQAGVRSEELSPMSVEPSAGLDPSP
FT                   EPCNPGEPVIITSARSSVTPRTHHCSPFAAASRLGSASVSRSRRMSSSLRVIPSDSHLL
FT                   SSTTSRELKRATKRVPGGLMRECTFKPVINSVYEQSPVSFSSTAIVQKRKPASTAPPTF
FT                   QPNTQQFHQARDSLARWTRQPIKDNSDYRGEAAANPLATGVETAVRRMIAARQQRQRSQ
FT                   SPRPSLQKGSHHSAPAPQSTVRAPVAHPRKPLLYVDVDLPQGQRDRLALYTGDDVQDVA
FT                   QRFSILHGLSESLCQRLETALTAELCALSVGKAA"
FT   tRNA            complement(1607643..1607714)
FT                   /locus_tag="LMJF_36_TRNAGLN_01"
FT                   /product="tRNA-Gln"
FT   CDS_pept        1608348..1611719
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4230"
FT                   /old_locus_tag="LmjF36_4230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4230:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4230"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z1"
FT                   /protein_id="CAJ09390.1"
FT                   /translation="MFALWRGHKLVHLVFFYKAHHTLFQHFSRASCITLYSAAKNKRTR
FT                   MSEDLFKEALQSLSKKGVARINCSGLDLNDHQLQLLITAMQNSPSNPEIIDVSNNSITS
FT                   AGVAYLMRYLATASVEAVDLRNNHIDEDGALALFPLFEKKTSVKLLDVRNNPCSAATAS
FT                   RLYHLSKTEKCTADVRSALLTGKAQHISFAGMTYGELEKELLRFLLHMENLQSVDFTGM
FT                   DLGTAGMITVGTCVRDTQVSALSFCRCNLTNDAVLSFFQAADLANQRYPNSFDFSSNIG
FT                   LSNDLVRKLISTTFDQSHCITNFVLTKTSVTPTYARLVQKECELNQENLAIKRAVVALR
FT                   NDSSDAQEINLQWDAPLPMCMNYLADYIAASSVIQHLNISNSLIDDTGLELLAEALEKN
FT                   TSLKVIELANCRITATGIQKLFAVLQKGICLVQEVNIANNNLDEGSVQFITAALSANPR
FT                   LKTVNINVNPAISPASLQEIAGLTMVNRAPPRIRSVLPLIENNSKDVVVLDFSGKDVIL
FT                   NDDSVWLLAQALRLNLTVRRLNLSHNSFGDTGASYLAGYLADNRTILELNLSSCMIGNR
FT                   GAQHLCEALATNQALQSLDLSNNMMDTDSLSALPLVLRDNTVLREFKLERTRVAPEFVE
FT                   QVKMACSLNRECAAVKRVYYRLHDGDASLTKIELSSPDEERVVDDQTVSTICTVLRSNT
FT                   SVEVIDLSGNRIGKNGCSALAVTLSECTCKVRKIILSKNPIDDDAAAELAACFPQTKTL
FT                   REVILYNTNITKIGMEALAKGLEENTSIVWIGITDDDTGDENVSLLMRNLALNNGPAAL
FT                   KRITLSIDAGVVVDDVDLSRPVDCSMDDSLCKFLCASLVCCPTLRSLNLSHNEISSSAV
FT                   PYILEVVETCPSLVSLDLSDNQIDESGAQQIIACLERVSNIRSVNFAGNLFSAESLERV
FT                   SQLVALNMGSEVLKKLYLITTRGEQLPNNIDLNGTTNSYRLTDEEVVFLAGLLQNSSTV
FT                   KSLDLGSNSFCDAGCIAIAEVLRFNHTLEALNLAGNAIGSKGGEALYFALKINPQLHHL
FT                   DLEKTAIPRDVLESISSLLHVNQTPYRAVIDMRGVKVHEVNDETQFRSTDYYVAQTVTL
FT                   DAAIEGCRQSEVKLIE"
FT   CDS_pept        1612533..1614656
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4240"
FT                   /old_locus_tag="LmjF36_4240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4240:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4240"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Z0"
FT                   /protein_id="CAJ09391.1"
FT                   /translation="MPSTAEQSLTPLFVLQEHTDPVLSCSFYPSEVYQRDESSWFLSGD
FT                   AGGLVVLWDLSTRRKMISFSAVTEAHRQLCGISQHGRNRGTSTTGDLIPENEVLLERTG
FT                   TLAFGPHSQSVLSVGFIPLSLSSPQPTAVTANSRGVADALVRGSDAEVSNSAVCSAVVD
FT                   HATRGTSEWAHPGRPRFRLSRRAPTRSVSSEQASSLSTGDVPDSGAQGFAFTPSSTICF
FT                   YTHCRDQRVYIWCLKRQCTDAPASSPPTRVPQLVVVLTAPQHGFCPVESISKAANPFTR
FT                   TYLAVPHESGGEVTVWELSWRQPNSARLTSSRELEEKGASDGPRSSSGNASVYEEEEEE
FT                   VNTSGMNPMDALIARAAAEERQQAKMKQKSTRVSGESDLDHPSPSAAFPDSVISRGERA
FT                   SILCYVDPAATTTSSNFSVRRLRTFSACPTFKGGMIMRLTMCHDAQHLTVAFESGHIVL
FT                   ARYRDADVIDMADEPGEVCHAGGSMSVARVRNVTRAFADSALACWWSGRRMLACSSEGG
FT                   MHCYDVSATAEGLLEAHLVWSVTLRKGIGSVFLQRNLVVAGCWDSTLRLYDARDGRLVS
FT                   ILSYQRETINEVRAAPPSIARVAAFGFDVRQPRLYAGQPGALSTKIPACIASNSKAVTQ
FT                   GNLPQFSESPLRETYVAGTPTPHSSSGSLAAEEQLVYLFASASKACTVALWRVDLGLVV
FT                   EQTAREAIAAQTV"
FT   CDS_pept        1619114..1621537
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4250"
FT                   /old_locus_tag="LmjF36_4250"
FT                   /product="protein kinase-like protein"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4250"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4250:mRNA"
FT                   /db_xref="GOA:Q4Q0Y9"
FT                   /db_xref="GeneDB:LmjF.36.4250"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y9"
FT                   /protein_id="CAJ09392.1"
FT                   /translation="MMKSYRPPASFQQGRYIPNKVLGTGTYGQVIRCYDNVTGKDVAVK
FT                   VAQSDAAYRRSALNEISALLCLKENEDSVNILDSFEDAGHVCIVSELLDRNLFEVLRHR
FT                   GFGPLSLREVRQVALRVLSALASLHNSGYIHCDIKPENIMLRRSTPVSSDSSSFMLGPF
FT                   TSENASSGSSNKSGEQNNFPNALAPGQAALKLDSNANAHNQLWRNTNSIDSLVGNTHSA
FT                   AFQDSDLNMGFSPRTGNRLGGYSKQQHGQRGSGDATAAISGAGMRYSSSLDALFSMPAA
FT                   AVGASGTGNSTRNDLRVNCNALGNKGIESQERTQFNPDANPYRRTCLIDFGAVRRFNEN
FT                   TYYDVQSLWYRAPEVLCGLPYTTAIDSWSVGCVLFELFTGKPFFPGESLQHQLSLIVQH
FT                   VGHPSQAALTLGCLATQFQLPMVYVSHDARREHVRQWILSSREAGLQRWRKHQIQKLQE
FT                   AHIAGNQQLWLHRTADVPNTKSEEDALLTATPYGESDVDGASEELELLVDLVCDLLNPD
FT                   ESQRLSCTQALRHPFLSNVSKCCSAAPCPCTATPAACFPAVSAAPAPIPCIMATTTAGQ
FT                   PVMMTASPLSVPMGCSPASPFVMHPVHSAPAATVPFTVASVESMVGVEMEVSTLGVSSQ
FT                   HQPAQAFSTYPAVAASTVYTTNSTGQVMQCTVPVFTQVAHQVAPNVGHAFLPLGMTAQN
FT                   PTGGTYCSPTTTASQQQYPPSGMSISPTFSPGGALVHARVPLGFTPTTGSNPAAVAAPA
FT                   ASVQPLGASSYVLASAGTVPCMHDYHSEMASAGMSPYVLCHFQPQHACATVMSP"
FT   CDS_pept        1637045..1638340
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4260"
FT                   /old_locus_tag="LmjF36_4260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4260:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4260"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y8"
FT                   /protein_id="CAJ09393.1"
FT                   /translation="MNSTTTISADPDGSSLCAASRISTPGTMSVLVPYKRRGQKSSMAR
FT                   GGASPQRRSPQPPYAGKSISTSASTLSSSVQPHGAGAASRGDQSRRGDAAPDGTLNAYS
FT                   SHPAAPLDRPRDEEFDAVEQRARMALESIATRDEDLEPSMGDHIGVLQSYRTACEARAM
FT                   YREAYLVQQVLRNLRLEEESRHVRGITEQQMEERRILEEAHRQEFREFHHSWNARIDAF
FT                   EEEQLEAELALLERQNEELIRFQEEMRNFQPRLLRYSRSLLESRLKQQTLAKQRDYVGA
FT                   QAQKAHAEAIEVEDIERFEAARMSLFERREYAARHRHQQELYALRTKVESRRLYLERYR
FT                   KQELDVLLQRYINARRSMESQQNIVRNKTGTLLLKHACNMKTDSSGTAVLVESAGSGAF
FT                   GTMVQRRQAYELRALQGSPDGASASVRDGSAM"
FT   CDS_pept        1640076..1644854
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4270"
FT                   /old_locus_tag="LmjF36_4270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4270"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4270:mRNA"
FT                   /db_xref="GOA:Q4Q0Y7"
FT                   /db_xref="GeneDB:LmjF.36.4270"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y7"
FT                   /protein_id="CAJ09394.1"
FT                   /translation="MQLLVMNNTQSSKAARSCQSRLLTVELPVTSPSDLVTCGVTRSYM
FT                   GDNGVAVVWVQRGVSGEGEEEVLSPGFAHVTVQREADNTGHSNLLLYPDERVVQCAPLS
FT                   RVPSSFFQSALAGSGSAACVVAALPDDATQRTISIVVLTDGSRVWRAELFADGTTAVSG
FT                   FRDEYRRNMLRSFCDGNEEVRLLDTRSVVADLQRLASPAASSAPSFADSGAEEERASPR
FT                   GSTWIRRLLGSGGRTGANAADDSDGAASGVLDVALPAVVRKRLYAAVTAVQQSRFVALT
FT                   RWNGQLEVYDTASGTLKLTRAYPIGILPQEILRPIDDNFSGLGAKAPGGKSALCALPPG
FT                   PLAQWAKQCSTTQLLHVVSCCSGGGGRACFWSALPPLAPSSRIVGLEEASNAGEVLAQH
FT                   CTLSVAPPTQSSFPLACAVTSDGRKMILVSDVGAEEDGHLLCTRTLGALTLRCDQAYED
FT                   GVATVVQVMEAANGAAFGDLLRTGRMHGYLCQGARMQSVVAQDNAVLMVERGPQTCRLY
FT                   TLEEAAPDAMRLANERVVVSVDEEDVYAMAHDMDGDDAIATYVGGALLRSHRVHYVPLF
FT                   EASLLLLGAAVPSTTHDTDGLALYWEGISVLQACPHGSRLMSDLLQDVILATTPIARLS
FT                   SLPRFLSEAHLSGYAAALQRDAAATKASVRAAIRMALLPPSTAAAGETAHAFYRFSRLY
FT                   ATHATLGELLSRITFLTTTYLGWQSTYSVSHALSSTGEDDAALSTADWVSHRLITALEV
FT                   LVAAYHAVPAAGADLVQLDLVDDSVSQPFSSAIVAALLPTLTDTAGCDDDSVACGWGFS
FT                   TLSMIQVANRLLRCGTPSTARACAVWVKQLAHRFPLLQHYQLLSLLETTAISTQSERAV
FT                   ALCERVCQALAREAPGDVTTALLLEGLLLTDISGPGSAFLQLSLDEVAAFLAADPTLGP
FT                   KLYAVGVLRRTITVRSLQTPMSHCVTHRYLYTTLAMCVEAVERMHRCTSVTAPTPTQAP
FT                   FSQLRRALEELQVDALLASAFARVSGGDVACGFHDIQTALDLITRHKCLPSYAELLQVI
FT                   LGHVVEVACASQANMNALLRATTIGAAQLEESLILQWYNYIARLPTKSATEVTEALRYR
FT                   AIMGLHRYLMNRHDYAQCARLMSSLATLIRCSPLRRSASAGISVSELAGLALHAAEMIA
FT                   PSAPVPETAAGEQGETGQAAPQGTLHDPALMVGSPLSLGYSWQPSTSASPAPFDLHSST
FT                   LGATARGPRWLTRADIPCLRRRLYQAHCERQLWRRGCTLDCTDLWVEGAPADAYQAGVE
FT                   KLVAALMQARLWPQAFRFACLSAVYDPCAVLVEWAVDLLRAPRECGSDEVAAAEAAHAD
FT                   LTAAWAELIGYCGEISNLENQFYAYVHTITAALTCAYSQVPTALLAAHRAADAYTAMTT
FT                   LFHVALMLRRQAEAVELGQQRNEEDGGDKEDADELSSSSSNREAGVTAADRDTEKRGEM
FT                   SLEDIRCNVWRAWCAAARIGIDMVAERQPRCAAAPDLYQRTAGAMTGAGEVMAEEDAAQ
FT                   MNVGVVVAGTVSAASSAARRTFSAFTAGALDPMAVWASELLRIPAYRAALNLVARGEET
FT                   VRQFQDLMGRPCS"
FT   CDS_pept        1646578..1649052
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4280"
FT                   /old_locus_tag="LmjF36_4280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4280:mRNA"
FT                   /db_xref="GOA:Q4Q0Y6"
FT                   /db_xref="GeneDB:LmjF.36.4280"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y6"
FT                   /protein_id="CAJ09395.1"
FT                   /translation="MKRSRQDNRRLGPAAAAMRRRDVYRDGRQAEEQVSIQKLFRDAVA
FT                   MQKFHSPNQSGAGARVMIHSREELALYRQKRRAELEESVRRGFKAIGNWIRYARWEAQQ
FT                   RDFDRMRAVMERAVPVHGENANLWRDYAELEESNGFAEHARQVWSRGVTALPSSVDLWV
FT                   KYLAMEQAAGQDQRVRDIFHRWLAGDAVPPCAYALAALYEAQQRRQAGCRDILRRCVER
FT                   FNTPASWLLYGATEQQVFGDHERAVRVLETAMHALPDEDLWGLEECRVPLALAEAHVAA
FT                   GNAVQARNVFHNALEHVADHPVLLEKVLASYSRFERLYGDGAHSEQVARLLTIQLYEER
FT                   LRTNTSDFDAYLTLYSLYRDQERESRLRASGSSNKMPEPVVGGNAAPASAALATSTAAG
FT                   ASPSRQVLERALQIPARDPYGAQQRAVLIMEYARACEADGELDAARRTLAQEIKNFPFD
FT                   VALCPRLWVEAAAMEERHGATAQARRLLRAGSQVTKDACLFEEAIQFEERQRDSVMEAM
FT                   HAAAHETTPPSAREVEEACAPYVAELRADYQNAIQAFPFDVQWWLRYAKLEEQQHEILR
FT                   ADALYGACIRTFNDEAERVRSFAQRYDLLSHVDAAWAHRIHLHTRRARALQRQASRRKG
FT                   NAAGAETARAEVAALQEELLHLYPTFLQDVWNAYRHEAVAWFSRYFEAGEGSGSGVLAG
FT                   AAPKTLPASLTPATARWSEAVEAVAGYMERMSAIKAGQGASTGATAALRAILKSMVEAE
FT                   RHAIRRSLGWTEQTTQFDAVQRAREWGELLLSPLLEEWSKFELTHGGSLEAVAAAMEKP
FT                   VKRRTRLFKARS"
FT   CDS_pept        1650408..1654100
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4290"
FT                   /old_locus_tag="LmjF36_4290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4290:mRNA"
FT                   /db_xref="GOA:Q4Q0Y5"
FT                   /db_xref="GeneDB:LmjF.36.4290"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y5"
FT                   /protein_id="CAJ09396.1"
FT                   /translation="MERTVSELVSQHGPTPHMGLLRCQMERRGRHSLKGYKKRFWVVDE
FT                   RNGWLEVYKNDQEHVPIEIFRAADIRNVMYSDDKQNRFFMMLVQTRGPRDIKFRMGSFE
FT                   ERESWSKAITHIMDVYSAINKHKNVLGMVLRRAKTVSEALGVNISIDSGRLLAEVPEDL
FT                   LQYVAEAVDIALVSVTAIVRSFKEEGADMPRSYILYVHAITEDQSPHQRKETKYSPEGR
FT                   TMTMNVCLLRVKSVRVSFVVTQPEEVFRLVQSSVFRNPVIEGWIESEPNCARACAAIQD
FT                   YLELPAERSSWITFQWGQHVSDSAKVEAFLQRFVTATFFERALQSVRDAVVRVERLIAD
FT                   TNAQTTAKSFTGGSLVAPARDGGCSSPFSERRQMTTLGVTVQPDSIVFSNNSLAATSTT
FT                   GGFGGAAGGGFHTHQPANPPLANNAVGGGSDAALAIRLIRENVAGLCIQLDKRVVEKGT
FT                   APPPIVTLHASEYEQHCRPAFLLVAKCHRVLPRKHHVTNDVLSEELYEVAYNAFLQQQL
FT                   SLLRTELNGIFHKQVKVVIMWDLFFRAAAGLKTPVSAEELPHLLRYVKDVCLSRLHHVA
FT                   QVLRHTRSDVPGHVEDHSYLYNAFCSCVGTVVVNFLPYTVSSDANVFEPNVQAGVLTDT
FT                   LYCAKEESMPSLMAALGHAHRGSAGKTTRVSLMGTGFHGVLLYAAEAKLGAWCESYFSD
FT                   PENATPDPRRQLVEDEFDSDTDDTSVGMLQDPDFGEAVAYERSAEIRPLTMQRVVNAIY
FT                   DSQRHAPVDLKIGSEDIMRAIHAFVSAFGDDKRPSKHDVARVLIINLQRLRQMYVRAVD
FT                   DETTSLLTFEQARQLLRDFCEYETNEQYIDVALREVPRLGTEPASPQEEQERSHRESHE
FT                   PVRTGEEEMDVDASDSGRLLEGNNVYPCSPRPRAMNEASLSVVSNGTTNIAEATRRGNR
FT                   RWSLSRRRLRSNSKRASTISASRTAKSPSARPALVTPGAMPNRSETHIHVLSITSDAFD
FT                   FASVTDVALTVLLPREARLARLAWRVGFVFGLENTGKSLIINSMRGIARPTVATVGLSQ
FT                   QVVAFDEWVWALNELGGRESFRKNWRYYALRIDTVHFLMFVLDVLNGQALDEARQYLKE
FT                   VTSHYHEVPLLVVFNNFREGHRRFDISEFEALIHLDKLRRRHGADVLSCVCDISVVHSK
FT                   NRQLPRTLSSTLRTLSSLLKARSKSENGGDGGAPPVPKATTSFSASVVGGAAGAAAAGA
FT                   GVVHS"
FT   CDS_pept        1657674..1659923
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4300"
FT                   /old_locus_tag="LmjF36_4300"
FT                   /product="trypanothione synthetase-like protein"
FT                   /EC_number="6.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4300:mRNA"
FT                   /db_xref="GOA:Q4Q0Y4"
FT                   /db_xref="GeneDB:LmjF.36.4300"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y4"
FT                   /protein_id="CAJ09397.1"
FT                   /translation="MTVKVASEVSLLPYGEHQGSFRGVVACSNRDDGYFSGENNYVDTS
FT                   IYTGFRYQCVEYARRFLLLTTGCVFANCGRASEIYAMDHITHVETGAQYTLHRHHNDGT
FT                   ATQKPAPGDIIIYPYHPELTPWGHVGVISFVDDNRVGIAEQNHYFGPFTSPSESYLDGE
FT                   RCVARYAMLTLDEATKTWRIDEPGAMPSAVGWLSYPDAPTREQIHAPFTPLPCAIKVRS
FT                   TPFDQDDHPFLTHYHLHKIFDIPSGCVRHAYGMRNGTAETLVGATSAAARVLRFTLHLL
FT                   FHRGRLGPAFRALPTNPLNATLPEGAGASTEACREVDALFKVLAEEDVVNATETTPDRL
FT                   RQAVATYFDIPVEWVMAMERDFAKGETHMAAVVSFYPNIATDSAALEAFRAARKRSGTW
FT                   AAPAVGTVPLTTAKASTPVAEEPLTLSYPATVEELPLKNPHDEAWHLATVNFGNARVMT
FT                   ELSQLNKVKQDLTETIALMTPSMRPFISTQYRMDFAGYLKVVEAVYGPRTGFTIVVSDD
FT                   QPMDGLLRELVSTVQNLCEHVEYPVRIVNEKDLTFVNGKLHATPSAISPEAGSHMTNIA
FT                   PSGAYDVNFVYALCEWPRILACREATHAALYRAAVDPASDVVFAKPLWSYLCSGAVNVS
FT                   DDAERAHYSHSPRSPSVRFFDVCRRLYLLASPTQQPKTWDLEVSEYKDSCRRIHVDAET
FT                   VPMHSPAHLNADSLMINLAGSCYMGHAGGTLSVESENTGIHVGHPAFLMFMFPAD"
FT   CDS_pept        1660662..1662290
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4310"
FT                   /old_locus_tag="LmjF36_4310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4310"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4310:mRNA"
FT                   /db_xref="GOA:Q4Q0Y3"
FT                   /db_xref="GeneDB:LmjF.36.4310"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y3"
FT                   /protein_id="CAJ09398.1"
FT                   /translation="MSATADSAAASSSFYLGTNPSPQAFAKYAKKHNIFLHPDVAFLVP
FT                   TKTMGMGVFAARPLHAGTVVISCPETSGVSPYMKEVATSPCVAALHASPAAMKDAALFD
FT                   VLVLMAELSRENSPWRPWLEVCPRMAHHFFDLSSAQAAVLGTESVMGGWTGADLGAPRA
FT                   VGDSAVVASPTLGLAGVTGVAQALGELRVMQRWATAQAIMAAFPDVWSANKVSFGLFSE
FT                   ALSQVLSRNFHREELPGREGPYLLPGLDILNHSFAANTAFEVRGGGRKHATAFTVVTTR
FT                   AVQKGEQVYGCYGRIGAARFAVEFQFVTKAILRNDLVRCSAASLATVATILQYWKAARE
FT                   TPGCTVDSSAITAYLQCCSDGAALAAGTGAMAWKPAFFGGDSAADIEIHRKEMEQRVER
FT                   LQRRGILYDEGLYLVRPYATWEAEEAAEPASTFRWSTPAAHEEEIAQSRRVLAATVYLL
FT                   TATKSVYNDVYHRVTADWEPPESAQISAAVRDFLHIRMVAAQLQHDAVCGVFVDSSRDV
FT                   VRCQLVQDVLVSEMETLRYYANSFV"
FT   CDS_pept        1663914..1670495
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4320"
FT                   /old_locus_tag="LmjF36_4320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4320:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4320"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y2"
FT                   /protein_id="CAJ09399.1"
FT                   /translation="MGKLTIKVRKCELYRPVSGGNCAVNPRVTVVVDGTYRFQTNIKKN
FT                   TFNPEFRDSFVVGNTHRLAVIEVSVHDVQEPSGLVLPGIGVLTAKRGLVRGLSGVGMDE
FT                   GEGAGASTAGPTGGGGSSGISSGTSSSFKARLPVLLGRCYISIERLVHHERKRRKYYLA
FT                   TPLPPSSATVTAGSNGCATAASVAANAIAAGTSPTTMVSDVGSSFLQQALPTGIAGTIT
FT                   ISLESDSLGEPPSELSLNEQLEAAYVRRLRRFLMSYDQPKVAMLDVMMAHVRDTTELGP
FT                   HSNSSRRYSNSNGTGTVALAANSAPASRSHKQDRSSAASATSGTTSLLRSGVDNVTSPA
FT                   CGASSLLMSSHDQVDSLMWNPSNNCPNRDLQLDPKRSPPSSNDAPPFVPTLRTHSVCLG
FT                   GRAELKADLPDERETFEEMMNRLCAEYHASEPGDFRVVLRVEGCTNIDKEAWNQSLIGS
FT                   DDVFIIFRSESEEFETNMVTLQDTVVWSEANTVVMDVVNPHRFYVTVILMGRCGSKTYE
FT                   IGRCNVSAAPLSNGYISRRNMFLCMAESVTRVAMNGVVHLLMRPVNFSLTPPDMAESVD
FT                   DFYYRLGRFFKRYDPLQLPLVDMLARARLRDHDTYMKDLVVQYGREPGTVRMLVAVESL
FT                   ISLRETADRDLSGQDVRVLLTMGSCGVRTKTFAVRQFAPTNVRENYVFDVVRETDLIRI
FT                   EVVNARDDNLVYGRVDFSCLNTQRSVMNKRDLYLVGAAATRDAYFSGIVRVSLYSDEVG
FT                   HNYEVDMKLEDAFTGRLRRYVYRRIPESLHRVNLAVATVFDIESFMAQLAVEYGDEDPT
FT                   YALYFTVVGCRQLRSGFGGINPYVVVRVDIDAYQTKTARANEEPDYFEFCEFYYDRPEG
FT                   MAITLVVMDQADIGKDEEVGRAVIPLANVQPSRQYNDWLPLLSEKKSGKVREVGTIGFK
FT                   YTVVDLNLVDRTRARIIKEQYRDRSARRPSLAKGGSESRPTSLAPSGIGGADFLNTTWS
FT                   TNANASSGLTHRWNTFKRYLLQAPIMTYSSRTLSMGNSAGDESDRFEQSMNESATLVMA
FT                   GRDASLFKSGRSVTSCLPTMNLMDLGISTVEEFCTAEVNELHSAGYSETDADLSASLEM
FT                   TYRPPTHERDTLTGSCFPINGEGGVQSGNAARMQLRVRLLSCTNLFKPGHSMPNPYVLL
FT                   ATISESHRSRVQFCTTEPRFDETFLFTVEDPKIDYLTVTVLTDTPYGLRKLGHCTLSMR
FT                   NVQCGTMRTRWTSLVIHPFEPTAMECGFVYLSLGAINFGINYLPSVEAENRLREQIREY
FT                   LTLHARRQLHRLEWYVGEFSQLESILLGGWFRDSGNDAGADDTGTRVADLEVTVLGVSN
FT                   LYSGGFLAEGSCVVKAKVDGQTRAKTRPITGAQGSFVVPEGQDPLRFTVPEPMTTLVRL
FT                   SVVLNGKTGAGECYVSLADLHRGVAKERTLMLVMDSRSSHAEAVGFIRISVFCSNYGSS
FT                   APAPTEEELALHSRLTRFFYYYIPTELAMVDVKYATTLNVAAYLNRMVEMYGPEPGEYH
FT                   LRFTVDRCRNLVFKNDNTPLHVFSIVRVGLQEFQSSIVEGHSECVFGESFDLIIGLPQQ
FT                   EKVELIVMRYYPSKQVELGRTQLELRALRRAEENIMELALVSNAGTKAAGVSGVLKVSS
FT                   FPIDFGCDGGVHVRTLSMLAYGLDGHSALAQTLCLFSSPTRTGAANTVSGPRSSAPSDQ
FT                   DTVKAPLDTERRTPPLSASRMISSSLHDSLRERGGTAPPTVCSSTSASVTIVGFAGLTM
FT                   RDAQIYIRVSEHDKTLLKTKPIPAEQLVALEASTATFTIDNVAANYDKQYTLKLGFRKL
FT                   LGAEALCHADFCVLRCPAGKTVEKRLRLYDVNSQYLGICRLSITLPPVHLPVLQWQHLS
FT                   PAVFEPLMDDVASLVSTYMPKDLRRLDLILCHAPDIRRLHCALRLQLAPSVVATVYVAI
FT                   HSVDLHSVTVRHSCVVTASVGNFTSEAVRRQPGSLQVYPYGMSKEGIFNLDFPLLRIDI
FT                   SATGPAAILTLCVCDRSSKAKSEEVGRTVVSLRALLTPAVFAMSEKVQVPLVSVSHAAN
FT                   RVHASLAGTVTFSLMPPAFESYGASVRFASSVVEGFDRAYVRYYTDRICRLLSHYDANS
FT                   LVDIHSRLYESYVSCQCWETGLPACLSELVVRWGPELDSFDPPPALKSRDGAQHSRMAA
FT                   MVRSKNKESGPYELTPNGERQPAR"
FT   CDS_pept        1673922..1678799
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4330"
FT                   /old_locus_tag="LmjF36_4330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4330"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4330:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4330"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y1"
FT                   /protein_id="CAJ09400.1"
FT                   /translation="MPSTRRSISSQPRRTGTVTADPASRSPTRSTCRTRQEKGKPCYEV
FT                   VETREEVTTYIVTANHVPAAAERSPSHQEHVPKGSGGRTQSCSGGARQEYPRLAYDGID
FT                   RAPRTNQSALEITGDSARRRPQFGALAADPDSHYVSAANRGGLTLSGNATSNSATRRHA
FT                   AGAHPSRSSRIVKAPVDISTLEDYQTPTRRRRSGGRYECDHGVGHTEAPPAGRGGSHGR
FT                   QRFSADVHAHENIDVEETETNCAAAAAAAEPYHFRVRLHKCRGVFADLKASCRPPPAVY
FT                   FAVHTVTERVHSGIADKGSYNPVFYDEFMFSSADPEHDALVCTLVAASSVNTSRGSGTQ
FT                   RDKKVAECVLALHNLAWQVERKVWVPLVRHPGTSQAYEQGEVLVSIYSADFGYDDVATE
FT                   EEEAACSAAIHDTLTQYAPQELHRLDWMTSAYVNKGPEALSQLRAFYRARTIEPVPVRV
FT                   TVRRVEGLTDEAGGPTRASDIYVVVGDGRVERRSKTVPYRRCATINQEFNLVFVNPGVD
FT                   TLSVTVFGNGRKLGEAVAGLTNVQAGKAKEVTLMLVRAAETGDASNGGQVTLTLQTEKY
FT                   SSPYRMSAKQEARLRERVLAHLWCYLRDDLHRLDAIMGSIDNEEVYMQAWARTVGPEQK
FT                   PRRLQVSVREARHIIADGGLQPRCYARITAGPTTVRTGLVTVRNGVATFKDSFRVQVYD
FT                   PAHDAVEVMIVAEDDGGEREISRVCLGVANLPRQGRVVRTLHLVSAATKRAAHVQGELT
FT                   VELLAEDFGLTGALAVAAEECTSFASSVHMQRLEAIMQRSSPEKLHRVPYMLDTAPPGK
FT                   AERVVEDEAKQHSSDVAVAPMTVKILGVKAFKPAVDFYVKVYLNNEPILRTGDVRGSTV
FT                   VTIGIKDNNEATVRLKDAPQAVMTFKIAQHRALRKTAVLGEAEVALANLVRGEKNVLWV
FT                   PFFQPAKASASGSGGESRRCSASCTSDTRGNIVKLKGNRMPNSNDTVAARQEQLPGASL
FT                   ARHDTAAASPVGILGLELQSNAFPETTVTEYKLDDESGRTGVSAQEAVTEDVTSLIAKM
FT                   RPSELPRVQPMIAQCTSLKSAHDELRTELSPRPILGTVYVNIESVDLATETGKAQEAQG
FT                   GVAVEAAYGSERQESRKRTGFANDALHQRQLYTQIRLDIPAKLDSAISGRNGAMSRSAA
FT                   YAKGAPALELRLIGVHGNEGASGAVLVPTGSVASGGAFGEGRKGAYHYDAADTDSDATA
FT                   DSYYVGGENNLHSYIRFPQNRGRLRSTTQPEEEHMGRPSKMRIMQQGQRQSDPHRNGGS
FT                   TVSLYSNHYQNIPEAQHSSHREEDGKRCLGGANNSYSYVGSPGQSFRHSVHGSERAPSR
FT                   HQVGLANASGSNRQPGSTSWSLTTASVPYKWSTPYRGEIGVVRLSLRALLTRPLYKIGD
FT                   TLRVPIVAPAIPAKLSNRARCSPAVNQRCIVGHVTLRLTLPAFEHVPESLRLGGHNSMS
FT                   KVVPDYVHYYERRIGAYLRSHNARDLVSFHYDLCERDVVSGCWPVSLPQWMQTLIKRFG
FT                   PETEYVGPVPSLPFVPEEWELVRQRADALRREREAALAPWKQSSKVGDDHTDDHINVYS
FT                   SRGASPSVRSRGNSPGRSAWADRKKGSSANGRLDAGEASAEAVHRL"
FT   CDS_pept        1681077..1682687
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4340"
FT                   /old_locus_tag="LmjF36_4340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4340:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Y0"
FT                   /protein_id="CAJ09401.1"
FT                   /translation="MSSYDAMSAVSSNGAVMPEINLHPRLMTHRPESDSYTGSARHSSR
FT                   STRAVPTNAELAYAGVTAQDGVVQQLSSRSEERGSLAGPREVSAQSNSGHRALRAITAC
FT                   GSIDEPLQLSEPHQGRAIRDTPREQKPQQHQSQPTRSISHGVVARNAAGAGSSREPIRP
FT                   GRSSCSSTPRIPSKHNDPYAHVTSVVQEYRQSRINALEAQYRVAHTHSNTSVSQGYDTR
FT                   QSQSASPRSLEARRNASAHSRASARPRDGSWRMSSVSSRTRQNSPLPRAVEEEYLRGGV
FT                   PRAALDAPHIRYAEALYNMYNSSSSSARRLACMSSMSSNMTTEYVPDVAKRIPDRFKYV
FT                   PPTEEERRLHREATLRALEEWRRRQCARENAHCKGSEDMAAGGAAVELRNRNPPKNQSG
FT                   TRSQQPQQAGHEEAAAWALQKGFDNTSDSFSGQARDSFTPSKKCSARKAKKIRSAAEQR
FT                   DDYPTNEGAGEWERPQSSVGKRSGTLISRRQNGAGLRASSRKGRKSPTESARVEDGMKL
FT                   NSFREKLLFDIAPPTVSIA"
FT   CDS_pept        1684158..1686827
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4350"
FT                   /old_locus_tag="LmjF36_4350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4350"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4350:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X9"
FT                   /protein_id="CAJ09402.1"
FT                   /translation="MGPVAASACSHMDDSRGSARFPQPRTPEPQRFQFRSLRWCPEAQT
FT                   PTAQHDGGAPYAAEEVAYMYADEEGVRHAPRTDVGHLTRPGAQDDGASPCTPRTVCQSR
FT                   MRQCAELANAHPFSASLRTAHASAAPLQQSPCSFTPSIADAPVVRRTRSLSCPSAYRSV
FT                   APARCSVGYGISSGGAGQSIGRPTTVLSGVSPAGVNVCGSPSAVSAARPTVPLHSALST
FT                   TALSTADEQGRTLPERRDGVDDLPACESNDVFLMHTYTTQPCATSTSVPQLTRLSVSSS
FT                   GHSPAVPTNWSIGRPTTLRCRDTDSDVHCNWGAIQGEDEEDKESLIGCATQVWRISAEV
FT                   QMPLQCSHGTRATEEETLLGAPTSHCGDHLTNGRGVFASSPPIVWQPAPLPASFSASQI
FT                   DLSGGGQDNAVLLSGAPVGSAEEETHNDNREVTRSNVIPATGDIAATESNDSFVGLEAA
FT                   PRKGYARSNSGTPPRSDLGSPNNAANLQAHGRAANGVSAGVELVYRAAASETNSHHFGA
FT                   SLCANIGSGCRARLGIPAEWRDHMCAATPQGRGVWVQVPGQLRESEYPASTTTAEAVAA
FT                   RLAHISIHTSPTPKRLAFEEEELVERVSGGGSPTLIPAVRFVADGAARRGACNEASVAQ
FT                   GAGGSTEVGLLGRGAGGLSSSGMRWASVFGDSGHLELCSSRIPSGLQLLRSRKRCLDEM
FT                   QATDTQERHADTLVTGGISDARDASYLVPDRVARMSLATPFENLEEDGDGDEEAVKRQR
FT                   REEQRRMRLQHLLPASPNTMDDLIPAPARALGTAVAPCSSVSSSHVRSTVHGIQSTQDQ
FT                   QHQQDRTRNDDPASWSQVSSISYVTPASQSTSMGLWGVPGTLSQGHHGGAVVCSVGSGS
FT                   QLLTPLPTNVMPQPSHKP"
FT   CDS_pept        1689262..1690494
FT                   /transl_table=1
FT                   /gene="RPT6"
FT                   /locus_tag="LMJF_36_4360"
FT                   /old_locus_tag="LmjF36_4360"
FT                   /product="proteasome regulatory ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4360"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4360:mRNA"
FT                   /db_xref="GOA:Q4Q0X8"
FT                   /db_xref="GeneDB:LmjF.36.4360"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X8"
FT                   /protein_id="CAJ09403.1"
FT                   /translation="MLAAVAVPSSSSSTAPGTNTAVSDYFLQKIHELRATQKRTLDNFE
FT                   RLEAQRNDLNRRVRHLKEEVQMLQESGSLVVDVVRVMGKNKVLVKAGSGQGKMVVDVDK
FT                   SVDFKDLTPNARVALRSGTSAIHYILPTKVDPLVSLMKVEKAGKESTYDEIGGLSRQVK
FT                   EIKEVIELPVKHPKLFEALGIEQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGAE
FT                   LVQKYIGEGARMVRELFVMAREHSPSIIFMDEIDSIGSSRLESGENGDSEVQRTMLELL
FT                   NQLDGFEASKNIKVIMATNRMDILDEALLRPGRIDRKIEFPAPDEAARFEILKIHSRKM
FT                   NLTRGIDLKDIAKKTSNCSGAELKAVCTEAGMFALRERRVHITHEDFVLAVAKVMHKDQ
FT                   DKNVSLKKMWK"
FT   CDS_pept        1695323..1702984
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4370"
FT                   /old_locus_tag="LmjF36_4370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4370"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4370:mRNA"
FT                   /db_xref="GOA:Q4Q0X7"
FT                   /db_xref="GeneDB:LmjF.36.4370"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X7"
FT                   /protein_id="CAJ09404.1"
FT                   /translation="MRMGSLALLSDIRTAYLAGYDAAQRSGETILSSSRGAIDRAKVTA
FT                   GTKDARQRLEEHLRLLCTTICISGEEYVRAFPANLYVPLLTEILTAAHVAQRSDGCVMN
FT                   PLSSDVCDSDVPSSFSVVKQPSHKVVLKSRSNKLLSSYMPALGMQAASPVAVFALRALA
FT                   LIADMVPSGSFAFCPSRSKDTIATLALYISEPDFLVVNEDLAEELLKCFRYVSMVTYDA
FT                   CIDARVPARTVEMLLVLEPHHLRVLCVQVVSNLLARARESDLEGVWAPVMAKLLESFDS
FT                   FLLESSLRLSAPETTTQVATDGSSRPTAATAAATTAFVTPTAVRSLTGKETTLLQHYME
FT                   AIAHAVDRLFVSVASMKAHMKLLDHMIRVCVQVLQLSLNIIPATCGEWLRSVALSPILA
FT                   FYLTNPPFAVPVLLQLRVWEAVCGCMLTLVDRRAVGTRASGAAAGVTALESEVAGGAPD
FT                   DRAAMQINSSAHTASSAAASSASLASNAQRGRGEGPALTTGPVLTTDVTTIPFIADELR
FT                   LLPLLEFLLVLLPCACRGHSHTDFRHVTLPYFGWTWEDDFHNETECNEAISRRLERIYQ
FT                   QTRSCRKHELFAITHGKQRVFYIDFLSKSYVSERRERHCLHRKPLLTGYMHGTQDALLR
FT                   GCTCCASEPAPRFSTWVNRNYMQLRTADTEAGGRRGESLSSSSSCASSGDAADEEDGSQ
FT                   APGSTPQSSAMVRASSSLSLRSSSARDRGRGHVSSSSSSHLRHQINTLQMPDVHASDPD
FT                   DGDGNRDTATSPSASRRSRGSGTTREGSGGAANVHHGNRLPHTAYSEGDEVNADDEDCY
FT                   SSMNGHQGESQQLNPRRRGGGLGFLLCRCDSDTTASSQGRSRQIRMRAYLPETPPFPHH
FT                   RHDSLAITVLPMEAVLESPGERLQADLSTRKSFLGKGVLSSLLVTVVPALLSVLDNCVN
FT                   PVVARHSVTLLLRCLSLSANLRTQVTGESIELFTGSCSGEKAAAAAAASEVSDKSGWRR
FT                   MSFRKWITGGSGSKPRGWQRAEWEATQAALQRLAPSLCEVLVSLYVADSVNIVAERQET
FT                   FGYVRDDLLMADELARVGLSKDFFSFQLALPSELHVCTADAITLLLHLFPSVKPSASAA
FT                   SAPKLKALKKSRKTSNLHRPPRHSISGDKDAGVLASLTQSMSSSGSSTKTSTAGQPTTP
FT                   AAQAALQRQHSQDLRDTVASLALSETPVLQYRTPVSQGGQGHVTKPLSPTQRPAPVPQQ
FT                   GSADANATNSQPPPLLSPTTLSRPSTMSLSLSASESYSASVDTVQDCLSKASPADSRGV
FT                   GGAGVFTLHQSTLLVSYASQIVRRSTKACAAAQQIHESMNHKTFYTRVVIGSPEPCDGG
FT                   ALQLQSRELTLRLFPDSRCPYHSTFLACTEAFFHASQALLMALLAAGASPPARSGATAA
FT                   PSRDLMAQPGTAVFSPAVVSEVPSAAVARLQGPQPGRQRPSACLTVRPAESAHTSAPVQ
FT                   SQAPSHFKGGEEFAVGVELPVIPATVNAGAMQEAIDRAMEDTTGLYRRLPPALRGLLGF
FT                   YDYCKQCNIELRAAVVETPEILGEMATHLEKWLASRARQREDVECSNASFALSLYMSNN
FT                   SLDSSTSRIVDALLASQQQLHLDSTARGKLLCLTADFATTIGRDLGLATLDVAPSVVMK
FT                   QPCSFQKRAKRVKTFDAIRLLLWRPLSIFLDPRTPTTAKQLLSGSLSTADAASVAWGEA
FT                   AGAEKSVVMVGCTELRVVTGVKLRDPMMSVLPIITMGLLAEAVAAQVQLPPVSAFSRSF
FT                   TLKSSQLSPSPRPLHASQERQSLSESDSGRGGAESSCLKSENGFEERRPDSTATATTAS
FT                   ATEPPISADRILFFLNDTPLFSPMTTLLDALTAFAGSGASLRDLVERQRRSSVSVDAHS
FT                   SDISATLPTLPFWTVTHVLKFVVLAEPLPSSLILGLTTTASASSATNCCCCCGCDGLRP
FT                   AFLCSPKHLFDAAPSSGPLALYSALSTVMREEVGNSLAVLESNQQRLSSAVVHELYHQL
FT                   KMFMLPPLLWCCGIGAAAQGRTRGRVVGTAATLSAGAFPLPSYVLWRYPFIFSAEMRLS
FT                   IFRFFISAQRSLSYEEAKHLLQHYRHLLVRHAAAEEARATASGADGDTEETLNIVGLQW
FT                   LSEEVVRRRRVTLTVQRRNILCCAEELIRLATCNVTIDVAFEGEAGIGNGPAMEFYEMV
FT                   AEELLDPKHGLWRTEPIPIDEPADSSSLRAAPPPTRSANPSPRTAATGVPQRRRPCTPL
FT                   FPAAKQTPTSLHYWKLLGVLLGRLLVIGTTSSLNFHPLLLRRLRGESLTSTATEASQNM
FT                   SQVDAALEFTLHRLETMNAGSLAACELFFTIPVSEADGYAPGTVKELPLIPGGADRQVT
FT                   VDNVREYTHSLRAYYLHTVPDLALLYLRQGLQLTVNPLYLQLFTVDELGRLLGSPLDSK
FT                   VWETREQFARDVEAAHGYHIKSDVVQYLLDIVPTWSAQMQHAFLKFVTGSSAVPYGGLT
FT                   QRIKVVRRDVDVSAADLSVTPTTHSFGISAAGLFTTSSFAGGGVNYDNSLPTVSTCFLY
FT                   LKLPRYSSRAVLQDRLLFAVCEGQRFFSLT"
FT   CDS_pept        1704508..1705989
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4380"
FT                   /old_locus_tag="LmjF36_4380"
FT                   /product="putative alternative oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4380"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4380:mRNA"
FT                   /db_xref="GOA:Q4Q0X6"
FT                   /db_xref="GeneDB:LmjF.36.4380"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X6"
FT                   /protein_id="CAJ09405.1"
FT                   /translation="MHKTPLFMQMMMRLHIRVALTSLSSSRRYVSKGGGHLGTSRSASQ
FT                   AASSASCSASVSAPSSNAFGSSSVRIKPPSYLYRAFMGHSTPFAAIAPPLTRAGITQLE
FT                   REPLAHSTPGRINDHICIGMVKTLRWLADRAFRERYIHRATMLVTVAAAAPAAGSVAAY
FT                   LRMFFRRSNSSNACTGDSQMPTTAEASSPFLAFGSSPSPGAAPPIPDACRAFAMARPSL
FT                   YMSTSSATMEGTGPRPEHSYVDELRGLLAQCESHAVHYQVLSCMAEITLLERSLVLLLQ
FT                   AVHFTIYLALFLFYPRMGFRLMAYAAEESSVVWTQMVNDVDLGKIAEPRVPQLALHYWG
FT                   LEGVFTAQAAPPPKTVTLQEQEAVLYKTSEGLVAEQIPVADAPISGASPYGSYNGHRSA
FT                   TPPSRSADHVSVPFAAAASCDGSAVDRKESEERVVNTSDPGAGPGLSVLTLRDVALLIR
FT                   SDEMIFRDLNHELANKLDMQPSWTQRLLASLGGEK"
FT   CDS_pept        1706956..1709550
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4390"
FT                   /old_locus_tag="LmjF36_4390"
FT                   /product="putative gamma-tubulin complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4390"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4390:mRNA"
FT                   /db_xref="GOA:Q4Q0X5"
FT                   /db_xref="GeneDB:LmjF.36.4390"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X5"
FT                   /protein_id="CAJ09406.1"
FT                   /translation="MSSTTDWTRFLAALEKRGVRFDQVQYATDRQEVIRATGITDALSI
FT                   AVVETEWQRHCNGGRATSGAIPPDHQGVSASNPAPARTLAPLLSQPAPDERGPVTSARA
FT                   SNDGVAGLPTLHELSQLTRLPEELQDTVLATEVLAAAVGLGGLFLQYTPAAPGTSSGIS
FT                   PKEGFQVSPLVPASMRSLCETVLPVADAFMALRCIEKAEYSSCSLVLMALGEVVSEINT
FT                   SYAHQVSKLQLWSEGRPMPLMGVVSEILRVGHHVVRLRQVLPMDLICSALAEAAAAAAD
FT                   PTSSTFASPSTGLVGPRILNHLCDQVNKYSGSCEDHELLTLLLRRSLVPYLRMLQRWMH
FT                   SGVLDDPYGEFFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPSATSAGRDGELGAS
FT                   GASTASQGRFGLKRRAAAQQDVVAFDRRFSLNKSLVPVFLNTPSRIAKMAFFAGKYCCI
FT                   LREYGAALPAFRPASVPGGAGAAVGSRPDGPGDALLTWSGANQLQRQVQESFEISSGAV
FT                   IQLLFSPSVDLLGHLKSLKLYFLQERGDWVVDFLDSAESLLAEHPDRIKQHSMQVLLQA
FT                   AVARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTTAAAVGEGATTALPSRRS
FT                   MGGSGGEVDARRSLELLQLETDLQWPLTLVLDGKVTHRLNIIFRLLMWVKTCERHLFEL
FT                   WYTNEILGEFSAAYGLKHQFVQFLRQFQFYAAHFVLEPLWSRLVARIGQADSVFAISQA
FT                   LTDFFDGAETGLVLSSTQRFRSLAHILELTERFCAVGMHSSTATMPLIEATLHSVEDQF
FT                   LRALSELASPIGPDYPQLVPLLTWIDFSRFYDQNNVYHVQHGAASSAAGRSM"
FT   CDS_pept        1712602..1715496
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4400"
FT                   /old_locus_tag="LmjF36_4400"
FT                   /product="ATP-dependent RNA helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4400"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4400:mRNA"
FT                   /db_xref="GOA:Q4Q0X4"
FT                   /db_xref="GeneDB:LmjF.36.4400"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X4"
FT                   /protein_id="CAJ09407.1"
FT                   /translation="MSLKKKTFKQRIRKNDMKQRHQIGFGLRKRMGAARRIRNRYDSVD
FT                   DGTRPMEMIVSEIAEGTAVPSQEAVLDPRSLTDLLLRPAESPVSNNSASASANVATTSC
FT                   AVASKSNGCSSALWKRGSSKSSALLTSVPLASEKVLPSLPLAPDDPLALPDTRVFEEEE
FT                   RQQRLAREAAARQNENKNLYRHSGQPYLFWERVGLHPALLQALRDLHFTHPTPVQEEVL
FT                   PNVLASGDEGLARQRSSEADKKSKKHKRAGGAADSAGHDVVVSAETGSGKTLVFALPIL
FT                   QDLLTTLDTERVSAVTPTSSAEAVHEKATGQASSDAAVARAELKAKRQKRIMHSLIISP
FT                   TRELALQIDAAIRQLTKFAPQVVVGCVVGGMAQERQQRVLNRHPHILICTPGRLWDLVQ
FT                   KNEGCYLGHSASRRLHYVVLDEADKMLQSGRFAELQTLLERIHCEVLPAGFAQDREEGA
FT                   EPGEIAVESGRWDPDTESFIPFDKEEAGATKPKVKKLVAETVTEAGGAPVETMKGKKRA
FT                   REAMEAAAEDVSSTSKTKKAKKVTADVTPAKSRKTAKTSAKQAAGLKEEEDEEAADEEE
FT                   TASKYGNINTETEHGGARHRKDEPQPIPMPPEPAAGHRVITYVTSATLSLQTNYERRDF
FT                   SARKSIIRTSNADVLTKVLQQLEIKLSNARVFSLAESANVAARINETYLRCPDNSKDLY
FT                   LYYFLKTYHDDRAIVFVNAISMLRRLVKLLEVLGIAVVGLHASMQQRQRLKFIDKFKEG
FT                   KIHVLVATDVASRGLDIDGLKYVVHYQVPRTTEAYIHRCGRTARCGGTGLSVLLVNAQE
FT                   HMSFRKLMESLGRKESEVETFAMQATIVHQLHSHLRIAWQIDKLQKEIGKSRANNQWVN
FT                   RMTKEADLETDDMFDDTADAENREKQKAIRILQRELQLLGRKFTGQYGGKGAFRTSAYA
FT                   LGAKQAEQHLKERADRQTIRVASKKKKFAADGKK"
FT   CDS_pept        1716678..1717262
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4410"
FT                   /old_locus_tag="LmjF36_4410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4410"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4410:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4410"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X3"
FT                   /protein_id="CAJ09408.1"
FT                   /translation="MRRAGWCAVALTAAVVVGTRVSQALASPSSASSWSLCDCSHVSAP
FT                   CRFHHAVGLLGRTRFTRFDLRKHEMEKRRLRELEKAGIDPVDDDDAPWIAPEEQQRLDE
FT                   EEERRRAEMEEQRQAFMKKRAEEDAVKRQKFKEFRAKQIAMSRHRKVAAAEKKEEARQH
FT                   RQQTSRVEGAEEANAAEDGADAEGASHHGTQ"
FT   CDS_pept        1717982..1718371
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4420"
FT                   /old_locus_tag="LmjF36_4420"
FT                   /product="putative 60S ribosomal protein L22"
FT                   /db_xref="GOA:Q4Q0X2"
FT                   /db_xref="GeneDB:LmjF.36.4420"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X2"
FT                   /protein_id="CAJ09409.1"
FT                   /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLG
FT                   NFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKDLR
FT                   DWIRILATGKGTYQLKYFNIQDQEE"
FT   CDS_pept        1719757..1720866
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4430"
FT                   /old_locus_tag="LmjF36_4430"
FT                   /product="asparaginase-like protein"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4430"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4430:mRNA"
FT                   /db_xref="GOA:Q4Q0X1"
FT                   /db_xref="GeneDB:LmjF.36.4430"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X1"
FT                   /protein_id="CAJ09410.1"
FT                   /translation="MLYISSGLVGRKAMSGELSPEEDTSGAKVLLINMRSYQSDLLDQT
FT                   QRSNVDHRRFFLDILQCNEDLHRPGVPSFDVIQLEKLKLSADHTHEDWLELAHLIKKEY
FT                   HRYRGFVVESGSDNMVTTSTAVSFLLENLGKPVIFTGSLIPGHRIYTDMTRNIILALAF
FT                   ASCSQICEVCILFDEMLYRANRAIKMSLCSLRPFDSPHFPPIASMRGGVLIIHKVLLRP
FT                   HPTGRLCIKAELSTKVLTLELGPGAPFEFFRAAIEYTSAPALILRCYGSGNGPTRRDFM
FT                   KRLLAIAKDRDLVVVICTHNRYGVVALSEYEAGRQLMGAGAISAGDMTQEAAMVKLKYL
FT                   LGLGMSPEQVRKYFAVDMRGEVSTPSAKL"
FT   CDS_pept        1722016..1722864
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4440"
FT                   /old_locus_tag="LmjF36_4440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4440"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4440:mRNA"
FT                   /db_xref="GOA:Q4Q0X0"
FT                   /db_xref="GeneDB:LmjF.36.4440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0X0"
FT                   /protein_id="CAJ09411.1"
FT                   /translation="MGSSSSRQTPLPAGSADTAASAEVTASTTDYQEYIKFRDQLLDFA
FT                   LGESAFDYTERLFAQKPDSPEVMALLAETAFLYDKTKNKVSREHWCDRLDLLQRGVDVS
FT                   RKCINENKDYGPCYRTYVMCATREAEALYYMKSFTGLGLVENYQAIMRKGVKGMELLPT
FT                   DAEIPNTLGALCARCCFRWYDPSRVYAWFYGLPPTRRLRELSVDFHKKACANDPKNLEY
FT                   ACRLAQAYFQLGDLANARRWYVKVRDEMPPQELKDEKWQGVAHTQLSTAFVKPKWNVPF
FT                   A"
FT   CDS_pept        1723999..1726029
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4450"
FT                   /old_locus_tag="LmjF36_4450"
FT                   /product="putative mitochondrial intermediate peptidase"
FT                   /EC_number="3.4.24.59"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4450"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4450:mRNA"
FT                   /db_xref="GOA:Q4Q0W9"
FT                   /db_xref="GeneDB:LmjF.36.4450"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W9"
FT                   /protein_id="CAJ09412.1"
FT                   /translation="MLRRLVSCASPLRLRGCGAAVVLGNGRFASTANASAAPPITTTKA
FT                   PTYGTVPDIPNLNFLSSPDNLLNTVDGTVDVCEALLKEIPKAKTPQAKHDLIDSTSNVL
FT                   CLLLDPCEFVRQIHPDENYKRGASLAFQKGYEYMCEVNSRRDLYDVIKELDSQEGRKGL
FT                   TPESVKNVVQLRRDMENNGIHLPDAQRAKVTEMNIEKEELAMRFLTEQGSANPFGTLRY
FT                   LLQCRYELAQLLGFESYAEQQLRGTMLENQENVWHFLCSIASKYRQQAEAEMNLIRKHV
FT                   GEVRNRVNITDEYRARVASSMRRDAEPENALEYFSVANCVRGIQCLCSEVFGVKLEEVP
FT                   LNPEEVINNSVKKFHVYDEHKRFLGVIVLDMYTNEMKYCQAGHLTLQLGCVPHQEALAT
FT                   VGLRLPKRQYPVVVLTANVGALKPAQRRPDGTYDDESTLMQPNEVTTVFHEFGHAMHTI
FT                   FGQTQVQNLAGTRASIDYVETFSQLFEQFLSSHEFLKLWAHRINTREPISFDIVQKRNS
FT                   AANMFKHLDMLDQVVLSAVDQALHGPQPLTVYFPHGDQGHVGKRTLGDLGDYGRGGFNM
FT                   ARALIQVAKPVSVAEPTETGVLSTLSFEHLSGYPGGYYGYLYSLSVARRIWTKKFERDP
FT                   LNRDAGRELVEKVMCHGAACDPRETIEKYLGDNLTDIDIWA"
FT   CDS_pept        1727428..1727910
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4460"
FT                   /old_locus_tag="LmjF36_4460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4460"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4460:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W8"
FT                   /protein_id="CAJ09413.1"
FT                   /translation="MMRSSFVHKAAAAAAGGGMTATSSDHKMASLHKLLTGEVQFRNNA
FT                   LLKTCNIEHNFGATWKSDIEAYAKCLPADERSCLERQVARVMLTRYTTRELAEYCGEGP
FT                   EHVDAVAREANIAQAKAHAQQYGADKLEAYVKAESKNAGWSEAETKSFLDAVKAAK"
FT   CDS_pept        1729428..1730255
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4470"
FT                   /old_locus_tag="LmjF36_4470"
FT                   /product="putative chaperone protein DNAj"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4470"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4470:mRNA"
FT                   /db_xref="GOA:Q4Q0W7"
FT                   /db_xref="GeneDB:LmjF.36.4470"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W7"
FT                   /protein_id="CAJ09414.1"
FT                   /translation="MGAVKFQLYKTLGVPMKSSIKDITRAYRHLALKYHPDRNPEGVEK
FT                   FKSISNAYAVLSDPERRAAYDLTGFLSDSADSSHAMSDEAARQQRSAELADQVRTFFAT
FT                   YAGSAEERLDVVRGYEKCRGDFKKMVREYLLFDNGVEAEVQRLHRLVSTLIELGNLSPT
FT                   PAWKSTSTPEALLRLEKAMHRERQEAENVLKDMAGSGTGAAGAADGDLSSLQVMIRQRQ
FT                   QSSYESMLNHLESKYVTKKSNARESSKRTREAAPTARKDECASKKHRKASHHR"
FT   CDS_pept        1732070..1734418
FT                   /transl_table=1
FT                   /gene="AAT14"
FT                   /locus_tag="LMJF_36_4480"
FT                   /old_locus_tag="LmjF36_4480"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4480"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4480:mRNA"
FT                   /db_xref="GOA:Q4Q0W6"
FT                   /db_xref="GeneDB:LmjF.36.4480"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W6"
FT                   /protein_id="CAJ09415.1"
FT                   /translation="MQSLATRSSLLVHDVRASQRQSFAGRISHRVASRLSLAGPPVEAR
FT                   TGTVAGTIINTLCSVIGAGVLSLPLALYFSSVIVGLVVLLLFSSFAAFSVYCLVVGCDA
FT                   TGRYSITEVIAFALYPPQLWEEYLRKQGAAKETAREEEQHAARPQHMPAPAPSGVRSSS
FT                   RNSESAVATPPPTEAAPTSADARLHSGRGEGVASGEEGSEDTLPYLRRHGSHRYDRRRD
FT                   DGQSCAEAARTKGCTTRDPDAFFLVPSTSTYARLRDAYAREEWRRRRYRRIITALMELI
FT                   LFCSNYGALVIYSKVIADSMPPVVSYVTHTDGFLVSKYFWLITGGAVFFVLSCSRNMEE
FT                   LKWSSLLGFLTILYIVVLILYRYHTQKRYDYPHVDPRRHGKVHWLRFSVGVLQTISTFG
FT                   LALSYHYNVPYFYKELQDRRPYRMMQSLAVAFPIVVVCYAVTGVVGYVTFGNEVAAPKV
FT                   GGNIVLNYPKNDLLMNIGRLGLFVHFACVFPVLSICTRRGLHRLTMIALTWADQSALMM
FT                   EAARASGAQLTEAERGAEASTATAVLTNGAGIEDGAHVCGHIPGETSPLLQRRGGPTPG
FT                   YEVFANSSPPHLAILGQQYNAESPVSGRRTSDAADRPRDTLSADASGTEQVCGSQPGSE
FT                   QVSTVDVDRDVGSPDQTTMLAIVIEAAFLVITSVLIAGTVSGIDFVIHLIGTLFSIFIV
FT                   MVAPGIVGWCVFSPSGPFGSASAAVAAYSGGDRELSGAPVSGLSSRFRLIRVKQLMCLL
FT                   NAVLGVCVTGVGIATLVYETFWGKPIPAL"
FT   CDS_pept        1735616..1737160
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4490"
FT                   /old_locus_tag="LmjF36_4490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4490"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4490:mRNA"
FT                   /db_xref="GOA:Q4Q0W5"
FT                   /db_xref="GeneDB:LmjF.36.4490"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W5"
FT                   /protein_id="CAJ09416.1"
FT                   /translation="MTILLTCSSEQRVAPLSLACMRCRMAALRRAAPQPNALFLGAPLF
FT                   RPTSSLMMSVRCRSDSGFAKSRPVKYVSTEAPELRCGSSSAEAGSYETVNDALSADYVG
FT                   GLSNVTAEKFRGMQPVGTWERGDGDGESDKSVNSSAEFMEVDFTSDEKLRKLEKLYRGA
FT                   HQGDKILSTRERQLFSRMIYEKFYKVGVQSVVDPAILYQASLEVHWVEEWAAGRARAER
FT                   WSEDEARRQVKRSLLERVDLHKPLSYIIGSQPFFGCDIHCEAPLLCPRPETEMWTHWMV
FT                   YRHLARAERSTPATGFSPAVSPIRILDVCCGTGCIGVALAKHLPSAVVTALDILPEAVR
FT                   VSRENAMRNGISPERYSARESDMFGCFLEGRVSGPPGKSANLSEDRPLGTVKDAYAGTY
FT                   DVIVSNPPYVLPQQYVDLPCTITHWESKTALVGDDYRESRQYLYFKELCVHGAKLLKPR
FT                   ARRNDMLRDAPNIAIEVGLQAHMVADLMDESKLWRDVEVHLDYAQQERWITANSVH"
FT   CDS_pept        1738214..1739017
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4500"
FT                   /old_locus_tag="LmjF36_4500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4500"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4500:mRNA"
FT                   /db_xref="GOA:Q4Q0W4"
FT                   /db_xref="GeneDB:LmjF.36.4500"
FT                   /db_xref="InterPro:IPR021298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W4"
FT                   /protein_id="CAJ09417.1"
FT                   /translation="MVLLECKRLPKEEYSRDYDAFIASVPATTNIGEATDAIQKMQNTR
FT                   VRLTWMMAAAKQMIKDCMVDAEQQHYLTGPIGDTERYLSLERTERRQLCVQSELDALVE
FT                   AFKGGAMILFPAECSGSDACQRLAAILDSDTASDVEKSKAHRILSMIDDGATNENTLSG
FT                   RAVMWWSAKPLARDSDFVKYIGKNDKTKITVKLAAEGSVAPPREPAVDVKAQAELMQHF
FT                   YRKQEEMKKLVEDEDISFGNSAWANPHGLKNQLQGLDSIHYKGAF"
FT   CDS_pept        1739978..1740574
FT                   /transl_table=1
FT                   /gene="RPL18"
FT                   /locus_tag="LMJF_36_4510"
FT                   /old_locus_tag="LmjF36_4510"
FT                   /product="putative 60S ribosomal protein L18"
FT                   /db_xref="GOA:Q4QG98"
FT                   /db_xref="GeneDB:LmjF.36.4510"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4QG98"
FT                   /protein_id="CAJ09418.1"
FT                   /translation="MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFN
FT                   KVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMARIPA
FT                   MRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFGASG
FT                   VPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHV"
FT   CDS_pept        1742192..1745356
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4520"
FT                   /old_locus_tag="LmjF36_4520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4520"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4520:mRNA"
FT                   /db_xref="GOA:Q4Q0W2"
FT                   /db_xref="GeneDB:LmjF.36.4520"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W2"
FT                   /protein_id="CAJ09419.1"
FT                   /translation="MSSAQSSVFQGGAPAGPQRLSAIDLQRITTILEACGVSKVHGSAH
FT                   IYAHPESIHLISPRDLSFLVLHADVLATHTDLLYDARAFTGILWGMMQHADRGIERVLC
FT                   AIEGNGAAAAESARGGNVGGTPSSSTTAPAPAHTFVYTNVSKVYSAMFPHLVQVFRVAT
FT                   LLRAYESADARAEVRDTRRIAQVDIDVAARLAGRLNHLFLCEAGERSTGALSGAGALNV
FT                   TATYTNVGHHLFRTTESALSSVLLLLSSLAARPGSDAGPILRYFHDVGAWEASALGSLI
FT                   TESYSMSVQTVLFSLFQRSCEFDNVEEVAAKLLLQRLALRPPYQWRAFRLLYFSVQDIG
FT                   ASDTQAAEDRQGSSAFGQLFVFSRIQHALQRCLTTSGRDNAGELAIVKSMRKAVSAQVQ
FT                   RAWPEQGSADNAGSPSRKSRTDAPPRLLSYYELLVLAALQGMPEADLTKDAELLRRAEQ
FT                   TNLSAEPEVLTPSFLRMLMAFCYTVPAPTDPALSHAMLSTPSTLALYESLAKHIFQIPL
FT                   CASAAVADEVNQLFATAALRTETLVDLCVRSAIHNTREDELELAGGVTARENSAAAATD
FT                   PVVVSPAPHARAKAGPAKTAGPPLPPIPSPRTAEVSTTAAMPSLPLPPTPTTALFHLVR
FT                   RDVSLLFAGNEDVLQHTPEAARARAKNFPYGFRAVTLATVHLLFAALRTAEFYHHIRPT
FT                   DMLPVIAQLFALRAYYPLLPSETEAQRKAARRMLALMQNTLALLPQEMKAATVNQLLCR
FT                   TLVPMSTTTGHTDQLQLALFEAYLRSMATASAANAVTDELMLQHWVDIAVPAITNRHSV
FT                   TLSIAGHDFLIAAFRAEKYVSPLFVPTYIALYVPSVELFSTGGRVGQRSTYSPLPVSVI
FT                   QHFARMVRVACHGIERCDSTALARLFEEDAGREGEATMPGSMNAAAAYMASLSPAQRAA
FT                   LRKLTPTSAVLLVVSALFDCLCLLWNNTPGYVKVAQDLFVAYFSGLCNLLQCTSTPVLQ
FT                   RVCASIEAMEVEHLRGSGSVQLQFLKYVSSVVDSVQGPSKVGIAEWFLKMNKRIQEQNY
FT                   GKHSKL"
FT   CDS_pept        1746520..1748121
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4530"
FT                   /old_locus_tag="LmjF36_4530"
FT                   /product="putative ABC1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4530"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4530:mRNA"
FT                   /db_xref="GOA:Q4Q0W1"
FT                   /db_xref="GeneDB:LmjF.36.4530"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W1"
FT                   /protein_id="CAJ09420.1"
FT                   /translation="MMRASQPCRDAPLCNIARGLQRIASAMLASTRGVEAGVASGATSA
FT                   TSWTADSADGAVGRGVAQRYASSSLTLPVDVAEDLSQPTTPKDMRYKHVPSSRVGRAAG
FT                   FASLFMQLGWEKMTGSIPASGLLSERGHQHIVDTLCRMRGAVLKLGQMLSIQDESTIPP
FT                   HVAALFERVRDQAFAMPPAQLHHTLATEFGNAKWRTDLFDTFDDTPIAAASIGQVHRAT
FT                   LRPGAAGTDPTEPPVEVAVKVQYPGVAQSIDSDVANLKMLMSLGVLPPGMFVDKILQEL
FT                   RKELSAECRYTLEASKQMRYRDLVAADPALSSLFYVPQVYQAITTDQVLVSEYVRGVTI
FT                   DQLGKRPGVPQELRDYIAESFMALTLKELFVWRFMQTDPNFSNFLYNAKDKRVYLLDFG
FT                   ASREYSREFLDDYLDVVTAAATGDRESIIAKSITLGFLTGQEVQEMLDAHCASVLLLGK
FT                   PFQDRAHPFDFAAQNLPSLIQANVPTMVKLRLRPPPSPVYSLHRRLSGTILLATKFRAT
FT                   IQSGRLFWNIHDQLRK"
FT   CDS_pept        1751705..1752814
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4540"
FT                   /old_locus_tag="LmjF36_4540"
FT                   /product="elongation factor-2 kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4540"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4540:mRNA"
FT                   /db_xref="GOA:Q4Q0W0"
FT                   /db_xref="GeneDB:LmjF.36.4540"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0W0"
FT                   /protein_id="CAJ09421.1"
FT                   /translation="MVVVKTKPAAAPQPRPAPAPRSFPKKWTPPTHTHEIPEHLSTDEP
FT                   DVLVPAQKYVYDVKTCAWKEADAMIRVLHPNRGLSQGTMRVCFALEELDETGFRSQMVA
FT                   KMFRHDISRVVESDYFNEGEAQCICGILAEKFNRVQVPAGFQRHVVSFLQCETVRIKLR
FT                   EAPAAYQHKRLGFFSYRTTDSADILFTMEPRLTGNFTKYTNNFGNVYDGFEKRRSLEEE
FT                   KKRHRVLMAVEAFSHFTLVESGGSMLVCDLQGVNDFLTDPQIHTEDGKGLGMGNMGQEG
FT                   IDKWVDAHVCNEVCRAMMLEPLSKGLRNFPRTAENESRVSYYQILRSKLRSQTPVRPED
FT                   IIPLKKPLSMMSDDEQLEYAMRLSALLSD"
FT   CDS_pept        1758107..1761532
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4550"
FT                   /old_locus_tag="LmjF36_4550"
FT                   /product="related to elongation factor-2 kinase efk-1b
FT                   isoform-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4550"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4550:mRNA"
FT                   /db_xref="GOA:Q4Q0V9"
FT                   /db_xref="GeneDB:LmjF.36.4550"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V9"
FT                   /protein_id="CAJ09422.1"
FT                   /translation="MEKGSLETPSSVNGSFSVVDHDLEKPLHTRCKTNSKATASVARPP
FT                   RDCADSVRVSRQHKYLDADQVSFGKDATSALWVPNAGGPTSSLRTTDEASSTKGGDGFA
FT                   MPSPQTCIPTIALARYVRPSSVGDAAPVIVRGHKYVFNNRTRRWLAHHITVRVLHHNRG
FT                   IHQDKYFATFAVELLDLVKPATPMLAKVYRHNIDLVSETDYYSLGQAQALCEEFARDYT
FT                   RTAARSHYVKFHLPLLTNRVVVRLDMDSVLDPAIRTARKGFFSYRTQDTRQVMFLMEPN
FT                   TVACEALGISFASREVDEGKCYSRGDAMWSRDIYRDIADGFSHFTYVRSRMCMVAHGFM
FT                   RSNGYLLDPLFHTTDSERFTMGDAGRSAMEDWVEGHRCGDTCRALGISNFNNDGECVKT
FT                   FAACVNPLDTEENHYTDFLRSVRQMRVIVHMDAAEILSDYKTDSAVDTVSESSDWRLTM
FT                   AVLQPAPVSPAPLKVTCDAVKYVFLPTRAKWMEVPMRLTVSASAVPDTVDGTYAFFAIE
FT                   EEREGGRPVPMRARFLLRPEARDADYYHFGDAYCVCVTLGQAFREYRASNVCARELDFY
FT                   AAYAVRVPQANIPDCIKAAVHDSDFFTRTTADSGDVMFVAEPEFQSFSPRCSPNADGVT
FT                   EDAAGFDDLALRHVVDAFSHFTLHKSGNHLLVCHFKCQGGLLMHPNINTSSGCGFETLN
FT                   DGQAGIDAWARAHTCNDVCKLLGMEPLPRELKLYDISSSPLMRYIRHVQEHKMGSDEML
FT                   ELASPSRRMSDAMLPAASDAAARQSETASASSSATASTATAAVASFVRPTPPTSEETML
FT                   RPWVKRGCKPSAASAKETAAQRRTLTQEELMRLQSKGIDTKYIIPATRYDLDIDDFTWT
FT                   PKRIFVRIVNPERGIGQGGMRVCFEVADVDPDTCKESVMVAKMYRRTIKHVVEKDYFMS
FT                   VTVQKLSSLFAKDFNKERREGRPLLLNVLDSAVIALNRADLSAELLAKRTGFFSYRTED
FT                   TERVVFCVEERLLGRFTKYNGNMGEAYPTNECRLSPPAARERTMVFEAVEALSHYSLER
FT                   SEGGLLVCDMQGVRNDLTDLEVHSYDGQGLDMGNFGARGIEKFALRHRCTSVCKSLNLR
FT                   NLRDRHFVVTDDVKTKNRFVALFERIKEIGNMEE"
FT   CDS_pept        1768112..1769866
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4560"
FT                   /old_locus_tag="LmjF36_4560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4560"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4560:mRNA"
FT                   /db_xref="GOA:Q4Q0V8"
FT                   /db_xref="GeneDB:LmjF.36.4560"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V8"
FT                   /protein_id="CAJ09423.1"
FT                   /translation="MPQPASGQALEREQLASVVRKLVIDTDEFFAQQQKALQLSYAELN
FT                   SRIEQLRMRVLQQQLQLSPMHTANGGYTNMNPSLFSALHNIPNADLLGLSGSNAGMVGG
FT                   VATTPSAANTMNATPMRPNTGGATRSLMGSLNGPNAVLGMSETLSESARSNGALGGYLS
FT                   TALNGNNAATAGPGSLRSYKADAVTPAKKQLALSQPTNKSPSMPPPHLAGGLNAMSVMD
FT                   DPVSGDFFSTAPNNNSRSHHDSLLASPQATQKLSLVELIERFNMSSTPMNTATSSTFNF
FT                   DSLYEQLTGGGGSEELSQSPVDYKERAPNLIPTGQPGNAQASPCDRHHDNGGDPSPDSN
FT                   GISGGAMVKNSIPIDTLRALHDQHLTTSVRVAYERGRPKVLKILGGAADTPGRLGIDPR
FT                   SSCEVLVEFKRKRVLQYESHEYVTPGSYVIVGGDRGEDLGLVVYVWCEVAQEGNGHGHA
FT                   GSGAGASDKAPSASRKRKVVGVGLTDSKLPRSIGVGNGTVLRLASETDVQQLLGTQAEL
FT                   ERRAIDVCAQLVLDHSLPMVIVDAEYQFDKKKLTFFYEAQQRMDFRELVRHLYKTFRAR
FT                   IWMELVDA"
FT   CDS_pept        1773744..1774712
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4570"
FT                   /old_locus_tag="LmjF36_4570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4570"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4570:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4570"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V7"
FT                   /protein_id="CAJ09424.1"
FT                   /translation="MTASRVPPFSAGLQFTRKDVHEPSADTAVDNRSGVSDGEPQATGR
FT                   TPVREEARCFESEEERLLWKAAKLRHRIETDLMPRQELAERALRHGRRQLVKLQRLLPS
FT                   AAFLAFRQKCAVWCDRLRLFEELVVHTMLREAVDGAARSGDVKTPARWRKSNQWPAITN
FT                   FLELQLHLCFAVGGSAVVEASSPDQSSSETSAVHRHLAAIGAAQQERLLTCDFLHRYYT
FT                   LRDILHGWGNGWYVRAPCAADDETVSSTARGCVPHEPDVSCICPFSQWESLSAVDRLTS
FT                   YSKICSHHLTEDVVECLEALMFTHFADVWCRVESVMSGVST"
FT   CDS_pept        1775619..1776977
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4580"
FT                   /old_locus_tag="LmjF36_4580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4580"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4580:mRNA"
FT                   /db_xref="GOA:Q4Q0V6"
FT                   /db_xref="GeneDB:LmjF.36.4580"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V6"
FT                   /protein_id="CAJ09425.1"
FT                   /translation="MSHSEAPRQDVLAAATCNKLPQRVWVDDEDVAVEQETPAFFKESH
FT                   VKPAWALSDTTRADTDQSDSHEGAVPGNQCSAEELARKRFRSDDLDTLLSRKEPLLSSK
FT                   HDRSHSAVPTVLSLLPLPRDSARTIHWHRNGQLAVVGGNQHIYTFHAAGGFVEQLSKVH
FT                   VNKRVETTALSENGEEVLIAAHEAYAPQLLNIATEQLSPLTFLDTRDTAVHRNGRRDNT
FT                   RDEFFVSKLVCRPNDPVSRGVAMARGSSVTLASLSSGSVLSHITADTAVVDVTFLSSTE
FT                   LAIATRNKVLLYDVRKLSRFIRELTDDAALDITTCGFSASRSSGARERAMAIGSASGVV
FT                   SVYDSATLRSAAATAASVAGGSRPKLLRELKQLVTPISCLCFGEDSQGESVLAFATRGQ
FT                   KGGFRLARMPELNVVPSFPAVSTRHGFVQSMTIAPTVPILSVGERQKVTNYAL"
FT   CDS_pept        1778903..1781353
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4590"
FT                   /old_locus_tag="LmjF36_4590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4590"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4590:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4590"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V5"
FT                   /protein_id="CAJ09426.1"
FT                   /translation="MAAAAQLTKATTLKKNTVDYIPSKLAYDTAIPVTILEDRSDFIER
FT                   CKPYDIIDGPNPLDEPEATDATRPQARCALVSPAPEVKKAERSSGRLNRKSHHSASKAE
FT                   KLHAVKRERDAEEGRDGAAVVFSRPSRHGWTAECLAQHRPYQLVRSHDMETCVRYVLDD
FT                   DDYDWCERQNVAPESLQRGVTYLEWAYASSLLRAATPRVATPEDSGTAATNSVVTGHAE
FT                   EHHSSSTLSSSPAGAAVAGNGRHTTSRRRNGKDKASAGDAAVCLCALCSKPVQLLTSQP
FT                   RSGSLERSTGGANAVRNSGGGTTDSAGALSSSPTARGGAGVGGGHARGISAPQLSDLVP
FT                   PIKRAFGDVSAGIASSSHNLQSKGLRCSDCGVVAHLRCWFFSEPPKLPEAWICDGCTIY
FT                   AHHRRRSAGMCCMCGRAGGVLLPYVSSPLRDDSDAVKPGSPQTSAFHGRSSSAVAVFDT
FT                   VCHAVCALSMPELAVHPQITVLRRNGLVDMQMRPYVYALRRVGKHKYAMNCRFCQHVGG
FT                   RCVQCSHPHCFEAMHASCAAEAHTVDCHAELPILPAAASPCRTSAGARGGDSTSDATTQ
FT                   PVSLGSSLSSPLIGTANWTRCSPYCRKHYGYSVGISVGSAELGHKAEAEALALDLTGLL
FT                   TGGDGVTSPVVRKRGRGRPPAALVKQREAERDLILKLRAYWLERREQRRQTSAQLSSEI
FT                   NARVRPIVEASMRPEIVKISAEKVRLSHFLSLVPEWQWQLVAIVEGELPLPDEEYDDVQ
FT                   KFRKAAHTRRSGNTRSLYDKMCEGAVQLGLLCRVAEAIKEQCRLRRTSVEQELAALRIL
FT                   SGWR"
FT   CDS_pept        1782407..1782970
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4600"
FT                   /old_locus_tag="LmjF36_4600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4600"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4600:mRNA"
FT                   /db_xref="GOA:Q4Q0V4"
FT                   /db_xref="GeneDB:LmjF.36.4600"
FT                   /db_xref="InterPro:IPR019184"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V4"
FT                   /protein_id="CAJ09427.1"
FT                   /translation="MGVGASALTLSLSFHLLRPFEPHSLKEGMRVRTYHKHAIQRNSPA
FT                   LQGLLTLHTLFSVFYSAPIWFTYLGTRWHLASVTSQQRIWMICVLILWFCTEIPRLHLG
FT                   CLANKRTLFCELVAFLTMTLVPQLLLVSVLLGFLPECNDLEFSVCVTQILLLVLECLTA
FT                   VQLLMRVTRNNVVDFYVSLGSPYC"
FT   CDS_pept        1783778..1785196
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4610"
FT                   /old_locus_tag="LmjF36_4610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4610"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4610:mRNA"
FT                   /db_xref="GOA:Q4Q0V3"
FT                   /db_xref="GeneDB:LmjF.36.4610"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V3"
FT                   /protein_id="CAJ09428.1"
FT                   /translation="MDISYQLWSLVEQARRSATTPPASITLPSRRTRTTEETQATDSLL
FT                   TTSQALDRAADMAIDRATAHISAVMAALDAVTPSSLAHLQNSLLLSDAELLSVSSSLNA
FT                   FTETLTKVTALTEARRRRGRFNGAPSTATGTDDAVEDFAGDKPGGQDGNSRSGVVAHLR
FT                   QAVSTLQQRIASKRLHVALAKEELALYKTELFLYGHCGVLACSDEVAAELARCVEATRK
FT                   AAVSRGQHGAKAIEGAEVNALSAGGGGQQRRHHTSSKSPAPMPGFGTTFRVVDGMVQRA
FT                   AETVKAAGSHADSALHVALTGGHAAARQLLHAGTASVAEILMLGALPRRGSCGNLSTPA
FT                   AETLVATAGGGAPRLPTLQPYELTNEEEAHLQEQNRALLEAQRQASAQDAKAVEALVRE
FT                   LSQLTSLMNEQVVQQTEQFSLIFKNTEAAHTNVKKAMNEVEKPLSAFWNPTRQLVALLW
FT                   LCMAVLVTVNWASR"
FT   CDS_pept        1785948..1789670
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4620"
FT                   /old_locus_tag="LmjF36_4620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4620"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4620:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4620"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V2"
FT                   /protein_id="CAJ09429.1"
FT                   /translation="MWLNAARQCVRSYTSDATAQLTHFSSAARKQPRATASIVPAGTAR
FT                   CYATGPAGTDNVAGVSPASAAKGKAGSSPVSSKTKSSRFVRTYGNAPPPAASSADSDGG
FT                   DIPQGEADARWPALHANLSAPPGLTSAASVAAYVQRLQSLLRHGRHPFVRACAVHELGK
FT                   ILLPSVKGVDGATVLLLLQTLRMADADGAMPLVQDATTWMGLHGFHLTPPQMTTAIELL
FT                   LHFDRSVARELAVALVQRTPQCTLFSFSTARVVPILTAMLPTLTYGRNTNLALQSIAQV
FT                   EQARENNVIAAEGLRDGCMSDELLSVSSGSLAQLLRALWAFRRANQGLYSKATATEWRS
FT                   LEEAACRILATPEKCAEVSLADLINVVVDLNQWREQRNDLDSAETAVDNAQGQLFTALL
FT                   LRLDAITERLRRCSPEPSERGSILPESLRMSDISVAWSHCLAHTATRGPSRDFPSLADS
FT                   GDGADAAGAFVTALQALQAALWGVVAARCSAESPNIDAVQLAAFMCSELVVSWMTHAHQ
FT                   ARDEALAQEAGDDLSAVLPDLASLIPEATLRGVIDGISAQLLADSITWTPQMVRQAVTL
FT                   LGNSRDPAHRARAVELARKWYRQLQSRSQEGERLQPIELLAFFVPTLLQEEKKGVAQAV
FT                   RASLSRWSVAEVLYFFSEIAMHGGRAGGVESMTVLRDSGKLLGVYAAKASAPQLVGLVE
FT                   CYGLAQVRSDDFCEAVASRVSELLRTTVADASREKTYLSAAPPTTASESQANSFAAGEQ
FT                   PAVQTEPAAANSERPGPTTSSGVTIAQLARLLRSLALMETRKVTPFIDAVHSITRAADA
FT                   DQGTAEQITQLIAAYAKMLIWCYPVLRALAERLLRMDKSEVTLSHLVTAQLALLRMDVT
FT                   LPSFTARFYEELSQMYKPGAGQSRVSAAGRVSLHDMVVQLSILARLRGHPSETPIDDAV
FT                   AEVLIERIVAHSDHLKVDEVAEVLLSLSRLGKGNSAAFGSLHVRTLGMLPKSPPRVMAH
FT                   VVEAYALAGRGDDTELFTLVADRTVAMRHEMASVTIASVLASFAKAGVRNDRLFIEVIP
FT                   RVRHVATYGTPRDVVNVVSAYAAVNLWHYKLFARLADRAIQLRADFRTPEVVALLKAYA
FT                   TVQMRYDRLFTEFAPRIQTLVHLLSPADLAAIVSSYAQLDIRCPPVWKATAAQAVTVAR
FT                   SFSLEDAETLLEGYASQSYFNQECVSALTERFPELANISYGLAETLAEGNERSSSGSDG
FT                   SESERRGQTETSQGV"
FT   CDS_pept        1791719..1792423
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4630"
FT                   /old_locus_tag="LmjF36_4630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4630"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4630:mRNA"
FT                   /db_xref="GOA:Q4Q0V1"
FT                   /db_xref="GeneDB:LmjF.36.4630"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR027502"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4Q0V1"
FT                   /protein_id="CAJ09430.1"
FT                   /translation="MSTYGKVYLVSGNKGKLAEVQSYLAHANIVVEAVKFDLPETQNSS
FT                   AEKISWDKAVEAYRVVNKMPVGEPLRHGGTPVLVDDTSLEFDALCGLPGPYIKWFLDRL
FT                   GVEGLLKMVKGFAAPGEKDSGAAAPAHRGANAVCIISLCHGVEEATGQPLVEQFRGVCR
FT                   GALPPVPRGGVGFGWDSIFAPEAQTPAYAKTFAEMSVEEKNTLSHRAKALKMLTEYLKT
FT                   HALELRGTKLVA"
FT   CDS_pept        1794330..1796072
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4640"
FT                   /old_locus_tag="LmjF36_4640"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.1.1.73"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4640"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4640:mRNA"
FT                   /db_xref="GOA:Q4Q0V0"
FT                   /db_xref="GeneDB:LmjF.36.4640"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0V0"
FT                   /protein_id="CAJ09432.1"
FT                   /translation="MSDGEVVFEDATGASSEKTPLKGDMLDAPPRKVTRSRAEWLRCVT
FT                   VACVLLLIAPLYLWTNFHAMRAAREDPISVVTSLSDNFDIHELIRELNDNGEKIYISSL
FT                   ISKEADGCARDVPGLPKGKQTVVTFKTLENTEREAVVYVPTSYPTAPKPGALLLLFHGL
FT                   NDNCKRFLDGTGFVPYAELDGFVLVSVCGSLGYLGTGWNAGMCCGFLGEKPNDVAFAKQ
FT                   LVTELSQSVCIDKTRVMAAGFSNGAMLAEVLACDAPEIFRAVASVSGVVEIRPGNDAAL
FT                   AACTAAVEKASSTARTSVLMVHGTADLLVPWDGNKLLGFPSMVKNLEGWRERNGCTDET
FT                   STTISTDTYVNTIYTNCSVRKPAGLLPTFDGEPEELQTGLEDNPYWGMDAVANKTGDAL
FT                   STVEDTALADGERCISRMEAEYLSVRQESRRHVTRLTHERWSRDQRCQKRDRTKAKNAK
FT                   AHEKHDDKEVYHRKVSSRNHHESMDFHLRPHLYLKEKLSQQDVPRQVAVNHRRPHHLPF
FT                   GSVPKERCEVRVQRDGPPHLQNGTSQVELVRVKGGGHHWPRDVDFSTTDYIYCFGIRVF
FT                   GRYN"
FT   CDS_pept        1797531..1798214
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4650"
FT                   /old_locus_tag="LmjF36_4650"
FT                   /product="putative 60S acidic ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4650"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4650:mRNA"
FT                   /db_xref="GOA:Q4Q0U9"
FT                   /db_xref="GeneDB:LmjF.36.4650"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U9"
FT                   /protein_id="CAJ09434.1"
FT                   /translation="MPKSKRAKIVPLTKTQAKTREDKDKLIERIREALEDYSDVYTFQL
FT                   HNIRTNILQQIREERAGDSRIFLGNNKVMMIAIGRDEESAQRQNLHKLSPFLTGLCGLL
FT                   FTNLSKKEVKEYFATVGAPVYARTGQTATESLVLKGGPLPQFPHSMFDHLAKLGLPIKL
FT                   DRGVIVLLQDTTVCEPGDTLSAEAAQLLKLFGVQSAKFKMDLTAHWTSGVAKKVSSSAS
FT                   KRSEK"
FT   CDS_pept        1799444..1802239
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4660"
FT                   /old_locus_tag="LmjF36_4660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4660"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4660:mRNA"
FT                   /db_xref="GOA:Q4Q0U8"
FT                   /db_xref="GeneDB:LmjF.36.4660"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U8"
FT                   /protein_id="CAJ09436.1"
FT                   /translation="MPSLDTRDAVKHYELRHNVLLQSILPGGLLSSLELKGRCEAFLVP
FT                   RQVSLEVLHIAPYFVATAQRLSTESSAKAAPPLSALFGGEDDAAERGGSPQQGTDATND
FT                   GRRTGGVTFPPENADAFRAALARFLEYHLLHFDGFGNSEFTNLSGQRGSFAEDLDHVKR
FT                   FGHFGQVAVLADADALRPRGCGASADGTAAAAGDLPCHPSSLQIFIIDKPLMDSDEVRL
FT                   VRETLYKLTVSAVSEIETKMSAPRLTTTLVDIPFLMGGQDAGHVTADMKQSSEQYALSA
FT                   PSAACVAAANRTDATDTNSCEGSVTETVVIEDFEAEPPEDPDLEAYVAKYTHISERQRQ
FT                   RSESTLSVKETLNSSGAASAEDKVIAAPCLSHSLPSAQGHQVVAVAGVGCPPNVSRAAG
FT                   TKAATVATTSMHANVLCHEYSRECIKDYRRVVAADNEIFYSEFERLMSLRCAGSLAKVM
FT                   SEYVSNNQHLQQPIQSSAVYNKFVERCHALLRRTPRLSVDKERMTIMQEGVERYVTSRL
FT                   YHQLFNVSEDERRKNERMQQKLLRLENMAPADLDALPEVERHHVWGQAMFELDGMDFFK
FT                   SPREKLRCGMRSCELLSLAVGDILGQRREAKRAEKAAKTAASGNAGGVPLAFGADEFLP
FT                   CFLLLVLRARPLSFVQNVLYIEKFRCPALMSTEESYCLATLQSSLLFWENYGEDGQMNP
FT                   ACATASTSGSAEVTSHNVGSASMRALTKAPPSLSGIMQPQQPPPHMTENDLLPSVRQAS
FT                   STGRQQTRVTNISQPGSEAAAVSEGKRMEEEAPTVLDVLFGWANRNLAPLASEIGLGGK
FT                   AGASDGDGSARQRDSHGTKPASITGSGAVAHLSPPRGTVAAFTSGNGRADVGQDTSVSA
FT                   DVFHTALAPAVSPPHCDSNMSSRTRVRQLLVAQNKTFEQLTLAELQMIVEEARQLLLEG
FT                   K"
FT   CDS_pept        1803445..1803831
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4670"
FT                   /old_locus_tag="LmjF36_4670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4670"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4670:mRNA"
FT                   /db_xref="GOA:Q4Q0U7"
FT                   /db_xref="GeneDB:LmjF.36.4670"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U7"
FT                   /protein_id="CAJ09437.1"
FT                   /translation="MLRPSRLVSLSATILGTHLHMSAEQHTEAQVAELEKRATSAEKQL
FT                   QALRMKLENGAGAAASGAEVEVRLRELLKLMCEDRDECETIRAQRDELMEENARLRAQV
FT                   MKSEYRIKHLLRTIEEIEKPGAPQ"
FT   CDS_pept        1804658..1804897
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4675"
FT                   /old_locus_tag="LmjF36_4675"
FT                   /product="putative cytochrome b5 1"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4675"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4675:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4675"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U6"
FT                   /protein_id="CAJ09438.1"
FT                   /translation="MKEYTREEVAMHCTSQDYWVIVDGHVYHLDAEFVTMRHPGGLIIL
FT                   ESAGKDGSVMFHEHHNSERVKPILVEYCIGKLKK"
FT   CDS_pept        1808585..1814029
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4680"
FT                   /old_locus_tag="LmjF36_4680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4680"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4680:mRNA"
FT                   /db_xref="GOA:Q4Q0U5"
FT                   /db_xref="GeneDB:LmjF.36.4680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U5"
FT                   /protein_id="CAJ09439.1"
FT                   /translation="MRRAHRHSSGQGTGGGVMSSTSATVFPAAELADAEAEKLWSADRS
FT                   GGNDAAKHATVLERLWRPVEYALMDICYAIEDRFIIPQNITLVPALVEEELTHRQGFLM
FT                   LVGHFISISTLMVFAAYSRRLSNLMSGASPVMGEILFCVSHLSQVTQEQLGWSLFCTGF
FT                   LSPSTFEWTTTEGGCSGPVAILSGAGSQSTKRQMLGANSGGGFGANGASAGGPQGSTGM
FT                   GGGSPGGMAGCPCTGGNLVRYLLGRKANMIRQESLRSYLYSSFHSPSAFLVEQTVWFVV
FT                   LAVTMDLVSMQRLAVAAFFANVVGWLPVYSVKSLAGLGVALVVGFMYWIPSSEVDDAVL
FT                   SVTFLQRPLRRVLSAYCASLCITLLFAETLLLDDVRRVIVHALFSLPQRLLRVGGHHPV
FT                   VAKLVHGCAWLRCEYFYFVDFYFFLGMMCWLSLVLMETAAGISVFGTAALLTVAPWLVG
FT                   SGWRETPMQAVKDTVIYVGFYVVVALLLAHVVPWSGLAFLSNAVQSGAVLFLMAARCEH
FT                   KQPGGSAYVLLWVAMMCVYLYMKAGTMRGTTGSLTWSLHDSNPRANFVKAAYAVWCGKP
FT                   ATEEGALSLLRLACITFWQLLSKGLSEEGMQLLHFNVVVFGSMLLFSTTMHAVFVEGVP
FT                   FSSPGPAVSTSAEATSTPAAALAASTMSPLPTSTTAASAKGDHNDGAVQALIGRQCCWR
FT                   GVLNGPHCSAPTSSSCAKNRAVPHVGGAKPSSSSTASTMRRSWQAPTQAAAAAIDVCVS
FT                   GKGSDGGAVPGEGRSEETVAEALVEMAKVIEKGKETIREVGSVAQGFDEQLAWPAPPAG
FT                   TGVSPVKEGGAPAALGKETKIPATPRTSASSASMSKRDDNQKDPRSQLSTASLTQNPTS
FT                   VDEAVREENEKPPPQPIRGPNGTKTEAAAPVPPRDESDLILDASRSASPEKIVNCTTAS
FT                   FTSTMCRSDMSSPTPSSFRHEQAASLASRSSTAAETPLETRCERQERERDKDRRHERER
FT                   VKTPASTTSSVSASPFPATKPEREEDGQSSPQQRTSKSSWGQKKSADTETPTAASSAPA
FT                   LPLPRSRTENLKKAAEATMSPQVTSRQTAVTESKEAVRSKNSVPDGRTAAASAAKAARL
FT                   TESTASTGAASAAAGAEVGATNDKGKAARDSGEGKKAGGKAKVAADKTSTSSDAAAVPS
FT                   PGDAKAVEPAAASMPVLFPLPKPHHGHKLADEAPATATVKAPAAAAKTTAGEAAGGEKR
FT                   GSNNAASFPMPDKVGVATAKKAAAAAPLQISASAPAPTALSSQSVATAPAVLPLPLPRS
FT                   AQAAEADSAAGAAQASPASGAQPHEAPLQQAWRDLRWASAASEATPAADTDESGPVSAS
FT                   GPKQNVKSKPSAAAAADDAEESDVSYDLDRVLNFLRLKINYAAGVDDGDDDDGSSSTVS
FT                   NADCRHNPTSFLHSDSPEHSTTTPKRSLSNAPEVKCGVSAAAHLGVDASVSRTVPQRTE
FT                   EAGAAHESLALRQPSGNEPITSIPQRVSQAIQSVSEWTVKSRSGFGDCRTDSFASTNHN
FT                   SANSSGNCALHDRRSNGFHVFFTHPNAAMATKAAGSSLSPHPRPVHMDVASRGGELLPS
FT                   EMMESGIELSAATRHMDFNAASSSLGHYQVSEIVAPPSPPLESRQSSSSHMPFSVSTFN
FT                   HSGSLMSSMSSIGRSNSDTAEDRSSVLPRMRVAPNGRVSVSEQMATQKAKQSVSVADTM
FT                   QQMQFAAPSMQQTMMVMMRAPDGQMALYPMVYNQPVYMADANRVMQPAQSVQMTSQPPP
FT                   QQQQPIVYAAASPSPGQAVEVAYHIAPDGSYMMAAMPRMPQQMMGQYQQQQQEPYQRF"
FT   CDS_pept        1815848..1818829
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4690"
FT                   /old_locus_tag="LmjF36_4690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4690"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4690:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4690"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U4"
FT                   /protein_id="CAJ09440.1"
FT                   /translation="MNIHISGNLSKPTVIFIAGWPDTCDVFRDNVMATLAADYRIVGVT
FT                   LPGFDDEHPFLNELRKRGDAAETNQLGKLRRGGGGVSTACAATGSTWMSALPPMRFLTS
FT                   AGAVLQPTDSSSSSSGGTCARTPLQAFGVPCRCAALEPFRTSWKGHSFQDLVTLLEIAV
FT                   DTAMETCNYCPPVRLPISAEAQASARRSGGGETETSQPTTDAFAAHQLPPTYTRPVLIA
FT                   HGWGCLLAYELLLARPSLFSRIVALDVGAYCFESDAAHVERMCALVSGQGKGKPTDMTR
FT                   SPFAAAEAQVALNKEKAANLSASGREVDTIAQTTATCDPDVGQQGRIVPAAGAAPTLTL
FT                   LRGQSTSPLDAVPALSTLPPMRSGPSTSGTKRSLASQYAIRRRRGAALPQRAEARKRLF
FT                   IILYQFFLIVCELFVPHRLARWLVEWFASVSGRPYYSYDPQMVVTPTMELLNHTLNAQF
FT                   FARHPLAVENRGALQLPMLLQTEKTKASPSSSAAAAAATVEAGYCKSKGPAQPTTAGWK
FT                   IMLIPYLEKMPVTAFRGSATSGNQGRLQSNGRPLSERGVGEAFEGNCGTIRKSTHSGRA
FT                   QRQWLYGDSSTDSCTGADGMGDTSEGDGGAGESGTTFDKKNPTDGAHVVFSSYAKGADM
FT                   VFDEWNSLAADTRGIVDGGPSGLGSSGELDPYTSVNGIAAPAWVTEDPLTLTGAQSFME
FT                   TNRATGVDSKDISFLMAADGICSSDGGRADTFGVSSSTGARQMHVAKRRLFYQAVVFPP
FT                   LSNDTIASSSTPFHGNLDGGDSDRSSVGPRSTVLSRLRKSNRSSPLRPAVPVLASPSHS
FT                   WIYLRFWLGTLVLRLVALVSWLLGEKPATPSSSVPGEGAAALSATVAPSRASSNVMTTA
FT                   MTTIYRRLPATPSLAADVSTLPGNGDVLLQPKSHAPLVTQRYFVPLAIPILFMYGGEKR
FT                   VMFHADHWCSYIRQHQRRRDGISDVVEVQGGGHWFFAEKKYQKKVADRIAEFLAAEPTT
FT                   PYEV"
FT   CDS_pept        1820699..1821706
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4700"
FT                   /old_locus_tag="LmjF36_4700"
FT                   /product="myosin heavy chain kinase a-like protein"
FT                   /EC_number="2.7.11.7"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4700"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4700:mRNA"
FT                   /db_xref="GOA:Q4Q0U3"
FT                   /db_xref="GeneDB:LmjF.36.4700"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U3"
FT                   /protein_id="CAJ09441.1"
FT                   /translation="MNPATKDVASAEEESPVVCTAKQYIFDLHSYAWKESDCLIRIPRP
FT                   HKGMGHGGMRVCYAVEDVDEEGAGTPMVAKMFRRNISNVVEKDYFNEGAAQCMCEEFAN
FT                   NFNRIHLTNIRKPNISFLQCYVVRIPRDSIPAASQRKRTGFFSYKTQDTGEVMFVMEPM
FT                   LSGKFTKYNSNYGETYREDKKAALTSSEARRRTEIFEAAETFSHFTLVESGGSMLVCDL
FT                   QGVNDFFTDPQIHTEDGKGLGMGNMGQEGIDKWIEKHECNDICRALGLQPLLGAVPSST
FT                   ACAREENMYLGLRAQLQSQNPVRLRDLVPLTKPLEEMTEAERIEYALKVSRLTD"
FT   CDS_pept        1823333..1825516
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4710"
FT                   /old_locus_tag="LmjF36_4710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4710"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4710:mRNA"
FT                   /db_xref="GOA:Q4Q0U2"
FT                   /db_xref="GeneDB:LmjF.36.4710"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U2"
FT                   /protein_id="CAJ09442.1"
FT                   /translation="MELDHLKEDVLMGDTNEVTVPAAIVASAPVLDMGFHPRLPIMAAG
FT                   LVTGEVEIYKRKSVDEMVKIPLQNDFSSWIFSGQYREDEVVMNYHHQNMLMHPSGSVSS
FT                   MEFTDDGNYLVSASGDRTISVMDCVSLRLVIHIPDEEVHARTAGKKKLNSMNKTNDPTA
FT                   KSGKATRQKAAAAPRGSRRGPTAPLNPHKYGISALNVCDENLIATGDDDGLIAVWDMRE
FT                   RRPVYVYHEHGDYVSQLCYFTDAQELVSSSGDTCLGVYDMRAGKVRDFSVRRKDELNCF
FT                   AFINSSGVSNATFIPSIVCGTPHGGLPLWKYGSWARPYDVMDRHPAECEAIISFHGENT
FT                   SFNHNLILTGACDGLVRVLQMYPVRRNLCQLSARDYTYSHSSALGNQSSSGGPQQQGNY
FT                   VARRARGQEAISRMRVSHDANLLAVSGSDNIIDFVDIAFMNDEAELDQLRGRAEQHHLR
FT                   TLRELDRELEEEEKRERRLLEGCGADGEGGKNDVDEASSDPSSSDASSPSSEDSDTDVE
FT                   MEADAQARLASREVLRQRFAEIGIAPRKRVHFDGNSDDDDDGGAPAAKKKSSQKAPQRS
FT                   DVRGQKTAKSTESAAASTRSPSADTGAPLPPKASRRVESGMSGTDTACNQEPLKKKRQA
FT                   PVETSALSATMAATDAANANPSSVAASCVEAVESMDSMEVYRTERQQKRERAAAARWLK
FT                   EERRKKINFTYEKRRRRVGGFFGDMVSRDDHGG"
FT   CDS_pept        1827821..1832257
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4720"
FT                   /old_locus_tag="LmjF36_4720"
FT                   /product="methionine synthase reductase, mitochondrial
FT                   precursor-like protein"
FT                   /EC_number="1.16.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4720"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4720:mRNA"
FT                   /db_xref="GOA:Q4Q0U1"
FT                   /db_xref="GeneDB:LmjF.36.4720"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U1"
FT                   /protein_id="CAJ09443.2"
FT                   /translation="MSDETVCIEAGERLYVLYGSETGNAESIAKRLHHDATTTHGFPDA
FT                   ECMTLNQAVAMKLFDAQLAEDASASLCVVIVCSTTGEGEPPENAAQFRRWLRKTAGTLH
FT                   NLRYCLLALGDTNYNNFCAPGIFMDKKLRDMGAVCCYPRGEADDGVGLHLVVNPWLEGL
FT                   WSALKQSGTEGTAATSQETCITGDIRIDMSVALETALLYSKSSPLCAATALFLHERITE
FT                   LGGKADLYPIQHFNPSTSLRRPPKVLFFVLGTEGDADAQSEQCACAAQQLPPLGPFSAW
FT                   IGNSDPCTPPPAEAVELHRWMSDPSIRFFHSLFVSRKPDGARRAAALDANLKAIATNCK
FT                   LELLCPCQLSGEVPSVAVCADDVYLWVEKVLQSLPGVTADAVSIRRTMDDSFDARVGVA
FT                   FRAAHAPGLCSGRATESDDVVRGGGAPTLTGQRLYRLGLENDRGRGDAGHASSENGGSH
FT                   GAGASRRTHEVVDDLLTPIVFLYSGHSSFVKQCAMDIFRGASQHHLRCSISELSNFQRM
FT                   GFPRSAAFVFVVSGVLTEPMSRVLKVLRTLQGQKKDIEGVSFAILGIDKTSESDRFNAC
FT                   ALELETLLLKVKANKIHDTGLADIDSSSLVPIIQSWESNLWRAIVRPMKSAAYLDIASL
FT                   GIQVQRSVVPLATSGTSVGAALCLAGASVGEAVDHDAGGSGGVSGGNGRVEPSEFGDFS
FT                   SASASPSLLPLPGGVGPRRGADLQASSLVGVSGSSLPGNPSTPTTVAAGATPGSDKTDT
FT                   PTAGVGLADALSLWDTTPLCREKACRTPVVFLYASAGMSKAMAMHAMRSAEEKSFPAAV
FT                   HPFAHFQFVDYHAHPNVILFCEAGAEGQTNGGRRLKRFLTNPSHRPDMLSSVRFAVLGL
FT                   CATPANVVHPAFRWAKLLLRLQANRIVPVLIMPSMSQLHSLGMPWVNCVLSSLALLPSS
FT                   VVVPAPPRGPNAPGASELTIGPSPVGTAAAPRARDDDADNDAVEEAADAGEEVQRTVSA
FT                   EMGSCGADVSTKQDSCTDRPVENRIACKVDGVVQSWKLLTCPTVRHSVVQLDFSVSAGT
FT                   QWAPGQTIAVVPSNSTAQVEALLRLFHLTCDEPFLPPAIAGPGASVFPTSPLYEAVDFP
FT                   VSCGAVLMRYVELRVTGTHKPLFQLLAHHCASEEAKAAVRAMYAKLLAHRTPRDLCEVL
FT                   EAVGAAADSLPPFRHIVENLSLLQPRQYSICSSHRADATTLSICFKVLEKGLCTGWMYE
FT                   QCLSAAGLPPVSVASAAPTRAEGSTAPSTVRQPVLSNTVIVAKARVVIPFEIRSTSVFR
FT                   MPRDPLVPMILVGSGTGIAPFRAFLQEREAWLKERHLPSGCACPKGTLCGCPCEKATHH
FT                   GQAVCGTIDVLFGCRRRYEDHLFRDELSHWKDSGVVHSLTVAFSRDTNDGRFYGGGCYV
FT                   QDKIQECGVALMDLILQRNACVFVCGDADGMAKEVDRTLRELIQQHLSLSDAAAATYLE
FT                   RMSKDGRYLREVWSTGV"
FT   CDS_pept        1833534..1837967
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4730"
FT                   /old_locus_tag="LmjF36_4730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4730"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4730:mRNA"
FT                   /db_xref="GOA:Q4Q0U0"
FT                   /db_xref="GeneDB:LmjF.36.4730"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0U0"
FT                   /protein_id="CAJ09444.1"
FT                   /translation="MAVHISSNTVVASLWGSEDVTAIPLQSSGQFLSLRLSPTTAIADN
FT                   TVTSVAFHPVDETCFVLGTGAGKAYGVSLQENKLFLLADVGERGALRCATFCPGYLTSP
FT                   IVVFAGTDNRLLFLDWQRGTVLQDVLATAHQRPILRIVTGASTESLFCIVSADAFSCWE
FT                   PVASSEGAFAMDPSSSAVPVTSHQGSTSTAGTAGPSPKDRSTSGFSMPRYGCSGSALPT
FT                   ECTLELQRSCDVLPRPTNRATHRFLGVHILHPALFVSVEANGVLSLWSRAAAAGDNEAV
FT                   AHRVPLRLQQSATTPSVLRVRCSAQCGALIVLGADAATVDELGDHVEPVVAFVVGQTLE
FT                   GAGIVRLPSGGTGAQAKDRATAVTQVSAVQSDCVACLLSTGVVHVVLPSTFHLVFSIPP
FT                   PSVGRLGHRLSPRSHWSFTPSGPTFGAMWCEHLLLLLHLPTARRGDAGAAHAMEMATLR
FT                   VDSRSAPLGEAVAGKKRTPVKPKVSRLGGHADETVATAHGVAVVAQSFLRSCQAPLSTP
FT                   PRRAVAADSAHSCVDASLAVLSRCRPPIVVPKKGFPEIWPDVNEVNLRAAEQQLTARRT
FT                   SDAKGADKDTTANGPLAWSSTAAFCDTLSPSSCQYNVNQLQAHLLKHGVFPHQYRPAIW
FT                   RFLAGLPSKAKTASQFAALARRPPHLAVLQLMNPFPLPPSSTRDAVENALSCLCWASPV
FT                   FALASYLPVLVYPLSLVFHDDVQSVVELVLMFFLNWGRDFFVCHTHGPATLLMAMERQL
FT                   RRLDESLCQHLDAMGAGVAVWGWELLTSFFTDSFTGAEWVQVMDHVITAPPLFLFAFHV
FT                   TFVRTRLRSELTSALSVDEVRGLLRRAPTAAAASPALSPPKSLQRLIEEGYRLYHSWSC
FT                   ESGDSATDLSSFKVFQTLTPLFEYPVNFVHDSVVLAERLRELSLLQRSRDEEKRAAANL
FT                   EVLRKASAAVSAEEAAYLLQQRARVAAKYDASAAAWQVYVAVERSRQEREAEERQLKWE
FT                   ALQKRTRNAEELEALRAEMNMVECQLRHDMVDRHMEQLKWRLAAHLTDEELVRLQKDAD
FT                   TQVERAVQRIEEDEQRHAENALHYQTAPPLSIEVLPGEEDKAAGGNAASPTRGMEDSHP
FT                   STQPSSTATMTEEGCDNTKQQSAKRGRGVSAKRQEREAATEGRAPAGGTGASSQPPGAR
FT                   VALKEQRLCCCSSSPSAASSSASSSVSLTAADETGGGASGSLYHSSLGTPPSSVTLSQA
FT                   PAPVDGSGGRPDEGELPARVLEKASPSGGADPTSRRPRLVPPPRHAYCDVAGEHGETAL
FT                   NQRRFLELRDRVLSRAEAYTQPGVVDPLRRYPPPSRDDESATVTASCTHTGTATSSCPS
FT                   SNTVPSSRRRLFDNYEPYQRRSGGGRRPYDRQQWRQPHPPVDSYTATVTRTSATSSTGQ
FT                   SMSGSTSTTSSYESPYTYTSYDYDYSTTVSTTWRTGETRSAGSTVFSSSLDRSTRPRSD
FT                   RLAQDDGCKHPCASRR"
FT   CDS_pept        1839248..1843468
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4740"
FT                   /old_locus_tag="LmjF36_4740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4740"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4740:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4740"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T9"
FT                   /protein_id="CAJ09445.1"
FT                   /translation="METSPKAGSADVDLYVLEYIVNMRWLLRYAAHELDPTVEQQYPDF
FT                   VAQVVQLDMVLSNTAFEHSCTLGDVPFGIVRLAREAVLYLLVSDHLLGGCPPTMHPFLQ
FT                   RAVVAESTSAARRSPRRAPVSADLNVSFPSHGDGDGRDSGVSRTFPELDGRPLNSIDPS
FT                   SEAMLELAEVVAQGREAQAMLLLLRWLCSEGVLSEDDVLATVEMDRTGDGSINTQANTP
FT                   APAATGYEQFRRHQRLACHLAQMVPFYFGAHLLLSRSLLLQYCSTLLTTDAVMRHVAHL
FT                   RSVVSCAAPRLLAVPPPSSVEGALLEWFQVIVDSINASKDGAVVLARLQDCSALRAFIQ
FT                   HGPFCEDVMDPADRDFFRLVQSGESVCVALLFYYPDAVPLAELSTALRAAENGVARRGD
FT                   TDAGLEQLHQHLSLCYWTAILAAVRQLGVWTLLRAEEIVRYGRTALPLHLFCLIQQLFA
FT                   VLATNAEEDVRVSADTAWWEQMKSRDGLTEMMRATGADAGTDAQEWSDKATTTKSSAAL
FT                   SGAQQVLRRSMHDTLLPPVFAAPDASGDGAGTEQVRMGSGHDGWPHERCFVAPPSSTGR
FT                   ATESLDTDECRAVQNGVNVPATGEDDTDGDTTQFSIEVVRTQRGVQTVSGTGPEETLET
FT                   ATSVLRPMVKWRGGALTCTSAAASGTATTTMSLDTLTAVPAANLHDGQRRTDFRAAVFG
FT                   AHVVDTYARAEEECVPNSRATAAGDLTAQPALVLSELRPTCADALLHTRAVDAVLHQSA
FT                   TAVYAKLPTATTVLVDVPVVTAPAPTKRLFRERDHAESSLRSAGSSYKANRDAPVVIQP
FT                   AGVSRGTSSIIACAVELSMSSSLTESSDFVMRKAPLDPKEANEAAREISDSGDFSDSKH
FT                   MSAATTDFQCTTEESPSRQVFAAGMGTGEPTAVLNSAMPRPLLASTTVTSAIIPAARMV
FT                   LFPTHDAEEGVEDPETHAAAPRRVCDATYADLSSSMGSSPTTRGKATVAAQRSDASAAH
FT                   VLSSLAPVGGSARSPPKASTSSLPRARDSRSSHSRKCPRVTGIAVEDESRLLFRDEAET
FT                   CARDISNGRPFSPPPEQLEPLQTRWKDRQTRMAVVDHATVACDLPTPLSHEQTLRQADG
FT                   DAVPTMTGEDTEKYRALPPSMLSPSPVCPVSSARRGHEHAGDGMRDDNTPHRTVSEGAN
FT                   SLEASPMPLVLTRSLSEVYGTDYALMLEDMAASDVDLLRRRHRTTEESWYSSASWPYHR
FT                   SWHGAAESLASAISSTQNTAQVRELLDRLTGISLTDLANKDKQELYSALAQQQAVANEL
FT                   KTALHGGRTRVGGRGQFNNATHRPVLRRRKAQLRPPLEETDDRGKDALVQAGRAVRRKP
FT                   RDTFGEGAGTQRSLMSPMTAESGGSAAHTVQSDVDGQLADTDVSSQVNESLRFPAFTSP
FT                   LASA"
FT   CDS_pept        1844191..1844670
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4750"
FT                   /old_locus_tag="LmjF36_4750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4750"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4750:mRNA"
FT                   /db_xref="GOA:Q4Q0T8"
FT                   /db_xref="GeneDB:LmjF.36.4750"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="InterPro:IPR016542"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T8"
FT                   /protein_id="CAJ09446.1"
FT                   /translation="MHGRFALLSFCVLLFLLCLCLQRLMMEDSQAAQIAINGFIGSILI
FT                   VVCSITYVLWAVLPDDVLHRLHLTYYPDRYWAVAIPAILVMFLFHYFTTSWLLVLVTTH
FT                   PLTDGRCITDVDSKPDKEIEVGALADSSSSVPPWVDIPVSVASNLLFEPWNEKVR"
FT   CDS_pept        1845331..1847280
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4760"
FT                   /old_locus_tag="LmjF36_4760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4760"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4760:mRNA"
FT                   /db_xref="GOA:Q4Q0T7"
FT                   /db_xref="GeneDB:LmjF.36.4760"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T7"
FT                   /protein_id="CAJ09447.1"
FT                   /translation="MYVRIHETYSGPPPPLLTLPPAHLFLFASSAAMSLRGSCVRLQQT
FT                   ALEVSTLHRLLRHCARHPERFELAEMYRLGILLKDSNDALALSSNTELLRSLASRYAQI
FT                   RENASPFQKSLLDAVLPRSQSVPTAGSSATGAGTAEAQLTTESPSTADSALPVTAHEYF
FT                   KSIMELAKDAEAEHYRAVAREARASSRGPQHDVSVDVREGESPRRGATAARAPSRSDDT
FT                   SAAGLGEALGSSRTEVLEAHLTALEPNLRQLSPAETCHLIKTLAKFNYTNYEHAVLLTR
FT                   RGCEISGQLKRRELCQLFFNLHKLHTRDSLVAIVNHLLEHTTEMTADDVFLLCQALERQ
FT                   ENTSSASQRLLVSLVAQAIKKLPDAPSAAYHRALLVSMARYNVVHRVTLQVVLRDWVER
FT                   WKATTSERDLLKMFEAAASLTSAAKLEGLQQLVERLTELAPTMDMCLMDRVMDLLSMVP
FT                   MDMSTKCMMSILARLVDEAGHLSVRQVVFILQLLSTYPPAKGHTAVVSMAYAASVRASS
FT                   MDTESLESVVISLAMLQLYTDDFFTIAHVLQAQKGGMRSFAAVQELLRHCTSEMAATKR
FT                   GLGMLANVIFTVAPMLSDEELASCRRALVNLGVQDRNVLQGIFAKAKKLHRAQSTGHAR
FT                   KKRLGSYDPMADLL"
FT   CDS_pept        1848194..1849846
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4770"
FT                   /old_locus_tag="LmjF36_4770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4770"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4770:mRNA"
FT                   /db_xref="GOA:Q4Q0T6"
FT                   /db_xref="GeneDB:LmjF.36.4770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T6"
FT                   /protein_id="CAJ09448.1"
FT                   /translation="MSRAAAGAAAGVAVMSLFSSALSTGNRPASLDYICQRIRLNLVPL
FT                   NAQDIYQICTVVYNNDTLGVLSDAELMRGIADAFQRSDQSVLNPFQASLVLDTLRRAGI
FT                   NASPKEVMVPEEEAISPETLLNVLRAMNVHGGTRDERKIDEVLKNVPAVLDEFSPTQLS
FT                   LALCELAKLRCVNAEAMNRIAKRLFEKTEDLSVMEVSLTTMALAKTRGMPYATVRRAFA
FT                   LSEQRLDEFQPDDYVNVLLGLQAAGKQYSRTFVKLVEAALGKVENLDAVTLTQFLATFT
FT                   VLDYGKREHLEIFADALVDVASDLDQQNLVQSLVALQRLDLLHEELFSALASCLMRYAK
FT                   HLEPRFIAPVMDICSGVSHNTDGLMHVLLDRAVECTRMLHPNDLADILDIVALYPGARG
FT                   HALVEVFGRQARLRLELFNPVALARATRGLAHLGYRDVDYYTQAADTGFRFGFKDWSSL
FT                   EPILMGMCFNKEVPVRTIKVLASFVSQMAKSMSLQEVERANRYLVQLKCEEDHVYRSLA
FT                   NRVMHFVKEITPDMPQELQVLVQRGAVNRLTEG"
FT   CDS_pept        1850707..1851660
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4780"
FT                   /old_locus_tag="LmjF36_4780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4780"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4780:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4780"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T5"
FT                   /protein_id="CAJ09449.1"
FT                   /translation="MEGRLVILPRDGLHKTSMFLVGTARRCILAVGSQSEGLLATPYVQ
FT                   QMADALKGEWAIAHVVLGSSHVGRSAPSHEADADDVDAALALLVKEHSMDEVVLYASGT
FT                   GVQVALEALASAAHAEVVTRVILQGGIVSPQRSKLFSVAATKRRLETARALIAEKRGDD
FT                   TTAMAKVYDMAVTPARLSRNATLTVQEALWQPVLGESESTCKQTLRGVTVPTLFLLSTE
FT                   ASYTAAAKDAVPAVQRAARDAIGLPAEDVQVTLLPTTIDEHRCALNGNGALAVKAVSDF
FT                   LQRADARRAQLESDATIVALEAKQKKDVALVNGVCA"
FT   CDS_pept        1853981..1856764
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4790"
FT                   /old_locus_tag="LmjF36_4790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4790"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4790:mRNA"
FT                   /db_xref="GOA:Q4Q0T4"
FT                   /db_xref="GeneDB:LmjF.36.4790"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T4"
FT                   /protein_id="CAJ09450.1"
FT                   /translation="MLSESDESTYSVHEAHRDDRGAVSKQVGNETEPETSSPLARYYPL
FT                   GTKERHAFDEHMRHLRQQVATVERERQFRVSHPFQPKTCSSFATAEDTVTDAALADSPG
FT                   HLASPVASGSGSSSSPSGVRPVFDRLAAQAVQLEMRRRHREEQRRRAEAASLRGAFQPH
FT                   INHTAPIYAERLQHLDLVPVEERLLHYGQFVARERQRKRELKELEQTVAWQSTQASLVG
FT                   AGTSQLRDPEERHRQQEEFLARNDRFLAERSKHRQCAEAAAAEAFTFQPKISATSAALD
FT                   EARQRCANDVSAGELGQLLNRSVNAPLLSISKTSANAGRRSDALYALAVTRQRQRMEKL
FT                   DYNSANSGETTKGVAKGKAVEDPNVTHQPLTNPTSDKWIAEGAHGAFFQEGFVRRQALY
FT                   EEVKREEAALRATAMQESELSSGRPATHKVDAKQLNQRLYYSAKTAREAAERRRQALVS
FT                   ARECPFRPQLSPGTKYVLEHMPCRDGDIVKRLTSQRSRASSGGARVAIDNDLYAPAPAH
FT                   QPSLQGHCRRPSQQRKTDVKNSAEAVQDTRRRRTSLRTASPRTEARGESADGCGDQLPA
FT                   QQQQQRKQHVRTLTLDEVERFYQRQIAALQQRQDLIQERREGKTMEELVECTFRPRTNT
FT                   DRYVGMDSGGGEGADTAVSVNHVTGVSAFLERQAVARVRKAEHDELVRTVSLLRHKSAG
FT                   SNGKISRTTALSPFKLQTEMRRQRLPRSPLESKQHREAAPFSTAALTTAERALHEAIEQ
FT                   SRRFPGASSQAPLFPLPGFAPASENGVHFDDLRHVAAASKDIEEPTSRVPPSTLSTEKI
FT                   GHGDAAAVGVGYDRPSLFSLISPNTFSGRNLGSAAYDSGNGKGTPVGRDFASGKPSPSA
FT                   LKGSKQRLTASVKRHRRNRSVSFAEETADAPLAGVARRGRKSFADPAHLAFLSGEL"
FT   CDS_pept        1857695..1859230
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4800"
FT                   /old_locus_tag="LmjF36_4800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4800"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4800:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4800"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T3"
FT                   /protein_id="CAJ09451.1"
FT                   /translation="MPPLAPRRRRRTSELKFCHTKRRRVSEALVERGIGKEFDRTLPFW
FT                   RCFIDLRLITGRVPEVVTRHTQVLCRIPCKVFKRVDVVWARTTVQLRPVHAPTWQERKN
FT                   GPRPPRASYTVPAKAAAERAVTQASATNGTPPSGTDGDRALRVYTIDTVHFVHEDAYKR
FT                   GTGSDHSFHVQSVVLRDAPHILQCVGGSMVSFSLIIYTSLRLAHACDARNCTLQQLGRQ
FT                   LEAVVTVCDESSSTTTTESTSERANNASSAADATRTGQGADAAQQVHSTTQAKRASLAR
FT                   DSDFKSSSEIAAFSVLRAWCPPPTARILILGMGGNSMAHALRVVLGAEALIEVVEVEPA
FT                   VVVSCMQMGTLHESDTKTKVHLQDADQCLATLPPTTYDFIYMDIFEPIQATMRNLHPWV
FT                   LATRTLLKPGGLLVMNDHHLPSAAGVAPYAKVFGEGNVQAVNLRGWSESIVVCVAPGDA
FT                   ATDKYSLDVSKTHADIAFNIYETLVPGWLPHFSWLVKAKTYRHEGVRCRLWTS"
FT   CDS_pept        1860228..1861064
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4810"
FT                   /old_locus_tag="LmjF36_4810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4810"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4810:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4810"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T2"
FT                   /protein_id="CAJ09452.1"
FT                   /translation="MASLSEGRVARFTSRWLTEELNSFAQSGNWQGALQTFEHMQQSSL
FT                   VRRNVFHYTTVLTACTRAGQMDAAMMVFRQMKANKVKPNVYTYTTLINGCANAEKLDLA
FT                   LRIFAEMRLVEVPPNVKTMTALISVCSRCGQWKKGFQVLDQCEDLFIAPNALTYTAAMD
FT                   GCRRAGVCTPAIALLEARMTDPSQVRPNEVTYNTVLGACAAAKDHKAALRVYARMVADG
FT                   YEPIEYTRELLREVFRGTSLDGLADKLMVRVRTSKWEAYVPDSDPATALRAAQEGG"
FT   CDS_pept        1861845..1863374
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4820"
FT                   /old_locus_tag="LmjF36_4820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4820"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4820:mRNA"
FT                   /db_xref="GOA:Q4Q0T1"
FT                   /db_xref="GeneDB:LmjF.36.4820"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T1"
FT                   /protein_id="CAJ09453.1"
FT                   /translation="MNPTSMEELLAANAAAAHELRGVAVLDVPAFDPDGPSRVSISNRN
FT                   DSSAMMSEAMRRRANVLWRALYPRTAPPTTAAVAMSSNTGVEADAVTQTDPPSRDVVRQ
FT                   GILTVVSNTSGERTNNHSASTSSGMLTRKHARDGDDILSVNPEQLKARSALVVSKAAAE
FT                   EAEARMYSPPPKWRLAKVLVGHQGWVWATAVEPGNKWFATGSFDAIIKVWDLETGVLKM
FT                   NLTGHKEAVRSISLSKVSPYMFSGSDDHSVKCWDLERNEVVREFFGHKSAVHCVAAHPS
FT                   LDVVISGSRDKTVRVFDLRSRAVVHTMLGHTDSVMSLVVQQEEPQVISGGSDGFIYLWD
FT                   LASGKPLQRLTRHKKPVRGLAFTAAGDALVSCGADEVRVWKLPSGDFVTNASTRVLDDH
FT                   KSRPATSVSGGRTDEVEEYSYRWSCCAVSPRNVLAVGSQDGELAFYDWNIPQPRRVARR
FT                   HYAPYQWTKTKSLPGTLHGEGGINALTYDVSGTRLITAESDKSVKIWRMRN"
FT   CDS_pept        1864082..1865500
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4830"
FT                   /old_locus_tag="LmjF36_4830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4830"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4830:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4830"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0T0"
FT                   /protein_id="CAJ09454.1"
FT                   /translation="MTSGYSSYAGASGSGHERFTRILVVGEASVGKTLLIRRLCDHIFG
FT                   DTSITSTDEGSAPESPYQSQSAVADDDLGPEWGPTVGIAVDALKRSTTVLEDTVTMPNL
FT                   AMSTPYDTAAVARYTAPSCSLHSGENGNYPHCSVYDTPCSTSGYGRSNSVLQYRGQGFV
FT                   GSNTSFALLHQLTSASPPRRQTVLQTVEFHELGGTHGYRDVARLLLRNIHYDGVMFVYH
FT                   RRSLTSTLYLKEWYRWIRSVFSASPDVGSHYGAEAKKPVKCSKKMPRFMLVGTQLPGDE
FT                   LPAAAAGLTKAAAETLHMASGAISDETLLDGNLEVKLRALQSPQTLTQRRGVRHALSKV
FT                   FRRLAWPYHMWWCVSHPFFLLSKQYQEELGPRSRLGACGSRVVERFVWLFYQAEQALLY
FT                   VMAVILFGPYQEAVVLGHSRPKQTLEEMLKDELCVSQAHVCRLESNISLQSSLDDMVAF
FT                   FDILLRQDAPDEGR"
FT   CDS_pept        1868280..1871903
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4840"
FT                   /old_locus_tag="LmjF36_4840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4840"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4840:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4840"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S9"
FT                   /protein_id="CAJ09455.1"
FT                   /translation="MDSDLSKTFGSVRSAHAYDQRVSSTRQASSSFVNINQKRSWRPPS
FT                   SLFQPILDYMSSAPFALAAANPFLRLFVERNVEGGGFSMRDYQVTPILLGQSRCGCDGA
FT                   GGADALTREGITPMVNGSLFGGYDALGDRAAAAYSGACLGTSGLVVEEDGVMEAWCGKA
FT                   CDDENIRDDGSGPRSGASASVPRVIPLYISGVDAPQGLSPLSNHCYPYVGVNRVAPSTT
FT                   QAVSLSLKSSSAAAADMRDRMCLWECGQSAALEMSLCVCITCKSDAALHLLTLGAWWLS
FT                   RYYGVSLRLHHVHPAQLAAFKAAQCALSPKEIQLENCVISEDMLQCISTCTDLLSLSII
FT                   SCSASQQVTLRCINSILRKGNEMRPVDFSDAHGIPLDGDVNEGTGRHGMRQGFRRSRNN
FT                   HELLTNDTPTDPNREVTNWYLSGVRSLGSLKQLRCLHILYTPLHEAFLQALTTCSSLEC
FT                   IILHRCRGVRSLEPLRRLQHLQSLSLHGLSVTDTDLLSLTGCTQLRQLVLDECRQITDL
FT                   SFLANLRGTLERLLMPRTLLSNANMQHIGLCDKLVELHLQSLRQLTDIGVLKDLTALRV
FT                   LNLSDNLVTDEGCSALHCMPSLQRLNLAFCRCITSLAAAFTASGRWMHRLLSLDVSHTN
FT                   ITDAGVQCMQECTDLRYLNLCGCSELRRLSWLQKMSSLRWLNLGGTRVTDEETNHYLPC
FT                   ARNLRFLSLSDCSGVRSLSFAVRLHQLEYLSLESTSVADSELPCLCHCRKLRYLSLESC
FT                   VDIRDVSPLCALPALLELNISLTAAGASAGGALSTTSGGSDGRSTPHGSSTLISSTSSA
FT                   VSARSTSPLSSIGSASPVSPSIGANRFPVMQVLHLNGCSRMTRLEELSRYYPQLRVLYA
FT                   DRISVLPPRGVGIGFTGMDKLRRFGTTPRHRGLLQHTRSVSVSTDEPNSEGPPCANKSA
FT                   VHIHQALQQYLPQPPAGPRPHTPYAVASRHHSYHRVSSCGNEQRARSRTVSLRFPGEAA
FT                   RVLRLVLRRSSITDVMLEQLCVTFACVSCLDLTRCTEVQCLSGLENLYALRELTLTQSS
FT                   VDNDGVRAVSACETLEVLRLTECRGVTDVNCLGGLRKLRVLCVARTQLTNQGLEGIGHC
FT                   LALQYLNCAECRYLSDVNALSSLKHLIELHLERTDVVDAGISGVMRCSALQRVYFTRCQ
FT                   RLTTMRDVRAFWPQLEVLDVYGTSIPTRVAGQGQQFACAVM"
FT   CDS_pept        1874779..1876608
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4850"
FT                   /old_locus_tag="LmjF36_4850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4850"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4850:mRNA"
FT                   /db_xref="GOA:Q4Q0S8"
FT                   /db_xref="GeneDB:LmjF.36.4850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S8"
FT                   /protein_id="CAJ09456.1"
FT                   /translation="MSGITVQLVFAFVGTRVPYFMPESATAASSPARSPFGNASSVSFN
FT                   AAAQPTLRADSARTSPRLTPCIPTNLFTAHGLLSHLAKALEPSLHAAANPEAATAESAS
FT                   LSPTAPLPFHKPPVFELFDYASLDPLEGSAALRDEQVLLVLCDIATTAQLVEALQLEWL
FT                   EVYSGVHHPHHRSCSASTPEPAHTTDMAVCTTEEKLRNVAHAQQALCKPVGLHLSLLRK
FT                   ELLSREATLAAQKEQLAQMRSCTTEGTAPAAPATASGSDGLSTPMLSGRAASFPLLVEL
FT                   EPSLSSEPAPSATDATHLQKLEAPLALCEARVRAVESLMQRAAKHHTKLLGLAASERAT
FT                   EEAFQRGNVSRACAEYLEHTEQDRSAAEAIIADYQVEMTRQVKVVRQLIAYITQVRKLA
FT                   SKAKYEMGVVELILSRLSLTSLRPRLMKEAEALLRRRVILRRAARRQMLLLQETEFVKL
FT                   QQDLESFSQRMEVQKVLPEKVRWYLRAPLPSLMPEEDPVATLLDHALIDREEDEAQELV
FT                   EKTRVYTADSSDPEKNALQITEALLPVERLARRLEEARASAAQYKSRVEELEERLKLYE
FT                   TAEALSPPPLQDSAVKSPSTERPAEGGGSFEEG"
FT   CDS_pept        1880036..1880743
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4860"
FT                   /old_locus_tag="LmjF36_4860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4860"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4860:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4860"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S7"
FT                   /protein_id="CAJ09457.1"
FT                   /translation="MSLLALNVCLVSSSFDVVALPLSSTLCPVEVDDDVEDTSLCYGLA
FT                   PLTEKGRKEYGYAHCTVMQFCARALDLKAIREIVRETWLKFRKHVLESKESLVLTGVAD
FT                   GPIFATTEDGRAVRLPNITVERSPNLMWLHETIMRELGQYHVKVGSEDVAKSAFHRKFP
FT                   ADGNSTTPEWMLSFMSKYAHENYTPHITLGACTEKNVAAFSFLQKTEIPWRECRLVVSH
FT                   MGNFCSCFELLES"
FT   CDS_pept        1882197..1882916
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4870"
FT                   /old_locus_tag="LmjF36_4870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4870"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4880"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4870:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4880:mRNA"
FT                   /db_xref="GOA:Q4Q0S5"
FT                   /db_xref="GeneDB:LmjF.36.4870"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S5"
FT                   /protein_id="CAJ09458.1"
FT                   /translation="MGFLLQTISVCATLAALCMLASSVITVKSMRAVKSVGSMTITFFC
FT                   AQLLNCNVWGLYGVQTLALPVIICNTFGSAIAAYCILMFLAVARMEEKAGHVLKSTSYV
FT                   ASLTTATLTMFLIALLLLLFLYLMSFSSSDFAAQLIGILGGCCSVFMLSSPLGMAKTII
FT                   RERNAESLQPATVMFATLNSVLWTLYGLLSLDMYITIPNVLCTLACIFQVFLLVRYGRH
FT                   PAEHVEITATIAPVPLD"
FT   CDS_pept        1884559..1885278
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4880"
FT                   /old_locus_tag="LmjF36_4880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q4Q0S5"
FT                   /db_xref="GeneDB:LmjF.36.4880"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S5"
FT                   /protein_id="CAJ09459.1"
FT                   /translation="MGFLLQTISVCATLAALCMLASSVITVKSMRAVKSVGSMTITFFC
FT                   AQLLNCNVWGLYGVQTLALPVIICNTFGSAIAAYCILMFLAVARMEEKAGHVLKSTSYV
FT                   ASLTTATLTMFLIALLLLLFLYLMSFSSSDFAAQLIGILGGCCSVFMLSSPLGMAKTII
FT                   RERNAESLQPATVMFATLNSVLWTLYGLLSLDMYITIPNVLCTLACIFQVFLLVRYGRH
FT                   PAEHVEITATIAPVPLD"
FT   CDS_pept        complement(1886720..1887844)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4890"
FT                   /old_locus_tag="LmjF36_4890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4890"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4890:mRNA"
FT                   /db_xref="GOA:Q4Q0S4"
FT                   /db_xref="GeneDB:LmjF.36.4890"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR027734"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S4"
FT                   /protein_id="CAJ09460.1"
FT                   /translation="MVCAPHDAQCFCWPFCVSAAGSCSHCPFTSPVSRGAPKSSRTPSS
FT                   RGRRHTRTRQIQTKRTMETCDGLDGVAGAPKMTESLIFQQCRRHQGYSTPEFNDKLYLH
FT                   HLGFTQLHGLAAFTGCVVLYLDHNALSDLAGLAALTRLDSLYLSCNALSHLGSMPRLPA
FT                   LRTLDVAQNQIVTLNGLDEAAPQLQTLLAGHNRLQRLDGVQGLSGLLSLDVSHNCIEDK
FT                   EATSACLSGNRATLRTLLLHGNKLCSRTAHHRKRWIAAFPALRFLDEYPVFDDERARAE
FT                   AFAGGGAAAEAEVRCAQRARALADAREQFAYYGDIREAQRAARRRNGAETQATPYFLAH
FT                   TPTVNRAVVQDAEDEPIYIPATRGAVVHQDPLGG"
FT   CDS_pept        complement(1888281..1888946)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4895"
FT                   /old_locus_tag="LmjF36_4895"
FT                   /product="putative exosome-associated protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4895"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4895:mRNA"
FT                   /db_xref="GOA:Q4Q0S3"
FT                   /db_xref="GeneDB:LmjF.36.4895"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S3"
FT                   /protein_id="CAJ09461.1"
FT                   /translation="MKRADGRESPRAVRAIHVATNVLANCHSSACVEIGKTRVLCGVRP
FT                   PQHLVQEYRGTRGRVSCQVHRSLASSSNLDNSGDRDMALALEGVAEQAVVLERIPQLLV
FT                   GVLIEVVHDDGALWDAATTALCVALTAGGVEVYDTFSACSAALRHDGAIIVDLTREEAA
FT                   AAMASVVVCSGLSLGGVYYCCHKGACEATTMSQLVQAATKGLQVRKVPLLEQIRNQLV"
FT   CDS_pept        complement(1889388..1895732)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4900"
FT                   /old_locus_tag="LmjF36_4900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4900"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4900:mRNA"
FT                   /db_xref="GOA:Q4Q0S2"
FT                   /db_xref="GeneDB:LmjF.36.4900"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S2"
FT                   /protein_id="CAJ09462.1"
FT                   /translation="MNVSGDGGVYRGPRPRPGADSSSILATSSGALPKTQNHSQCSVGS
FT                   AEACKEEERLIVEDALRRLPQLAAFPLLSMSPRASSHVNDALVENSSFDSRQGTSYHLA
FT                   ADEEALLLQELVNITAGAAPFMSTAAQEEQATGGSEKRPDEAATLLGSRETGTQVPAAT
FT                   ATANGDSTSSAPKVSASEPAATSPAALSVHASTHTGKGASSSKRRRAVAPPTSSKTAVL
FT                   KEEQDILDAILAAVDGQQSSVSGDLLGETSAAAGAEAAATSADSDEEIDEVDLVLGQAK
FT                   QLTSSTVLCETQRGEVVLHVHEHMALRCKLADLRKAAGEPTCVAVAESFDISARAPTHA
FT                   STASPAAHTPSWSLRCAMGTSLGVVVLFDRRWTVLGICGTVEASVGNARGAVVSLSLCT
FT                   PTAALGGADETCDGRTAATGHARGTFVLWSLHTFSPLRVVSDESRVPVLRVMHLHRDPT
FT                   RILVLDSSGAARFFQFWKVMAKYVLRATTVTSASAAAPISDIDTLPCPSSFYMANLETL
FT                   KQHMPCSNGEESDGDVSAPWLCAPPPLPPSAATAAGISRTAWPTIAGKHFVATVSHDAV
FT                   LVYVVDTGLQGTVTGVARHSHPPSSALSNELVRFVVMEVERSTPRLLLCVSWNTEVELL
FT                   LMNLRVPEPSGSGKTAAAEPMMEGLERLTLLRLSAPLVQMVPLAGCSVLLCDQNNHAHL
FT                   MDASVAAMVERHRFGSLEYVGFASRLCGVKYHGTAASNRAAALLMGKEHAYGLSLRSWR
FT                   ERLSSLLARRKYTQALDLAKGFAEEVALSTVGFSSNAANCRRELHQFMERILIAYVESR
FT                   LAVLPRTEATGKSSGGPPKQSAGNSDPVCGTEFLLDVLQQIAFYCSAVDGLNLLYGPVA
FT                   LALQHQGLLSHLLYVLEQCMRHGIITYMPETLIERFIYLFLDDAELDAVEVALGVRPLA
FT                   PRDGKEARGDVLDADSAVKISGRDRVELALMSLDSGAPSLLRLAQEHGLVRLTVTILSL
FT                   RQQRYVDALAYALDEEQKADEGLHGSDRGPEVCAPRVPKCPSLFDSPDAASVAVDFVEC
FT                   TLKGVSLLPGASLAIGEQRPAKKAILEYLLRPASNDGRNADSGAVGGGVHNLLRFLRRQ
FT                   PEHAMRVLLFALSDEGPCSPWGGADGLSRTQFVSSVYFILTGGSRTRPRHAAESDLLSA
FT                   SGQRQGPLDLFRIDDELLNRLPALRTLRATELAQRPFPPYIAVHTFLAGAAIFNELLLS
FT                   TDADELASDEPDRPPVRLDVWLDLVIQDVLFAFQSAERVEERRELQEHLLRVLAPDLLP
FT                   PYRVAVFQSDFTRLRMARCLAALLCREQRYAEAIACYTDPMQNCVDAQLQQDVFKMLRD
FT                   EMQHLQDLRTQTMNRAQQESSRSQRRGGSALDSDRNAASLVGGSATSEVGRGFGDDVEQ
FT                   YFSEESSLIAPTVTATATAPIDAAIKSLQLAVMSQVELLVRIDATSLAQFVFDYLPSNQ
FT                   REVMKLLRGSSAAFMDYLDELVTQGDQAVANDMNLQNTYIELLCEHAPRRVYSYLQEKG
FT                   NRVTYDVQLALRAVRKHRIADAAVYLLEKAMMIEDAMTVMLRAVRELLGALREEVVTRV
FT                   TPAAEAATEAQGDQDRNGLAPLLTSTPGAEAGEAATQRGCRRRSTRGKEAPPLTCELAS
FT                   LDSATELRRFVGIGEELCRKHQAERVAGVASTSDAATPLAVASSRTFSSARHGFPGSSP
FT                   QHPEYWFRLLDVFMVPRRLLCEMMTQDDRLQALDTAPVPARPFTSSDPTGMSNELDAAA
FT                   HIAMASYAGAAAASLANPPSAAGLPQHLANLTTPLSREQRRCVEALVAVYTQYTSSILQ
FT                   SMMRTLDVAVVVSKVVQDHKNGTFCALKPVLLDMMDTLSFDLEVSRLCKLATERDVMLR
FT                   GRELYQMLNRSVVPQSDCCAFCHINLREPPLPQPAGDEVDAAATVGLVPSAVSVYTCGH
FT                   TFHTVCAAQAMGSRQGCGICMQSRCSSGKPGEYEVYGNTSGASAAQPSTSGGAAADRAG
FT                   HEDHADPVTTVVMRAAERTIDVARMQRRVRQTKMKMDHPEDFYSVLQSLLAWDTSASDS
FT                   SLGKAGPGGTRDGSGNRVLAPSPSVPAVAGQAHGPVTGGVATMQDKVLDTLTDAEILEL
FT                   FGGV"
FT   CDS_pept        complement(1897421..1898503)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4910"
FT                   /old_locus_tag="LmjF36_4910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4910"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4910:mRNA"
FT                   /db_xref="GOA:Q4Q0S1"
FT                   /db_xref="GeneDB:LmjF.36.4910"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S1"
FT                   /protein_id="CAJ09463.1"
FT                   /translation="MPLPPVESGPAAMTRRNFLVEMNRLRVSQYMPTRKQLEEEDLRIA
FT                   TIRQEEKRAKHAEWAESRRKAADSYNAAGTNSGRPLPGSVSRSMRASGKGKPAENTYKL
FT                   EKEEEAAKKREYNRLYEQEAKHQLAIRQATLKQMHDDEVRQMEALRKVNEEEDRKVAEA
FT                   HAQAMEEERQYMERLKQSNKRELAARKAEQQAKEARDRQLQELVNENNRHRAEMDERRL
FT                   KNVTRMLHLQNEQFHREAMMSKKASEAKHYEEVAATEERNRRLTKEEQEAAQRKKEQFR
FT                   QDFEDCIARDKEFRRTHNYDEPMEVTRQRNELAAQSYRLVLEEERLQNAERRQQYRKDL
FT                   MDQIMAKQTYRMTHLDEAGI"
FT   CDS_pept        complement(1903517..1905649)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4920"
FT                   /old_locus_tag="LmjF36_4920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4920"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4920:mRNA"
FT                   /db_xref="GOA:Q4Q0S0"
FT                   /db_xref="GeneDB:LmjF.36.4920"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0S0"
FT                   /protein_id="CAJ09464.1"
FT                   /translation="MSAEFTEQDKEDLREIFRIYDFSKVNKVDDSVTLAQKAGQTPAEL
FT                   FDDLYQLFKIQKLPQRETVARRMREAVPNATDADIESVIRQSEMKGFTERDALRSLERK
FT                   YSVQHINKRVLLASRGSHSSPQGKALEEESELGHAAGSLHHIKVSETSLTSSTPLAASG
FT                   DVTEKASGLSLMFSRPPSKLSGAPTREDLDEIIAEEVREWVAKMVGVKHNADVWSMPNF
FT                   VDALRSGVLLHVLLQKMESPPVSDEDLKLPKRTTGFFVRDNVATFLTTAKSRYDLVDAQ
FT                   LFTVSDLVDGKNDRQVVTCLMSIARIAYSAGAIKDAPNIIVYEHEIEQQQNRLTRLDLD
FT                   RIVQEAEADEGMRSLVARSDDPAEWPSSKMAPEPATASPTVRSCDECPGFAASSTEESL
FT                   GVCESAFTQHELASPEVTVEGLARCSVPDTAAVCDTDKLNDKRSEDTAAAALASALPSE
FT                   QTPRRVPASPAGMQPPSTSAIECAADPSVLSTPTDVGEHSVPGNASVGQASPTSAQLTP
FT                   AKSDEALAAAAQRTAVAQPAETTEEKTSARETDVSDAAPSERRRSGEEDSDGSGRVFYL
FT                   RDGMIHLAKPTPIEEKVVGVRSKKTGPRVVWKSTSTPLEATQPPRYHSRHWDGIDVVLG
FT                   RHLNAHYEKHCQSPWRFRTVTATSGEYVLYNRLNASRRVVFLRIIQKRLFLRNAGKHQR
FT                   WIEIDEALGGLEKLEV"
FT   CDS_pept        complement(1908332..1909852)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4930"
FT                   /old_locus_tag="LmjF36_4930"
FT                   /product="putative translation initiation factor 2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4930"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4930:mRNA"
FT                   /db_xref="GOA:Q4Q0R9"
FT                   /db_xref="GeneDB:LmjF.36.4930"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:2A0U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4Q0R9"
FT                   /protein_id="CAJ09465.1"
FT                   /translation="MRFFFFAVAGWGGGGNPVRCTLPPVRDAVVHFLSTFLCLSSLHFD
FT                   VLRSFINRRPTLPKPSPPHNPTQPQGKRRTCETHRSAQRHLPIQKKKSLLKTHPATSSE
FT                   GFLARCLYLTTSTTTPLNPSLLALSTVMMSKPHHATLESIKYTPGSLRLLDQRKLPLET
FT                   VFDDVLTVEDIWSAIKEMRVRGAPAIAVSAALGIAVATQRKAANGELKSGREVQTFLLT
FT                   SCDFVMTSRPTAVNLFNCLRDLKAQVDKLDPTKAAAEVAQAFVELAEAVYTNDVAFNEG
FT                   IMRHGAAHILAAAKAEGRDKVSILTICNTGALATSRYGTALGVVRQLFYDGKLERVYAC
FT                   ETRPWNQGARLTVYECVQEDIPCTLICDGAASSLMLNRKIDAVVVGADRICQNGDTANK
FT                   IGTYNLAVSAKFHGVKLYVAAPTTTLDVKTASGNHVEIEEREPTEITTNLVTKQRVVAD
FT                   GPHLSIWNPVFDITPSELITGGIITEKGVQAPAASAPYYDIASIIAQA"
FT   CDS_pept        complement(1911659..1912486)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4940"
FT                   /old_locus_tag="LmjF36_4940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4940"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4940:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4940"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R8"
FT                   /protein_id="CAJ09466.1"
FT                   /translation="MSAHEEEIDMILSMFSDECERYEGTSDSIIVHLPFHFELQVTLPP
FT                   HGYPDASYPKLYLLSSPNAQLASAFSQAVYRRMRDEISLGIPMLALLIPLAQSVAEELK
FT                   DLKERAEKARQDEAVERMSELQRKEEHRRETGIAIWSGQAIVDRRSRFVAHMARVHSMD
FT                   EVREVVGHLRSVKSIACAAHPTIYAYRFTDANGVLQKDSDDDGESGASIKMMFLLDHLQ
FT                   IDGYVVVVTRWWGGILLGPDRFKHIMEVTKNLLLTIPEREKEMAASAKRKSLR"
FT   CDS_pept        complement(1913106..1915256)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4950"
FT                   /old_locus_tag="LmjF36_4950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4950"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4950:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4950"
FT                   /db_xref="InterPro:IPR032862"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R7"
FT                   /protein_id="CAJ09467.1"
FT                   /translation="MRPFRLVQRRRHCVARLCTAAGFERQPQQRRSIITSTPSSYAAFA
FT                   SATSGIGAEMKAKGFHHSTPNFNTAEFTDAADPSDLANDIVTESAVAVDFARDIYGPWL
FT                   VMTDDLQGELFVDHDGFVYYRPANGLGYGIGKLQVLDAGATGTAFTCQLESYSYQPTNT
FT                   VVPQYGLTFDITGMVKRVTAKSSDYKTFSLVGVWRRSNRNKGAPALLPSQRSSSDAAVE
FT                   GASAALSPESLDNQGALDGPGEKTSGQFNAAKLSPWDPSTAARPFAPNAELQSVFTQVF
FT                   PERLRAESHVQRAEASRESPAARHLAGCAGKPSLMHLDLEQYATGKIPGIYYIPDYISV
FT                   AEEAQILTFIHGTPEELKSKLTKRTCQEWGCTMCESCQKSFVSDANMPQWVQEFIDMQV
FT                   YDGLFTPTTFPNSVRIHEYHQGDGIGPHCDGPIYVPMVTVLSLASSCLMSFYPKQPLYE
FT                   NHPMDHYNDTFKFGEGDIGRRVPLQSVVMEPRSLLIFSGEGYYHYPHGISDKAEEVLTP
FT                   EVVGEVVNRRFLRDPHVQSIPRTYRASITTRNLMTRCSHQPARAEYAMKRAWYLYNHLP
FT                   VPSELFTPAPQLPQQQQQPAGVSAGGSSGSRESSDASATRSPQKRVESFFPACAPPGTV
FT                   AVDTELREAIYEMRARQEDLRNNVEELKQLVALSIPVQTTFQTETATILNHLSSSVLQL
FT                   ESKVDDLLEEVESAKRKSSTDT"
FT   CDS_pept        complement(1916377..1919304)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4960"
FT                   /old_locus_tag="LmjF36_4960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4960"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4960:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4960"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R6"
FT                   /protein_id="CAJ09468.1"
FT                   /translation="MPISSDADVVAAVPVLKPLLALAGSSVSWKHLSSHDGYSVSELPP
FT                   IPALGLPMKCYRTQFVVNGDLDLFQRVLSDEASIREFDSALKEMRILERRASKTLLYTS
FT                   YVSPFPWLVTPRDFCVWSAGIFTTLEQLKRVCSEAKEGSPQSFNSALAVRKLFCTCQQS
FT                   GEAPDPGQRVYLQNSVTALVSDSAAVPTPQSGTLFVRGVVYCFGYVAFADPSIQGTLRV
FT                   THYCCVDPAGQIPTWLVAAAVDENTKKLRKMAELVEAAAAAAAPAAEPTSACLNAPSAD
FT                   PLPAKEPQEPAFTSTGSAEEPSEEAKGEDVSTPLFTKDPCDEAPSLAVPTVEGFSDSGA
FT                   YPSPDAEGEAVLSMAPESTDVSPSPRPMPKEQRSFPPPPATCRNTATHDPSLTSTPPQP
FT                   PGTAASVDPRVEILSLLARSNGWCKRREVEEIQYAELRILPEPLRSKDPLCIAMRVSAL
FT                   VRCTLDTFVAVLRNPALFPEIDPELVRVVAASTSSGASSRTASCEPSTAGHGSAPTAGE
FT                   LRHYQFDATDPFRSPWEMILLCSDFELTQIDGGRYGFHTPGVPAATHVWVSADSTTSCY
FT                   RGVHPDGYHQHMQVRVFGVTAVAVPRSAESIRVSQYMLFDACAPLLLIPHSSWHISFQK
FT                   KCPTEEFVSGVSRWMEGRMNRLRRLSEERHRRRNSSAMVALDKVPLLRFLYTVHCAESG
FT                   RALKSPEAAWYGDVLARAIRWTGKGGCSSLRTEAGSGDPPLVVLSTVFPCSLAQLRKYM
FT                   LFSSPRHRYALERGIDTYEELAAPPEFTTVRVVYGAASASFPRVRLTVLEAFGELHGVN
FT                   VPCPTLVLSRAGIDGDVGDESDELDFGESFGHLRVSADKRFEDGRVFCSGWVATTLEGS
FT                   GSQSCANDPWAAVRSPHSGLAPVSPELCTERSISGGKAEEAALHQPECIVVTQYLSIGL
FT                   PSAHQRDLDADGLPCGCVAEQAALLQRFRDSVCTWGSPVAATTSE"
FT   CDS_pept        complement(1922822..1923859)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4970"
FT                   /old_locus_tag="LmjF36_4970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4970"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4970:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4970"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R5"
FT                   /protein_id="CAJ09469.1"
FT                   /translation="MFSRTGFRCAPVVEDVVAAFKVLGLAYNPRAPASSRPGVDDVRRQ
FT                   YLEMARLHHPDLSSGDDNRMKVINTAYELIQSSGILHGAYDAPAGAREGVAGQQGGEAG
FT                   TATRFARKAGARRRRMPDDFASGDDSSWSMKTSLDWQAIMNSTETLSDEEMKNPANHPF
FT                   SHSKFFTFEDDLTIYRMICGGATVRQVARSLGKPATFIERRLQNAQFKLRVQYVLRQDK
FT                   RKSTAASSNGAASSGSMQQTTSTTITEPATRRALRRSPYEDAHVSSTVRKREWEPSYPE
FT                   WRAPRYRDQMTLEEQGRLDGLLRETPRAAHAAGKSVSSLHSARRSAASKMGRSYENYKR
FT                   LRPSF"
FT   CDS_pept        complement(1932838..1933842)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4980"
FT                   /old_locus_tag="LmjF36_4980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4980"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4980:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.4980"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R4"
FT                   /protein_id="CAJ09470.1"
FT                   /translation="METMATTVSPSALCLPGGLQTLSASCYRHNPYAFTLLQEKDRERA
FT                   AESFSYIYSVLTDEGRTSPAPPQKRKKARRGVAGNKGGSKCDSSCRDPEVQPLDSLFAK
FT                   SGAAADSSNDDGVSETSSDSGSHYAKEVLATYPPGFSVTSSQSHLGTSSATAAATAIPA
FT                   AVQSVIRYASVNFRFGSAWFVAPFRTFTGDMVVVQYPGNNSLHMGLVSAITTAKPITFY
FT                   TEDNMDPNYLSPEELQTVPRLLRHARDFDKETKLDLRRHDLSSLANARKLAADFGAPVQ
FT                   FLDAEWLLDLSAVTFLVKVFGNTALADKLVDELAMQEGAEVVFTYPVSSATMY"
FT   CDS_pept        complement(1935517..1937196)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_4990"
FT                   /old_locus_tag="LmjF36_4990"
FT                   /product="putative delta tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.4990"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.4990:mRNA"
FT                   /db_xref="GOA:Q4Q0R3"
FT                   /db_xref="GeneDB:LmjF.36.4990"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R3"
FT                   /protein_id="CAJ09471.1"
FT                   /translation="MATVHVFVGQCGNQVGTAFLDTVASEAEASVDEGYQMRVSAMHFR
FT                   PALRPPPARRHHQRSATGPSREPSEAARRIGHRQYYSLSYYAQEKERAAMDTSLPQPRC
FT                   VLVDMEPKVIAATVQRANGQLEQHKSSPSSSSSPSPQSASRRLYSLAPQQCVTRGEGSA
FT                   NNWAFGYHQQGQSRRDAIVECLRRESEQQGTVVSTFHVLHSIAGGTGSGVSCLVAEEIK
FT                   TMFPRSTLLHSVVWPFRCGEVVTQWYNVVMAVSTLGGLADGVFIAYNDAIAEELKGARA
FT                   NRGFKDAGEVSFQLINQRISGVLAPLHLPQLLYTLPSPQKDLSKNRILGTGSGAARGVL
FT                   GSGPTGCVAEGAAPRRYATASDVIEALSLDPAMKFFTGSLAPQMVTGSTTWAAVLGEAA
FT                   RTAQHSFTAPSALAPSADTGFSRSEGKAMTDRVADASAFYMQHRSCLWAIRGVAAHTDG
FT                   IRELRHLMADIASSPFPMTSLFVSPAEEWRATPSYTRPDHSVTLYGPTPMVGASLADAA
FT                   GRAEELLHVGAFVHHFERYGVSKAELRDAAAVLYDTAAAYHL"
FT   CDS_pept        complement(1939738..1940808)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5000"
FT                   /old_locus_tag="LmjF36_5000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5000"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5000:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R2"
FT                   /protein_id="CAJ09472.1"
FT                   /translation="MSFLRGSASINRTLITVVLLLTLTLLLDLRRLPDSSAAQEYVFSL
FT                   LTPCDGVGLCNLCGDVLEMVDLLQRALANPFQDKLTFSPEDWDAHGLQPYQRCLREPFL
FT                   RGCDTLVHKIRMQRIDFAKGILEQVVEDVQFRQKWGSLGEDYVTENAVQLTAYIFDSQE
FT                   RSLGGRRDPRKEDGAAQNIVYQPSTLSLGGDPALESLVTCVWFLRRDVLLLHQDFCYPV
FT                   CEGRLTVFGRVQVALLRFYVRHAIKPRLLFLRQQHRGTLVVVELMMIGFAFCVERLMRP
FT                   GLTCSGTVARRIRRVQGGTASSTSTGSGLVSGVHGEDSVAAASSGGGSAGGGGGGGGGG
FT                   KLHCRPGRRRRWVVVM"
FT   CDS_pept        complement(1942867..1943607)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5010"
FT                   /old_locus_tag="LmjF36_5010"
FT                   /product="putative 40S ribosomal protein SA"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5010"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5120"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5010:mRNA"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5120:mRNA"
FT                   /db_xref="GOA:Q4Q0Q0"
FT                   /db_xref="GeneDB:LmjF.36.5010"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="InterPro:IPR027498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4Q0Q0"
FT                   /protein_id="CAJ09473.1"
FT                   /translation="MSAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRT
FT                   AEGSHIIDVHMMWEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFHGG
FT                   RFIPGTFTNQIQKKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIA
FT                   IPCNNRGIKSIGMMYWLLAREVLRLRGTIVRSVPWEEKVDLFFYRDPNEAAEEKAAAAA
FT                   AAPAAEAEEGFGWVERNDDNAWEA"
FT   CDS_pept        complement(1944587..1947124)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5020"
FT                   /old_locus_tag="LmjF36_5020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5020"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5020:mRNA"
FT                   /db_xref="GOA:Q4Q0R0"
FT                   /db_xref="GeneDB:LmjF.36.5020"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0R0"
FT                   /protein_id="CAJ09474.1"
FT                   /translation="MSSPVKPATSASDNLFKSLERDFEEAMRALEGEESLGHFRFEYDK
FT                   LYRALKKSHASENEIATQCQQLTQELLSNAAKMQAAVKLAQGDHSTIESLKKEIEKAWR
FT                   AVDVANEKDQRAREMVKTLKQEIQSLQSMIHDGTSMSTDHMSTLEQLKIDNKRLLTESE
FT                   DMTKQMDTYTKEMAERSATLGTLKASTEEAVQERKLLASRLELVRQEYNRERNARERAE
FT                   YQCCELLLTLKTREKALQERQERLTLIHAHAETHKTELEKQQRRRQALQQQLETAEKQL
FT                   YHTKQSYNDSVDTTVELNERLHAMEKQIAATGKMILETRDECARVTRIEERDFREFDRL
FT                   KQQIDNIRRDEDRIAYEEETVRKRIAAVKQEKRTLQEALELLERECSALEKKGAREESL
FT                   QTATQALVQNELAQQAELEACISQETEIGRRLRDALQRLEKERENCVSEVSQMSGQSKS
FT                   AAEELKMAIFQVEEVQRKLDESERRLTQQQAKYEHMRAERNQLSKRLVDAQDEIVEYRQ
FT                   RVKVVDHQVHQFKEELALKARKCQSDKSQYKISKERLMKARQLVNDSTASFDATMKEGE
FT                   RVGQEIKRLLKVMQECDKGLCGQQREFTKMSNERDTLAAQLTRRNDELALLYQQLQLIQ
FT                   DTVNAGEAAYRDRLDDLRLLHLKLREIQHQSMLAQVRGGEVSTAKERLRAKQKEVLLEQ
FT                   AKVAALAEELENPQNESRWRRVGGGYPSMAELESKMKVLQRNLLTKSEECMKQEMALEE
FT                   KQRLMMEMHAMAARQPGPEVAQQLNAYQKDMQKKNAQMKQKASELNMTATHKAELRYEV
FT                   ARLGRAVDEMRQKYYEVKVKNETFLAAEFVPAS"
FT   CDS_pept        complement(1948071..1949237)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5030"
FT                   /old_locus_tag="LmjF36_5030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5030"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5030:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q9"
FT                   /protein_id="CAJ09475.1"
FT                   /translation="MSALNDSRTTSGRPLPGGKPYALRPEGIPPSLCGDNVGASRGGDS
FT                   IGDFKTAFEQPHSIDSEEEGDVEAASSPEQRLRRVQRDVYRHERQIASLFSEKHEHCEH
FT                   LATVYKELEKVLRKIQLAPLEDLKGHAASPSASTFCAPSSDEDGYAASSTVSALASSLQ
FT                   QRFHQVLQQHQDRVYDVLVDYRQQINKSEYETGRRLCAIEEAIAQIQSDVRELQHTASI
FT                   QVEELRHVQQDVRQRVEAVAVQQEAQRAALDATREARDTKAAKLLSKIQDDVAGLRADA
FT                   KAARTQQIESAKDVEEQIRSLLSAQHRTEEALGAHSASIAQLQNQDSLEGAFHEVKDWL
FT                   GDLEKRMVSRGELLQWTASLQSEIHQMRRVTGGVLSHTIEPTAPGQDA"
FT   CDS_pept        complement(1951064..1952359)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5040"
FT                   /old_locus_tag="LmjF36_5040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5040"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5040:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5040"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q8"
FT                   /protein_id="CAJ09476.1"
FT                   /translation="MLRRTLRRLMPSDAIGSVHPDVLWGYQQGQYAGPGWANFVKSLPL
FT                   ETLAMQGGSTMANLNDRAGTFLDPEDPRHPLALMQFGIMGKMDGTFHQLAYGDFGRVPK
FT                   GSRLMQVLYENYLEPFSMNRVCAQLYFYQKVPNNYHASVDATAEYVGQTASLVGQVVVG
FT                   LGACIMEGVTIRADTNCVYIAEGVQILENTCIMSDAPTDLLAYQRHELLNPYQQWDGMD
FT                   GVTRIMPNTIIESNCYLDGCSIGSFNRIGHNTKIMKGVTTGIMVHIMPGSVVTADTKIG
FT                   DGELWGGAPACKIGEVSKFEYKRPYYASLLHRESVAESYRNMSRYGDQFVHYMNAMGQL
FT                   ETLMIHYEDHVTPGIKAKVRDFEEGREPFHHTITRIAQGWSPANRPDDKNFAMAPPAPG
FT                   VKLFAEHNTDSSPSEWNGSYANITNIFNDFRW"
FT   CDS_pept        complement(1954552..1955355)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5050"
FT                   /old_locus_tag="LmjF36_5050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5050"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5050:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5050"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q7"
FT                   /protein_id="CAJ09477.1"
FT                   /translation="MGTRLHFTVGRVCRAIIGVHLAMSSSFFLCSAALHDRAFEQHWNY
FT                   SKVTLRKRTHYFDFWRSAFYSPVLSREERECLDVWLSILAVHSPMFATIQLSPTAILQD
FT                   SMAMLQGISELRDGVYLLEKLPIRVEPYLQELRREIQDDVVFLHGKTRTDIYLTVPFTS
FT                   YSIPLFVFPASFTLQLERTHTNGHLHITTVEHRWFSGLICSHQTNSVASPWGDVGDLCR
FT                   RYNGFLWSLMVTKKISLDERRRALATRAAEIEADLKEQQERQISM"
FT   CDS_pept        complement(1956714..1958036)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5060"
FT                   /old_locus_tag="LmjF36_5060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5060"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5060:mRNA"
FT                   /db_xref="GOA:Q4Q0Q6"
FT                   /db_xref="GeneDB:LmjF.36.5060"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR036283"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q6"
FT                   /protein_id="CAJ09478.1"
FT                   /translation="MSWAALVKSIKPEEATNFTAKPRVTVFAVDPSQNDAERQLQNPQH
FT                   ETAEVKLPSFSKGLLILDANAIIKGMDNFVSTADALVTTPQVIAEIKDRASRELMERLP
FT                   HKVTVLDPTPEAVAAVVACAERTGDFGAMSRTDIRLCALALECCKVGGFLGEPIEPRPP
FT                   QVNPRNDDKVQVMTEEMGEDGSNDERAKSETAHAQGASSSAMPGWGDWSDEAKETDGEG
FT                   GAGAAEEDDGEGEWITPENIQDVQSGTRGAGRAFEAGMACVTSDYAMQNTLMHLGVPIV
FT                   GTNGIHIRELRLWMMRCTACFTLVVDTTRQFCPECGSGDTLRRVNYVVNDQGEKKLYIN
FT                   FRKRISTRGTIYNLPRPRGGTHGTNRNLVLREDQLAHVIRGTTSSKVKAHQVMQNDDGA
FT                   LATFGEAPKLKKKNLADPRAYSSYHRYNVNEKKKVRAAHRK"
FT   CDS_pept        complement(1958962..1960173)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5070"
FT                   /old_locus_tag="LmjF36_5070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5070"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5070:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q5"
FT                   /protein_id="CAJ09479.1"
FT                   /translation="MSFNLEKLNRGLTRLASVRQYPIAKKQYVAKQTKGRVFRVGVLHK
FT                   KELTETALLRNRRGFINAQLNTVAHAPSLYHWLFHRCGIPFAETQALAKSGRLKVNEVV
FT                   VSNASDLESQLSWETFQQLDIQVCSSLPALQSSASTGACARESSRVAQGTWVPALKRAL
FT                   HRTYTFIYLHSGVSVSSEESDPRSFVHRMAPIVGADPSPLLGLNVLRPIGFFDGMKGIG
FT                   IASNDVSMLRYWNNESLGNFGVYDVRFPRGTPLEVVRHAAKDVEVTLQARVQPQLSTDI
FT                   GVSCSCVCCPPPPPSRDTVANQLLSAIPLLTEERLLVRTPLLPYRMARRLQRSGAIISL
FT                   VRNGPFVFPSTLVQEKLRPCNATDLALLFTFERRLKTNRMVLSLREFDVGKKNATAVLH
FT                   DEAR"
FT   CDS_pept        complement(1961258..1963147)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5080"
FT                   /old_locus_tag="LmjF36_5080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5080"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5080:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5080"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q4"
FT                   /protein_id="CAJ09480.1"
FT                   /translation="MEAPVSSASSPAENAPSSRGTGRGGRSMFRSGRGTNDHRGRGRGY
FT                   SHGGRNAFQGRGRDRGNARGHGDTRGRGRGRGKGQPEDRDFAPKKFMRHRSLSGKHGSH
FT                   TPLDGERAVKREKKDKKPNSNFALLRSTLGDAETIAEYIRDYHSSKKFSEVKSVNAFLQ
FT                   AVSQRPKAVYEELMSQYKDEVFTTLERLFALYALGKTPMIPPAHEFLIRCEQEGVRKSA
FT                   WGEGVRTLPVKAAETDAAIPAEGEAEGVAPSPQPPAPVAPPLDAEAGSLLSPRELLKKL
FT                   ASLDVVGRLQRLIEMSRSVADIQVCANKLTALITDARDDVEKGSVIPTTSAEKFDYAAK
FT                   CQLISKLLSKARRLVEPTFAPPSRAAADGASDNLVEKPAEEATVRRSEQVFGGDDEEEL
FT                   PRTAAEAAFSGTSATAVDRAAPVVTQRRVPLTDDEIEGFQAAISVAFHALETVLEQHPP
FT                   SVTHQPLSKFCKVLEWCKGKGLLASADERFATLLEQQVEKDIAEQANQIKTVISLKSLT
FT                   AGDTAALREVVDQLWEAGGSLCFSPSSMDVLSAIAVAASVDDIDADVKRLVADRLVQTQ
FT                   RHLADTVALPRRALRFVNDERNKVKQAAIAKQLQAEASKHKTEGDEREGEGLR"
FT   CDS_pept        complement(1964660..1965484)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5090"
FT                   /old_locus_tag="LmjF36_5090"
FT                   /product="putative protein kinase ck2 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5090"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5090:mRNA"
FT                   /db_xref="GOA:Q4Q0Q3"
FT                   /db_xref="GeneDB:LmjF.36.5090"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q3"
FT                   /protein_id="CAJ09481.1"
FT                   /translation="MDDAYSPENMEYEYEDEELVSWITWFCDLKGNEFFCMVDREFITD
FT                   DFNLTGLAPIVPFYHYALELILDVESMESDGLTEQQKRLVESSAEILYGLIHARFITTG
FT                   RGLKLMEEKYMQGEFGSCPRVFCEGHALLPVGQSDVVRESSVKLFCPRCEDIYHPRSVR
FT                   HRSLDGAFWGTTFPHLLLMQLRERGVSIPPPNQQYVPKVYGFRVRKPGTPLITNGAGEE
FT                   DTGAASAGAGDVSRKAEAGPHHKEEGAVAMSNTLDQRLSAESSSSSSKGKAE"
FT   CDS_pept        complement(1968498..1971443)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5100"
FT                   /old_locus_tag="LmjF36_5100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5100"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5100:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5100"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q2"
FT                   /protein_id="CAJ09482.1"
FT                   /translation="MQGGAPNNGNPYAGYQRGYPPQDGMQGYPQQAGRGGGAGYYAPQV
FT                   QQPPQPQPMASQPMASQPMASQQMASQQMASQQMTSQPPQQVAAQQYRGYSQAYNQSYA
FT                   ARGGYQPTPPQQQAQLQQGYASRGGYYQGGGAYGGAGIQQGYPGAAAPISRGGYGPGYG
FT                   PGYYPVQQQQGYYNQGYNQNPNYTPAARGGFQGGAYGVQQQPQQPQQPPQQPQQQQQQQ
FT                   PLSQQYGRGGRGGPGGLQRGGRGGGRGRGGRMFESYAVVHLDSYAQLEEVGRKGATETI
FT                   VAPEVLSAMRSRARGSTIRVLVVIQKKYAAACLSIPRGPEDTLLSEKTAETFVGVPCVI
FT                   VGHAERLIDLANGAAIQGAVFSTFRSLMMLLTTFDKPQTTPAEGGQPVNVHDKTRDELL
FT                   EAITKDIATYEALMTEMAADSDESTRLFSHLMRLSDAEVDGPQQGEAHEEGADADVGHN
FT                   EGEEGEEGEEQKAAVAEKPAEGAAAPKKMVKRTLMSSPQGIRILRAALTVSRKRQVFFD
FT                   KIVPPPPNPEANPLNRIEWSSSLRLIDPLLHYPLLSDLVFQFFGVVPVGGEAAKPAKAK
FT                   AQEVKALCDAIARYGVQLTSSASCGNTILALLQAMDPQHAKISVAERAAEETNRKPGLK
FT                   RGREAEEGDANADDGAQKTKTEDSPEEEREAASESPAAKQAPSSLAEYKASAAPVDWRL
FT                   YYAVAESWCTGEQPVLRRKRTRFTTQAQLDADAAAAEKPATVESRLRYVGHHLIGSFVL
FT                   RYMTPIFADVVLSALKSPASRKKKEHDAFVQQCETILSTMAGAWSTNDASFTGGNVYRN
FT                   LLTSLASRAVPGTPIEAYLRKLLDGIVNTIFESSKEKYLSHCVQEALTVARQTKDGGRF
FT                   TLEVARALMAKADESFMNLAISPSGNYVVRHLCGQLTDYATGKVAAESEVVAEAKELEA
FT                   KYYTFMTANLGKLTRIQYGRGLAGWQSEQAARLGAASAPGATSAPCSPNAE"
FT   CDS_pept        complement(1972603..1973397)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5110"
FT                   /old_locus_tag="LmjF36_5110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5110"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5110:mRNA"
FT                   /db_xref="GOA:Q4Q0Q1"
FT                   /db_xref="GeneDB:LmjF.36.5110"
FT                   /db_xref="InterPro:IPR028034"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0Q1"
FT                   /protein_id="CAJ09483.1"
FT                   /translation="MEHSLPCSGRVCRGCYGEIAEIVTHAGGVYMLQTKRQGTAHQLNA
FT                   IWRVLGEQLEEMLIKKRSGIVLDFLHASIKVQRVMLFDKSVAIELKPQLVLLPDFTSKF
FT                   HLKNVLEMQDAHYHATVPNTVSYITIASIVGTDRFVVEAAVKDSVREIGKYLQRNAAST
FT                   LTIDIGVGFLEFQDRTYRMKWSREFLARMRASVGAAEVVTPYDPPSRTIGGPTAPCRFQ
FT                   KGCTSENLLQTQVRNTVLAESRLSAAELNDGMGSSSYRRTHW"
FT   CDS_pept        complement(1974435..1975175)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5120"
FT                   /old_locus_tag="LmjF36_5120"
FT                   /product="putative 40S ribosomal protein SA"
FT                   /db_xref="GOA:Q4Q0Q0"
FT                   /db_xref="GeneDB:LmjF.36.5120"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="InterPro:IPR027498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4Q0Q0"
FT                   /protein_id="CAJ09484.1"
FT                   /translation="MSAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRT
FT                   AEGSHIIDVHMMWEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFHGG
FT                   RFIPGTFTNQIQKKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIA
FT                   IPCNNRGIKSIGMMYWLLAREVLRLRGTIVRSVPWEEKVDLFFYRDPNEAAEEKAAAAA
FT                   AAPAAEAEEGFGWVERNDDNAWEA"
FT   CDS_pept        complement(1977922..1978758)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5130"
FT                   /old_locus_tag="LmjF36_5130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5130"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5130:mRNA"
FT                   /db_xref="GOA:Q4Q0P9"
FT                   /db_xref="GeneDB:LmjF.36.5130"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P9"
FT                   /protein_id="CAJ09485.1"
FT                   /translation="MSAPPSYKNLANVVKDYLTKGSDVHGWQLDANEDGASTGFNAFPF
FT                   ASPKAIGAHLSYECPSYHTTLKSKVSAAFTSWREYLPTIIYHTKVNNTSSEIEVDAAAA
FT                   SVKVTSKHSIFNASCKSSPLDGFVTDANVTTRVFDQVYAGASLQYDPKRSGVRDFTALM
FT                   VRYACPHLSKGDVLGQYSLRDGFSVHVRVPLHTYMDAAVIAERRCFIAGVQARSPCGAR
FT                   LMLNTNVSNGTYTVTTIRNMNDIWKLAVTMTAPFASGEGAAAPRFGLKLTNMDAGD"
FT   CDS_pept        complement(1982773..1984329)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5140"
FT                   /old_locus_tag="LmjF36_5140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5140"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5140:mRNA"
FT                   /db_xref="GOA:Q4Q0P8"
FT                   /db_xref="GeneDB:LmjF.36.5140"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P8"
FT                   /protein_id="CAJ09486.1"
FT                   /translation="MVQLSLIEEVKDKVSRFIPNPFVDIVEECTAPQLLIPTYEHVKFL
FT                   CEQVNKKSESTVDIVRAIRRRIADSHIAVKHLTIQLLESMIKSCSTWFHIEVATQKGLL
FT                   RDLVAVACVQPSTGRAMQAKESALLLTLNLSIWFRGHPAEECYILTTLADDVRNEMGPN
FT                   CFEGLEPERNTRMKVEVHAPNRNRQQPGQRSDAGPNYQGPRSHGHRRDKRRIVDAIAIN
FT                   LPTSERLSAMLETCMTFSDYVNNAETNPNVCLRDDEVVLSYLSQLRDDHIYVTILLSSN
FT                   LQLDRDLLRTVSDSQSAVLAKVEKSMARPRTDAAPEGSSALPPALQQALMRSAVDTEQS
FT                   GGDVSAFQETGMQQRPSPPRAEVPSRNVGMTRTSPAPMSTPPLAAAPAIEDLFGNGQSA
FT                   PQATSSMPKSLSPTMEAPGSAPASSPPVASPEETANAAEPAVGDFATTALTSSNAAALP
FT                   PMRAETSEAAGAEEVPAPLQHAASESTSAAATAAAPTPPAADLPKDVDDFDTFLEGHGV
FT                   S"
FT   CDS_pept        complement(1987108..1988985)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5150"
FT                   /old_locus_tag="LmjF36_5150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5150"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5150:mRNA"
FT                   /db_xref="GOA:Q4Q0P7"
FT                   /db_xref="GeneDB:LmjF.36.5150"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P7"
FT                   /protein_id="CAJ09487.1"
FT                   /translation="MTMSLKSSTCRSFVRVRPFTPSEAQICPEDSAIPRGILQWDGKNI
FT                   ISVLDPQNYFEVRRNAMFPVSEVLWSFQEPGEETVKSSKKQRPATQQDVYNRFVAPMIP
FT                   AIVEGYNTAFCVAGASSSGRLYTLYGSEAEGAHRGILPRFAEDIISSFKTNAQTNSSLS
FT                   VELEAVDISGETYVDLLATGRHGGSIQTSADSLKLLSTPSGPRLVGVNSVAADSTPELL
FT                   KVIQQLHRIVEKRNSTHTVSFRFTETFEFEDPENVNQSVSKSRRVQVLFVLLRNMPSAF
FT                   HRCIDVAVEHDSGENPLAKVPVRESAFTKLFPSLLQQGFHLNMISCVSPYYEHMREDIN
FT                   TLQFSVKVKKLKGNPQLLHDESFVEMRRLADEVKDLQVEERKTHEALSVVQNELNAREV
FT                   ELMKQEANYNKTMNEVTESHQQVKLATIGRNMEAERTNRARKQMNTELNKKRAEIKEFQ
FT                   QMQASLDAAAKRQMRDADDAKVRAEAVEAMLKKQKANTAIYEERLNKYMEEDAKTERVE
FT                   AFNVASPDEQRRLLISGSDEKKRADAEIQRIERERSTARELDNTQERMRAIQAEYDIAY
FT                   NAAAPSREKAELEEEIAKYEKEISETQCEIRRLQDEIDKKKSQCQCNLM"
FT   CDS_pept        complement(1989800..1991497)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5160"
FT                   /old_locus_tag="LmjF36_5160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5160"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5160:mRNA"
FT                   /db_xref="GOA:Q4Q0P6"
FT                   /db_xref="GeneDB:LmjF.36.5160"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P6"
FT                   /protein_id="CAJ09488.1"
FT                   /translation="MSRYVPPHRREAVASSSDDLTSPSSVAFQQESWRALSRSITGVVN
FT                   RVNKDNLEQSAVELFRENLIRGRGLFARSMMRTQQVDPDLTPVLAALASRINRDLPTVV
FT                   ELLCRRLVVQWNRAYLRKDWRFVENASRYLGWLFLLNVVEVDIIYQLLLKHLTSEKRRE
FT                   EDIDQAAKLFRETFKVMSLKERRSFHEQILTPFRDLLAMDDEELRLSTRSQAVLESCLK
FT                   EVQEWERRKEREEAIPDYLVLFDLEMQQRHEMDLDEKYPTEDALDRYAFDAEYDTHEEQ
FT                   YEAVRKAILGEDWEVELLQQVADAEGDEDEKGGGEGDDEAADGPSAGAGAAASEAASLP
FT                   TSAELDASKTLIDAEERKLRREVYLAMRSSIRADEAVHKILRQMQPQTERTICFMVIEG
FT                   CCEERAYRKMYSMAAERLCKSNARFQAFFVEAFHARYESASELTLKQIEYTCKVYSHLL
FT                   RTNSVYWSRCLGCLDIVENNESQRLIIQYLFKGLAEEIGISGVMEKFQKDEELRWHTQR
FT                   LFPLNQGVDTLKSAVNLYVAMGLPEMTAPLRAALEEERAAQKRARVDY"
FT   CDS_pept        complement(1992696..1993325)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5170"
FT                   /old_locus_tag="LmjF36_5170"
FT                   /product="vacuolar protein sorting-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5170"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5170:mRNA"
FT                   /db_xref="GOA:Q4Q0P5"
FT                   /db_xref="GeneDB:LmjF.36.5170"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017898"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="InterPro:IPR037206"
FT                   /db_xref="InterPro:IPR038358"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P5"
FT                   /protein_id="CAJ09489.1"
FT                   /translation="MASIEIPPEDRQHIDYLADLFAVIIAIEQIEKANRRDLINPNQYD
FT                   STVRRLLEKYKNTVAHLQGARNPYFTTIDDFFDKYCARCLAARATIRDGPMSRPTENNA
FT                   RFLARQSVECSDHFITLLDSLRLQQTSVDVLNPPLGDLLQVLRKLGLSKEDFYMRLHNW
FT                   QRRLDSMSAADMLDESAARDFAYDLDRGYACFKAFLESDPTLSTRR"
FT   CDS_pept        complement(1995087..1996685)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5180"
FT                   /old_locus_tag="LmjF36_5180"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5180"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5180:mRNA"
FT                   /db_xref="GOA:Q4Q0P4"
FT                   /db_xref="GeneDB:LmjF.36.5180"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P4"
FT                   /protein_id="CAJ09490.1"
FT                   /translation="MTQYFDVRNPATGAVVGKYMQQQASDIAKAVSNARVAQKAWAQLT
FT                   YDQRAVHLKKMKAFLAANAERATDVIVSCSGKTRQDALATEVLPGVLACDWYAKNTKKV
FT                   LAPQKLPVGSILFANKSNAIHYEPVGVVGIISPWNYPFSIPFGEVLMGLMAGNAVLLKV
FT                   ATNSTPVGCFIEEVVQAGELPVGLFQHLVVSGAEAGRALLEAGISKLFFTGSVGVGKKL
FT                   MAEAAKTLTPVSLELGGNDPMLVLKDASIERAVNCACWGGYQNAGQSCGGVERIYVDES
FT                   IYPEFLAQLKAKTEALRHGPDTGTFDVDMGCITTKGQYETIAAQVKEALAQGATIEAQS
FT                   RPSANCPKDGLFYPATVLSGCTPSMRIMKEETFGPILPVVPFKTEEEGIQMANDCTMAL
FT                   TSSVHSRNMKHAKEVAMRLESGVVTINDHLYSHGMSEAPWGGWKESGIGRTHGYLGLKE
FT                   MVNAKCINSDLMPSGLLPRNLWWYPFTHETDAMLRNVLSFAASTSICKMLSSLWYIITH
FT                   CRYMFRPWEIKSTPK"
FT   CDS_pept        complement(1997498..2001355)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5190"
FT                   /old_locus_tag="LmjF36_5190"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5190"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5190:mRNA"
FT                   /db_xref="GOA:Q4Q0P3"
FT                   /db_xref="GeneDB:LmjF.36.5190"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P3"
FT                   /protein_id="CAJ09491.1"
FT                   /translation="MDDVKRGDDLSTPRALVSSTTELHPGGVASRDDDDMSELVPLLQR
FT                   SRSQRFPPPSFALAPAVPLPLWQRVALSSLQSREASLLSQRKFKHIRQFLVRDLGRYHV
FT                   ELQERAEKQRQQQREARVRAGERVAAGVRRYWSRRGDAYQQLATVEFDVMKHQHDRRKQ
FT                   EDLLRETEELTRKLLESIFSAARKQPASASVTAVESRVAACSANGVHDRSPDAPPWEST
FT                   LPVFPVTAPAHASFWDKVGDDDAAPIEAALSLLDTEGGQRPLRHYQRSALRWMVHLYEN
FT                   NLNGILADEMGLGKTVQTIALLCYFAEYRNDWGPHLIVVPTTVVLNWKAELERWSPGLK
FT                   VLTYIGSTKERHQLRKGWTSEDAFHVCVTSYNLVVQDRKVFRRRPWGFLVLDEAHHVKN
FT                   FMSLKWQSLFDLQAEYRLLLTGTPLQNSIMELWSLFHFLLPFASAFRSNAEFKEWFSNP
FT                   MDEMITGRSTLNEAIVRRLQALIRPFMLRRLKKDVETQLPTKTEKVVLCHLSRRQRSLY
FT                   DDYMQLAETRQKLRGGGGAGGVLSVLLALRKVCDHPDLFEERPTTSPLVLSHDAVVEQR
FT                   VPRKALLLDNDDRGRWRFPRFHVLDVNDDGGRVNSTQGQTEVSGSDWAVCERDCRSDLF
FT                   LSGTGAPVPWWLFLTHVERPDAPSEDAMASFAKRFSPTFLEGPIGRRRESSADASQLCN
FT                   CSAALKAAFVSVLAQARQQCRSRHHHTKAAQWQRYHAIQTARNTYVPPTCRLSLRQTVL
FT                   AQRHPSLCPSIAVRAAALLPVLERVCVYVPAVVAAHPPKLQWSLPIPHPGPFETLSREG
FT                   CAPLIGAVAKAQDAAQCGRVAPRRRYDAAFFLQEMWPIQVRRSFLFPDKRLLIHDCGKL
FT                   QFLETALKKMRDDGHRMLIFTQFVHMLNILERFLALIGVVYTRLDGSTKAELRQQYVDR
FT                   FNADPRITCMILSTRSGGIGLNLTGADTVIFYDSDWNPTMDLQAQDRCHRIGQTRPVTI
FT                   YRLISEHTVEESILEKARERKKLNNVVIRGGQFHTIAGVSEQYGDSAAAFAALSNPVNL
FT                   RSFFHDLDEDATVASAASAAPIDASDSAGAASSPLDVLEAMADVEDAEDRAAGQELQRE
FT                   IAAHAAEEAEGGGDDDASGLPHQGGTLYSSSEREKELDLSAACVVNDDAKWQTRLPNSF
FT                   LDALLWPSTRLGSGAALHGSEGSSVDSVSSAPSSSAAALLFAVRKRQREIATKAHAPVD
FT                   QFLAFQYARCHRADAEERYNALLLSYKAHMNENVGDDADLEKARMGLFQPRFRVEYRLG
FT                   S"
FT   CDS_pept        complement(2002087..2005152)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5200"
FT                   /old_locus_tag="LmjF36_5200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5200"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5200:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5200"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P2"
FT                   /protein_id="CAJ09492.1"
FT                   /translation="MCCDVLPHRSRGWCALDGALHCVRLASPDTRASPMSALVSLVQRA
FT                   AAITRPYNSQDALLLIRALSALRLSRPEVRLICEKASFSLASSTAEVPAAALVDAVNRL
FT                   CTLQSAHLPVVQRVLLKRFCELQSECGPQRSFYPTPTSSLPVDPRTAQKAALVLAKLGR
FT                   TAGQAEATEHVLRLLHTLLEHRPDDAGLHIAYVALYVNSLSYTTQLRWWATTAPLKRSV
FT                   QTLQRSVHFLLKNRQTLKRASGNVAWQLLHLLLVIPPSTQLAMTSQGSSAHLLHGQQGE
FT                   GFDSYFASGALAQKVSAGAYVQFVHSFGTDVCQLDLQRTAALLKPLARPKKEAASAAPH
FT                   TQKRLNVYDATKLASALAAMFSVLATHPSRSASFAALGGPREQHPSAEASQASHQASVG
FT                   AHEAWRRVVQLCFTILCNLVECEQARLRNTHANDDVLMDTVVSPDRFLVAALLDSYTRG
FT                   CVVLLESAEAPRGMRDTASPWPMLSASISALLEFVPQLSETPPTMISWMLRSLASLRRR
FT                   GNGADGDQLERSAAFLLRQYVCVPSKKRCLRSDVETLYAYACLLGLNDDSNASRSYSTT
FT                   TATVTTLMKPPSHRLPPLSALDPIVREIASRLRASPFAAADEPQTANADMLLAALLHLY
FT                   KKTLSAPAAMTDVSKGTMELLPLLDELQSTLAAYYCDRVVGTPSVPMKDDVTVRAARLH
FT                   VVAALLRSPQFSSCRSGAALARAAERTAEQVTMIGAPVTSSSMLRVLAVLARGQLTGVA
FT                   ASLPPTSFDAALLYTLCHRYQQYINEIVQTGGRREHVSEVVRVLWRARQAGVQLVFAEA
FT                   ADQDVLFDASSVVEGGNASQLQLWFPASLCRLEHLTCCAAVDLLQLIAESQLRSPALVQ
FT                   LQPHTVLHLRMTLFEQLTVTADVECITRLLQSNATAAVSQVLLPEKEDLLCVVRCVDVC
FT                   VSSLLDSALKGTSEEAAKTSRHGNLREQAGRFLHALVESQLLIRVPEIVSSAEGGGLRR
FT                   RMLELALYLETSAREADAIAVLKMRLFCSEVL"
FT   CDS_pept        complement(2005898..2010505)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5210"
FT                   /old_locus_tag="LmjF36_5210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5210"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5210:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5210"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P1"
FT                   /protein_id="CAJ09493.1"
FT                   /translation="MGRHKGALPMPCFAPQLHCPRVHRVHHPAISPPFLPPFPFGSLGD
FT                   RTQTQQNPFGLVHLHRRSAHMSRLALSSPSAPMRCDVYDAPITAVVCSGGRGQVYFAAG
FT                   NTVHCSRTDSLACGTSASGPQASSATVRFATAPPGTTINAIDVAHPSSPLPIVFMGAAD
FT                   CVLAQCGAAEDPSRCSCSIVLHADEGRVLRIVVDERRGVVRVLTASNDLFCGTVDSIAQ
FT                   ALGAQATSSHYDVSARCVFARVSGPRLGVVLAADCLVQHPLLSEGHEGGSTAVLEGMAC
FT                   APCRLFSATYAGEIVEWEAEEQDDCARAAGTESQQPRGPCARSCSVVSRVQAHPSGCAI
FT                   FAVRVKATYSMLCGTGGAQDDATALARVHLVTCSDDRSVALYERRGPIASSGNHLKKRA
FT                   EPQESEWVLLWRGSGASFARSRIFDVALHAASWPYATKSPEQPSRSCIAYVGVAGEDGA
FT                   VQVVEVNAREDGDLVAWPLSHRIQSDCRRAVATPRLVRLHQHRGHGAYRVAFSTSSPHS
FT                   VTLISGGFDGAVFAHTLPSALRQQACDVGRPVQLRPHDLMLQPPILATAKVCDGMTIER
FT                   EELLQPSPSSSSPAKKTDQVRAVHVDGNGLLLACTSRALCVLCADSAAHSWWIALPTGA
FT                   SRRRCGVAGDDPALDWGVPAALESAVARCCVSSVRGLKSSSVGCALVGTTAGVLCAVPY
FT                   GYTHAELGGSFPVASFAAVHARKTDGDALPSTSALRAFGKITQVSALRMHEGRFGASTH
FT                   AFSGDDDATALRSTGATTSELVVATNHVRGTIVLSRLLLTLCHACDSGERAVAVDWPVG
FT                   LCVSAVWHTLIVYSDCPGPLTTTLSLIPIHCGRYDAGESNDGCCCCLEGNMALSLWLLV
FT                   GDRNGCLLGTRYEAMNRALESPANPLDSHTLPLATSLKAVAMVHRYVFAEHLHTAISAL
FT                   CAENCSSATSAGGACVSSDTLITVAGTGGVLEYVYLHASTSSNKAEAAETTPLPSRARE
FT                   PLRLPFEVSSVLFVSPCLWVVQCGTTVSILCRIPGQSSWVPVGSCDGVRAPRLLTARVV
FT                   AASPTRSPMAFFAHCSDGRTVERMMVKPGPNALLHPALPLCGAQTALVHGVGFPGKDYN
FT                   CVAYAPAPLHCLLMGNEDSSVALYPVLAASAGMGVPNVHALFGGLLTPLNVCGAHHSNI
FT                   LAMAVLPRTEADALRFVSVGGGAMVNLWSAGLISSPLQLVDWWCGSGAPSPQNTAISPP
FT                   DGASSPDGKSKGAPCEPRISSARFQRRREKKVVAASMSLTLTDRIPRFMAVTALSSTDI
FT                   AVGSSDGTVLFFRVHEDGGAEGGSPQPTGATLQLRWRGVLNTERPKPVMCISSTHDDDR
FT                   DALTRSVNVDRAPRLVVAGDTNGVVYAVDARSHIVRSHTRLEQSCVNAISELQRMLTVS
FT                   PSDADAARHQWRFAALHDSGVVHLMALEVAAAQGGSIRTAELRRLCSASTGLTAGRSAH
FT                   WPALSLPLVVVTEERIIEFDPEAAQRGKLRLLRTQRVSVRCVSGAALVSEASSNKRLPT
FT                   RSRVAVVGQGFELVG"
FT   CDS_pept        complement(2011694..2012431)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5220"
FT                   /old_locus_tag="LmjF36_5220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5220"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5220:mRNA"
FT                   /db_xref="GOA:Q4Q0P0"
FT                   /db_xref="GeneDB:LmjF.36.5220"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0P0"
FT                   /protein_id="CAJ09494.1"
FT                   /translation="MGRRSGCVLWLAAAALAIFTLQLRSAVAAPMDLSNPVERNHFLLL
FT                   APYGVRHRSGANAHGENTARYVQLSNGSRFVCDTTGTKRRDPLDAKNYPLRHQMESLMT
FT                   FMRGSDHPCVHYAEESYVTVYCWDNEVREDALSENKASSLGRRRTDGPQMYWASNDAFG
FT                   RYAATVYGDGDECPYDKGRRIETEVRFYCRYSEFENPIPYMSIHESSQCRYMLRLLSSK
FT                   FCSVHQLDHPSEEETVQCQMLAD"
FT   CDS_pept        complement(2013495..2014958)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5230"
FT                   /old_locus_tag="LmjF36_5230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5230"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5230:mRNA"
FT                   /db_xref="GOA:Q4Q0N9"
FT                   /db_xref="GeneDB:LmjF.36.5230"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N9"
FT                   /protein_id="CAJ09495.1"
FT                   /translation="MWQTFVQQSHAAALALHRSTCTCSLSARPVHMRQRCVSAPVSGAA
FT                   SSAAAARASAVKSRSRYRRRWRGFGIAAACFVVGVVLYVCLGSSIMFQSSAQQRQRRRP
FT                   GKYPVLAERDVMALDVATSQVANLATLPALDNLVKSAAELGAVHAQVLEQVVAAQEVED
FT                   GGRALRELGVSQSHLSSGCSSLRRAADVSYAKLKAMLLQEAHAELHMAPTSLVRTTYGW
FT                   MLGNIYLYSAVLPEYYLFRDDSTNHALVLLRSTNVLSWSPRVHTVPSAEMREHGAAVAT
FT                   YDLFNWSGGAACRRGPLGHVPHATRFCESSFSSWSAVARRVAATYEELIVLYPTYAPLR
FT                   LHYAISFAFLAMDTAADVTAGGTQGLDGHTAKALQVIRSDRSKLKGTYTHADAAHGPVL
FT                   ALLEAFLTPVALRTADQDAQLVAALREWESCAEAQAALLEATSWPGGVFPGEYRAPLLR
FT                   DVQLSHLLAKAQLHLGDDHAALQTLRLCL"
FT   CDS_pept        complement(2016641..2020105)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5240"
FT                   /old_locus_tag="LmjF36_5240"
FT                   /product="putative glycosyl hydrolase"
FT                   /EC_number="3.2.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5240"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5240:mRNA"
FT                   /db_xref="GOA:Q4Q0N8"
FT                   /db_xref="GeneDB:LmjF.36.5240"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N8"
FT                   /protein_id="CAJ09496.1"
FT                   /translation="MLSKVTEDGAGSASVGRRIDAAIRVDRWELREDTLPIGGQALVSE
FT                   TLFSLGNGLVGVRGHAEETEAGQNRHERHRAHTSRQRAYYNIRRGGDELLSDVKNRHSP
FT                   FGDGGNWHYSRAQGGGNSGGSVNGPRGQRGVYFSGFYEQRPLMHPRSFSAGLSTKEGYR
FT                   LRTPDPFCIDAFLSGEHISAARGPTRSHARRLDLRTGELHRRFVWFSNQQHREITIETR
FT                   RFVSAARKNIAAMHYKMSVRNAHNADVRLISRTFLSAAEYDVETMLTQSNIQDAMSVVL
FT                   VRTRNSCRHLAIASVETCTSRSYPAGIQTFPTRDTSTPTQGATGGDTGFATSPSGAVPS
FT                   CSASPSSPAAASPTTLTPNSRETEWGTETSYTSCISDGVIVEFVKVIGHFGDEDATTEE
FT                   LLDVATHQTRKVAALGYEGLLAEHRDVMNAFWETADVRVEPRADVQGAFRFNILQTYMS
FT                   TSGDPYYCFPTRGLTGDMLLGVQQWDVDALIVPFLSHACPRKARALLEFRIRTLNEAKD
FT                   IAADLSLPRGALFPYRTVTGEKNPTPYCGAFLFVNAVVVYALKEYVTATNDTSILVQGG
FT                   ADLIFTTALVWLHWGTWEKGLFHLRSVSGPDTYNDVADNNFFTNLMAQMHLQWAVQLAV
FT                   MLRQENLEMWHGIMHRAQMTENDIVAMDQAAAKMVLPFDGTHRIHPMDQSFMRKKHWNL
FT                   TSLKDGAEGPLTSLYHPTVVYRHRVCHIPDVLLAIMLAPDSFSLDEAKADFTFYEAVTA
FT                   SDSALRLAIFSVVAAQLRLSNKAMSYFHDSLFVDIDNLIGNSDGGLHCTAAAGSWSSMA
FT                   VGICGLRVAQGVLHFNPVLSEEMEEFEFHARHRGCLVRVLVTKRLVTYTLVSAPEGVTD
FT                   LILVHAGVNRITLRLNHPETVRLFSEVRVFDFDCVVFELDSVVEDIEGVHYHAWTQTLE
FT                   EHFHQHGFSDFSMTKELYLAYLRHVKPFYGLNEIFKKYNQSPPPAGEVDDTAESNTLYG
FT                   LCRRKLQLFRSYATTHGMPMREGVLQLISLLRQYGIAVGCVSGSKNARWVINETTRGSS
FT                   IFDNFLEGKEGEELGLRWRPEMDYFEACAHRMDAATNRAVVVMDGIDGFSKKALERFRM
FT                   VVDVSPTPEETTLSIPRVLAKNLSDITMETLNEYTVRGGVVNHLRQI"
FT   CDS_pept        complement(2021223..2032064)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5250"
FT                   /old_locus_tag="LmjF36_5250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5250"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5250:mRNA"
FT                   /db_xref="GOA:Q4Q0N7"
FT                   /db_xref="GeneDB:LmjF.36.5250"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N7"
FT                   /protein_id="CAJ09497.1"
FT                   /translation="MSFMEEMSDAPVSITGEMWMCADSAGPLKVGAGRGLKNLITIEKD
FT                   RFCAYSSRSEQCKQVKQIAFRSMKCVAWFAHHPKPPGREPAVSTTAATLRRGARKDPLA
FT                   ATYYYLVLEFLRDNTIPGTVSLGKRERIVLCTDDQQDFSIWRKFAELYECPPVHEGFVE
FT                   GRDKKALRAQAPAGGARDHDDTTSSDDEGYEGRGLDGGSAVSRRPLDLWKNRCVALLND
FT                   FAHLSNPSLQVQSADVFDTPAGCGGLDWDAHVESVLHAIEQDMRPSMKVVPAPSTRGAA
FT                   AGPSSLLSSPSIAPSSIHPCAATKGTMETDFDEMQSLASNLQVELEQFQVVAAEVGALA
FT                   EGRELKTTTILPDALHAYVERLRKMPTPADPADSVAAQREDKTAANASAAAADLAKLES
FT                   ACVNAVRSFTDKVHTSALPLSQEWNREKAEQQERAALPQRVETIVAVLIDELTRAAADV
FT                   SALKTSLATSMAPTTASPATNVPLELSELRRVLNQKELEVETLQQRHFHASRHTKQLSR
FT                   RLEELVFSYSDVAHDMLRSQYREYASLRNLFLRALRGEVPLDNSTAAEASLGESGSFGG
FT                   TSEARCSGHLPGSFTGVQKLVISAAHLEAIQALEQERIAARERQRELEKVMKELEVLRQ
FT                   ERDEEIANLKCNFLAAGEAWEKDVAVLQAKLTALQSAIPRGALLLPASSLAAHTAVKAG
FT                   IAQKLQSTQPHTPTAPADTRESTETVTPMLAESHKTLHKLTTLLATTPKETGVEAAVVT
FT                   QRLQAFYDWVLEAVVPLSSTSVSDGSVLEIITHVVHAYHALFQQISTIYTATRSGTDDT
FT                   HVDVLKLVKNEHEKFEKLWGILEKHLLIHGEDSSFHISGHQSSSERTALLFSSPPTMEE
FT                   LDQLPSFLETLWTNATLYSQLKLRSGGVPIATYLQDLEKKSAQLEQQQLQHTQREKRSL
FT                   SALMATFQDDKHHTSSLIGHANSALAALGVGAPASESAAEAIARAAADAAERERALRAE
FT                   VAAMEERLEAANAQQQQLQADRDEQLRDADERLAETAAAHQELSGSVADALAALGVGAP
FT                   ASESAAEAIARAAADAAERERALRAEVAAMEERLEAANAQQQQLQADRDEQLRDADERL
FT                   AETAAAHQELSGSVADALAALGVGAPASESAAEAIARAAADAAERERALRAEVAAMEER
FT                   LEAANAQQQQLQADRDEQLRDADERLAETAAAHQELSGSVADALAALGVGAPASESAAE
FT                   AIARAAADAAERERALRAEVAAMEERLEAANAQQQQLQADRDEQLRDADERLAETAAAH
FT                   QELSGSVADALAALGVGAPASESAAEAIARAAADAAERERALRAEVAAMEERLEAANAQ
FT                   QQQLQADRDEQLLDADERLAETAAAHQELSGSVADALAALGVGAPASESAAEAIARAAA
FT                   DAAERERALRAEVAAMEERLEAANAQQQQLQADRDEQLRNADERLAETAAAHQELSGSV
FT                   ADALAALGVGAPASESAAEAIARAAADAAERERALRAEVAAMEERLEAANAQQQQLQAD
FT                   RDEQLRNADERLAETAAAHQELSGSVADALAALGVGAPASESAAEAIARAAADAAERER
FT                   ALRAEVAAMEERLEAANAQQQQLQADRDEQLRDCVRERCAYVSQVCLRELEAKEAEARF
FT                   DVVGAYCALSPYVSIASSIIGKLLDIRGMVGGDVDEIVGRVRALVAELNGLRAFASEAH
FT                   EKVVWYEDVRVRVPLKKLSDFVRKRDGTDECEQREEFSVSFLAETLRSSFRVLQCLDSE
FT                   AMALQESIFSMTALLKECGTALNESVTNLQKALPCAASKEDTSPSQSHSTLPVEWGLRV
FT                   VCRRLGATVSEAVHWQGELTNILKATYRILIATSDGTRVHGAPVSDGDHPSFAEYSQLP
FT                   RLAAQACSELLHSRRFAAVEDELAAVTQQRNDLTGTVGTCCGSLCSAISVATPGRVGAL
FT                   PATATSLTCDEAKSALRDITVLTSSILHDYAQSMEHTLAVLTPLASIAADTFAFSSSFE
FT                   MLAAATEAVRARIKRMERSQLQHLHMSQCDEEGNAKARGAMQDQLFALSEDGEAGELAR
FT                   RNEQEEQAAPLAEVTLQRQRWDAVAEVLGRFAEDVGATVRAKNGSESQSVGNTEVLPLV
FT                   RQAISLSASAKAQEELEGRLSGILDACKRGAAEHHWAEATAARMALDPEELHASVTTGE
FT                   HSPEKMQARANACQMPIATMEAARAALGQSTTQMQLVAARAHEEALDVGVREWDASESG
FT                   VRAPAGEGERLGEEMYLVQSRMDAMQDRPNEAEERGSSQVMDAGVLLEAAGQVRSLEDV
FT                   MRVVASYSLEYKTKSLESKESRLRSEIVQDWAVMMVPLAVELRLLRAIAAGVDRPLPGT
FT                   ALADLPAHGSSVRRELTEAGRSLGAAASAPCTEEATREALLGAMDQACQLLLGAPPERV
FT                   LDTAAPHGTASSAEECPAVTFAGAVSTTDVAGGTAPDKLADTVYAMIEERGDRAAANGT
FT                   LCTGEAWYSAVARVTQTLCSALSSAGVAVSVPADHGFVVGHSSCVSPASQTSMLDFLAS
FT                   AAEHVLKYTTDTTRLFEDWRESLQDCLSRTESSLPTLVAAVVEEVASLRAASQLAAEEQ
FT                   QHRDHELDALRTLLQEASAVFSDTSPFLSMQSPNFVEKCMAYAKECARLTALESELSSV
FT                   LGAASAQRSSWEDASVSLGDLAAELQRDRVELREVEVPKLQGLVCTLSVEVLLAEERAA
FT                   RTMLVAEEATSRLHALCDPQLRELGFLVERALARAATAEAQCAEKTAQHCSLLAAHESL
FT                   VTMASGLVPVQEDCCRALVESEGDASCAAAPTRFTSEALRILEQEAVLVPRLVQAHGRL
FT                   TATCAALRSDLDAAKAACVQALADGEADLDIARSKSTELEAQLEHVLDAIEALGSLLFP
FT                   HEEASLRDASCLPRLVEAAGQLAHTAAADAAARCRLERDVCDGAAAFAEQQRQCTAAES
FT                   NAETLQETARRYECQEAEEIQTLTASAKTAAEAYAGIVTALCLSAESVPSAASAAAAIS
FT                   EEQWAAVVHAVQAAVEEGGRQTSDAAELRVEMRILQSRMAELKAAVLESEAREGNLLQR
FT                   LNALMMSSEPLKAAVTAVVASRECNLESLEDVALAMQAAVQLVERQQGNINQLIAGGGD
FT                   LHSGVESLNGRLCGVAKECDVTRPSLASLEETHGMLQRRMAQLERHVHDTISTVDCRAV
FT                   TVLGAAELRRLDKSTPADCLDGIAYVADALACRAEECDAAKAQLLAWRAEERIREEASL
FT                   RTTTRLSTLWQAFRTALLPLLVDEPADRGGCGEVAVFSADPVEFLASEAEARQAAQMIV
FT                   DTAERLRRTHNDLQAVYAALRGHFGGDAATGVREMTATPHAPARVLHNSGVTSLRFDDT
FT                   VTATLHLVSTVVNAKCTSVKDFIDHVVSDVLRDTSGSARVSFAALRPGAFAERLQGVLA
FT                   SLRALRESSDQHRDRARRLPAFMDALVETIHSHGGRVDVASTDATGALAIADATMPYRH
FT                   SPATTLEDCQAREQRAIVHGLQALLNQQEERVRALTAEWQCVKMQYHQLSQEQVAAEET
FT                   VVELRRRVQFKVQEDYKLEESLRELDSHLDQQARELSMRYFADQDAIVRRFTLLRNQIH
FT                   AAMRLPTRRSASAMPPRTPGRDTSTPRS"
FT   CDS_pept        complement(2035047..2037596)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5260"
FT                   /old_locus_tag="LmjF36_5260"
FT                   /product="putative adaptin"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5260"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5260:mRNA"
FT                   /db_xref="GOA:Q4Q0N6"
FT                   /db_xref="GeneDB:LmjF.36.5260"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="InterPro:IPR026740"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N6"
FT                   /protein_id="CAJ09498.1"
FT                   /translation="MNGAALIEHATFVTERAWEYASNTTSVFNKARSLVAGDAQFFSVA
FT                   PKVDDLRRSLSSESLHDKRDGMKRIIAQMCKGSDMRHFYPDVVKNIHVPSIELRKLIYV
FT                   FIVYYAEDCPNETLLSISAFQKDLLDPSMHVRALALRMLASLRILAIQPVVMVAVRKCA
FT                   NDMAPLVRKTAALALVQIHTLARQELDRETVRQLLRTFLSDRNPDVVGAAAMAYTRICP
FT                   DEWDLVHGVYRRLCRILMDCEEWGQVVLLRLLLRYARQHFVDPSGPFAATAASGSRGFS
FT                   SSSGEGTDSDDDDATSSSRSSFNMTLSRGRGASKSDTAADAQMDPDLLLLLNSTRPLLW
FT                   SMNSATVVATIALFCHCGTRRFQEACVKPAMRLLNTCTEGHIAVLHVVYALLLLQRDAF
FT                   LPYLKSFFLLPLDAADVRHLKLRILSRLVTPATWTEVSLEFRSYLRQYSDAAVVEAIQG
FT                   LAQAVQQCPPFAAHTIRLVTPLLSSRTSSPAVVAEAVAVLRVLVLQGTDPVRISRLACQ
FT                   LTLDIMEQRITEPSAVATILWLTGENISKHPSMAAAAPDCFRVFAKRFGGLTSEVKRQV
FT                   LTLGCKVWVHLQGNSELSERFKRVYHYVAELAKYDDDYRIRDEERIIEATFDRQSGTFA
FT                   GVQTALLREKPLPDVNDPYADRAGLEMGTFSQLLGSAVRIYDPLPTWATEATDGALRRS
FT                   IEETNATAAAVTMFESTSGEEESGSNNSSDTEGEESDDSDGAASLSGSYESSYSGSSDV
FT                   GDVSGKSSSASDGDAADPSGASAAQKAGSGAGTVKASPPKFTVKITTQSAPPPAPPPAP
FT                   AQATVKAAGETDTVPAVVPGLPPSPETVTEPHSVVEA"
FT   CDS_pept        complement(2038935..2041142)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5270"
FT                   /old_locus_tag="LmjF36_5270"
FT                   /product="endonuclease/exonuclease protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5270"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5270:mRNA"
FT                   /db_xref="GOA:Q4Q0N5"
FT                   /db_xref="GeneDB:LmjF.36.5270"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N5"
FT                   /protein_id="CAJ09499.1"
FT                   /translation="MFLISWNVAGWSSTSQAIRERFGSIHDFFACTEADIICLQECKGT
FT                   LAKLSASPVDMGASDPPVSRRPVVTLLKRLAAQEKRRRLAGSTEGDAPVGSSGGGGGGC
FT                   NDGIDGWESFWSLSGKQHRGLNGVVTFARKGLTWRCDSQPFSEDAFNEEGRAVVTHHSA
FT                   FVLVNVYVPNARGGARHAFKLRFLYALEKKMEQLRKDTGKPVILVGDLNMTYCAHDAAW
FT                   SLRRIHLGTLLQLQTFAETKGDTAWTAALPHLSKAAVKRVANMIANHLCAQAQEIAALM
FT                   DSGAATAASSSGTGVVSVDTEVNSSDNAIDREALQRLCALLPPRGSGGTGKGVHNYEAP
FT                   PVSLRALYDVGFRCAYTSDFVKSSPCPHNSELYAVVHFCGLAPHSDASAEFMGRLLQLR
FT                   LPVSSSAMPQRLPWTATTDVAARQAGISRVRMWDTFLLTREMVDAWSTAPADSPLIDVM
FT                   LLREVERPRLRPYCPCPYTCWDQSRNRRLENEGTRLDYILVDSALLPAVVCRAETANNV
FT                   LAGVPERSSSASTAPGPSVDREDFFSELHGARYRDGVMRAMANGAYPPAPFDGTGMPAL
FT                   CEQARELCFAGLPSTGLFVTPPQLSDHIGVGLLLDLAALGTESELLQRPGKVIEDHKCM
FT                   YRPPIGLHTFFAAAATKKAVASVPTPPVQREVAADDKGVREAEGSVAGHKRAPDSGVPL
FT                   SSSNASASARAWPAVAKSRTEDGVAVAGGDAEPCMIDVDSL"
FT   CDS_pept        complement(2041942..2045097)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5280"
FT                   /old_locus_tag="LmjF36_5280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5280"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5280:mRNA"
FT                   /db_xref="GOA:Q4Q0N4"
FT                   /db_xref="GeneDB:LmjF.36.5280"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040362"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N4"
FT                   /protein_id="CAJ09500.1"
FT                   /translation="MDSTSSSAALEEKRELSEQEVLEWLSRRGFARAHAALVAETSSQA
FT                   LTNDDSPARQRFMRGGAEEVTTNGATPTSAELQAALRDSVVEALSAYRDLARDDNVLTL
FT                   LERWDPQLCSLHVQRAAQRSEENRGRLERRVQAAEESNAQLRTRERKLDAQMKQIVAII
FT                   AERLQALASSLDPMRKDILLPLLRIVALLGSSGTVRAAARHMMLTLYKRPMMEHRMTVV
FT                   QEWLRVAQESPSRTLEQELIPELYTLVNAQAFERRLLALDCAAAVAPLLRRSPQVRYSL
FT                   CQGLLRPLCEDDMSAVRRELPRCLSLLWGDATATGTTAAMNAPASAGGMLRSSVGGGLP
FT                   SETTTVHSSTAHTSVEGLPGVSTTPLSPTQQTFFMELLVHLATDSNSRTVRQAAQTQLC
FT                   EVLYPVFLRDGVLLTQFVPLLLTVMEMEATQWLLRRRPDNSISSAAALGTANAALIGER
FT                   QKDPADESSTSAAAALSLSNVMTLIQLLHAVLRCVAAELVHSPEAEGRCDRCEASDDSQ
FT                   TSSALPSAYAHVVLPIAYNLLSNLLSKVHLASLTTSGEGGTPSGSDASTRLCGPLCALC
FT                   ATLASLVPLLGAQVWQEVAHYLKGPLASGPQQDVEAAAVREGTSEMTTARPPPPPLQPL
FT                   PPQSPMGASLTQQDLERGRLLFVFSFFLFLCGDAVTLPQSGGDASAADNATAPERQGQT
FT                   ADLDALTSSTALPSESLTPECIREESLRFVAWSISLESEDISCPRSAPLMACIRCVAAL
FT                   TPLAMESHEVASGISGLVKFLVASPEVRQRLTAVVLAHDTCAVLASERLKVALLIEPLF
FT                   PLLEDPQPAVQEAALSGVLSVSVALTEPRAQEKAIRPVLRVADATGCTSRFTRCLLQQL
FT                   YQLMQRMPAEPREALLYPQLSLLMDCLAELCVERVSQEGFSAAPAVATPSSLVSTSAGA
FT                   RIDPQGRAGSEQRDLGEHDWEETMLVLHAVLSSIVKCAVVTPTLLYRYLLPGIQQLSSD
FT                   GILSACSPSLRSRWLRLQKNYQVFMENNNASRLASSCAASAGGKPKVGTLLDRFKDELK
FT                   RRL"
FT   CDS_pept        complement(2046690..2047277)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5290"
FT                   /old_locus_tag="LmjF36_5290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5290"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5290:mRNA"
FT                   /db_xref="GOA:Q4Q0N3"
FT                   /db_xref="GeneDB:LmjF.36.5290"
FT                   /db_xref="InterPro:IPR039963"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N3"
FT                   /protein_id="CAJ09501.1"
FT                   /translation="MYPERDPYVPNKVMTGEELQRSVDRLSRSNRPTVELKPLAPRSII
FT                   TREALDKHIHHLYDESLERRQREREEVARQMDAAIKKDATITVTKITSLEEEALVRHLY
FT                   DETLATKKRNFDELYKQSTSHYERNTKKLTAKKQLAAMDRLYREGMERERNKHIALYEK
FT                   YVVARQPPPLQRTATELAASADKMTRGEGLTS"
FT   CDS_pept        complement(2050355..2053702)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5300"
FT                   /old_locus_tag="LmjF36_5300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5300"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5300:mRNA"
FT                   /db_xref="GOA:Q4Q0N2"
FT                   /db_xref="GeneDB:LmjF.36.5300"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030476"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N2"
FT                   /protein_id="CAJ09502.1"
FT                   /translation="MASSHASTTVQSTDQPSTSRPSLRSYGRQSTRARRSRSRAETLVV
FT                   HLGDVEARTYRVEVRQGEASPLQSLLKAYPDCVWDGSEFLLLPLLDEQREPSEVLPSAI
FT                   AREPTERVRSVVEESDTTATTDNAPPLGFGREAADEMALPGVTTFLCSVNASFGGAGGG
FT                   GIALDATPPPSSLASAAMGGGGSAVDSAGSAARNTMGLQAGRLATTAVPVVPRWKRFSV
FT                   TAALYLALGDAGCCDVAHFPYAAVQLCDWDDLVGQQRIRIEAKANRSAAAISALEKGTH
FT                   DRRTRLVPVAVMFPTSRKGEMRRPLSLTTQPFTDAEVFQLFYLQLLFRAYFDVRFRGMT
FT                   FTLPGQAARHLRSDLIAARSSGSRHVAFEHPTKNDEWLLFPAHTRLLTLLNLEEAVVPL
FT                   YATPAELQETSSLPLFGAGETLPCLGVAGRGAAQWAATVEVSSPETAVLALAALFDNMK
FT                   SQFGCTRGELWRRATGDAHAGALPFAPLLFRCGEFTAGASLQLTGATLSRFFVPPSKRA
FT                   AAAASVATAAGAPPAADVLADSAPTGSLLSGIPACDSAHTTTASPTSSTSPRPLLTEIG
FT                   LQAGASATMGTMTEVLPGAGGTRASSDCDQGRDAGFPSCLDAADLAGTKSSEEMLCACK
FT                   SVPPVLVHLDSVHDTAGAPSAQSPDIVPALVSTADSAEEDAKRVEAPPLPVVADAEVGG
FT                   LDEVTTTCSELRSASSVGPLSPFTKWESLITRWRHYIQTGNCAIFTGATTDVEVLRFLG
FT                   RGGSGLVYSGTYGSQRLPVAVKVFVIPEDMDHEQYVRESLTDVAFYVLLNQLEDFGVCY
FT                   GGRAHDFIVSQQTPAGLPAEAAAEARRGADGATTKLCYLVTDLMDGTLGRFLTEHDADF
FT                   DPLYDQLVNSPLRDGELFQFLYIQLAARMLFDWKVLDMMLNNQLRGDNIGYRYVAQPPA
FT                   QTARLRESAEEAVALAGPRQYHAGILYGFQFGPDEPLHYLRFPAETGLAAHAALGPLRF
FT                   ICIIDVGQGIQPNVADLVRNRYIGETVLDSCIEDDGFGRYWPLNELYCRYVDVEGTLAK
FT                   DVAAWGSARRVTTKEDAFQALRELVDYFYPTFGIEAPTEEELHTHLCFSWTSTNLEHLK
FT                   AAYVYRGE"
FT   CDS_pept        complement(2055924..2057039)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5310"
FT                   /old_locus_tag="LmjF36_5310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5310"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5310:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5310"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N1"
FT                   /protein_id="CAJ09503.1"
FT                   /translation="MWTTSMALMSKRSMKYQTKLRHRFRNPSVLPLKQTKAQRDETIRS
FT                   VLQVRNINPANQSSYRYVEQRLYSTGSRLDREGVKLNTTYALQGLGDLEPLRNSKSFGF
FT                   SEREALKYDSLQQAAKYEAPPVPFTPLAARKLAEGKLWPSAPEPDGMLSKEVPYLRHRA
FT                   NMSPSAQTFADKIAYHLRRSLKACPAHIAEQMDFAQLIIEEVIASRRSKLVYIVWATVD
FT                   PAARFAMEPQLHRLNHWVQRLIMERIRTRPNIPQIAWVWNGGRLERELPRELKEEMQAY
FT                   ASDNSSTLEMRVRYLKEMDTVNQRMRNIPWFMPYLWSKEEKAGKTRRMRKDLEEYEQRR
FT                   LAAKKDQRESERDMSGRSVAPQIGAPPAYVR"
FT   CDS_pept        complement(2057887..2059827)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5320"
FT                   /old_locus_tag="LmjF36_5320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5320"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5320:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5320"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0N0"
FT                   /protein_id="CAJ09504.1"
FT                   /translation="MSGRPTATPFRVFGSPYTLSLHQHVTYLRLKQLPFRVYCRSFTTT
FT                   LLYSLYFRARSVFCTLTPSGASPLQVWQLAEATELDEDVEAIARTAKGEVSYAGKDNYG
FT                   RCGTPHASGAATAAPRTQRLLVRKETHPQLHLASWCVVVYTCWWLAKTGAMFRYIRGDA
FT                   LDVLEEYVRYFFPIPGVGFARAMAPRFREAMKQLVSATGASEVTAPFMEDHFQRFCAAL
FT                   EAHLREHPNEHFLLGTPHPTLADVTLGAAFSSLFLMDDPPSSMLADKFPCVTEYVERVT
FT                   GWRGATFVGTTDDAALTNEDASVGSAAPTADTIANSAATSAADRNTDYPDTVPESLGPC
FT                   FELIAEVLPFLMSQCASFNAFMAGDGVRTLRREPLEGEWKGCTGYLMPQLANVRSLMIV
FT                   DDNISSVQARSQDLEIAFLAAREVLDDTLRDFGRREDGSHGASPHDVNARGVNESAAHT
FT                   SAAAASAVAQTTVASAYRDAGDSRHLVQPVQEGAAVNGAATGTEESEPGRQVAEEGSAA
FT                   QFRQPLDPRTMRAEEADFYRAYTAATRHNVVGTAASLCDVVPRARQATSAGSTAMVVRG
FT                   SVTEHLQTLYEMLAKMSCPQYTLTSLHHGRRIYVAVIPEYEVSKVRKARQESARKSTAA
FT                   SLDVKCVTESG"
FT   CDS_pept        complement(2061381..2064602)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5330"
FT                   /old_locus_tag="LmjF36_5330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5330"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5330:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0M9"
FT                   /protein_id="CAJ09505.1"
FT                   /translation="MPADARAQLLPSGTEVAVEKCFPLDDAPARSADCISWGPHNVLQV
FT                   CTRWAVSMYLANLLTPACQRSVRHHPLAHRSDGESVEVVVGAKWSTTLLPEVYYPATAR
FT                   LCVQTTSNLVVYRVSRHGANRVVASHGIGIACSCGGLARLSAHSDGIVAEASPSERPLS
FT                   CFLAAERPPIGKRHRGAAKSSVKVTSKPKTKPATKKTFAAARQKGRQGSCSTANSSGDD
FT                   ESASSSRSDASSSSGSRPLPSRFASRSRASATGAGKGGSSHESAMPTLVSAGNPDRAHA
FT                   ETNPVEADSASPENDDVGSVVDYTWLDQDDLLVLTIQGLHLVALAGNLSDNDGPVTRSL
FT                   PPPLYRWGGEDEVAQLGFRGPAPLCMTPLFTDGLAASTATAAALARLRRIVVIASPYML
FT                   RVIHVTRSSPANATAVMHLAYTVEVPSLTSVPTSVCAAAVRHTGQTATRAADLPPEPEV
FT                   DVVVFVSAPCAVLRGRFALAALSSSSESALPSPCRRIVFHVDAHYGSDILVGEVCLRRL
FT                   MAVPFVADSRVAGADVGGEGDRINSSSTELDDAAVAVLGIGEKSVYEFLACGPSSAVLL
FT                   QCPLLAGCSEMPPRRCAGIAGVALHPSGTLAVAAVQTGQANHEPTHLWPVSVDTRGGWL
FT                   RRLVELGALVPDAVTGKPHEDSAFGGAVEPYESSGSIVRSMLLQQASTSFFLYEQLLPG
FT                   SVAQSSEIHRYAQVHQQARQLPTTEMLHDYRRSMIPGCVASSRIPSLADVPARRRYLHL
FT                   RAQYGVDLFLRWPLRLSTAAGDAASGVPSVFASPPSMDAMQASWPWWRLLQHIWAICPW
FT                   DRPVLSELVLSNAVQILAKRYCYANMTLEGSESLRDCAVTVAESARCSTKPDALDVDGA
FT                   IAFMEAYMKAQKIAVRKANGSTQAASSSSLGLITAADCAEPAGPGGDNERLPRKAARDA
FT                   PQLAAQVHWCVSPSWVTSLEAFLEATAYSHRRSAGVSSAVGGNASETSSLHLFPCSLCD
FT                   RPTCVPLLLGLSSTSTHVPAGDDPEVKRDASVTAPASHTTLFSGSTLSPLSFFSEDYVL
FT                   TRCLACGLSDFADGPRCRVCGGMLE"
FT   CDS_pept        complement(2066690..2069299)
FT                   /transl_table=1
FT                   /locus_tag="LMJF_36_5340"
FT                   /old_locus_tag="LmjF36_5340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LmjF.36.5340"
FT                   /db_xref="EnsemblGenomes-Tr:LmjF.36.5340:mRNA"
FT                   /db_xref="GeneDB:LmjF.36.5340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4Q0M8"
FT                   /protein_id="CAJ09506.1"
FT                   /translation="MPAKKAGRAKSSLALAAREAELAQEAELLRQETEKGRLRNEESEL
FT                   RQLIEEEWRKLLEAHRNRERDLRNTLAEVERKAYYDAKEREMAASVAQKVQELQEVQAT
FT                   LALKVQENDLLEREKVSALRRVGLLTNELELTQLRHTDSQQRMAAADQAHQEAQRKWEA
FT                   EYDALQQAHQELEMKCAALELEQAKATNAAEAAAAAAAAAAAAAAEEEDTRAKKSAAVA
FT                   PSDDEETVMLLRVMQAETERYKATATELQEEVDHVRKQEEKSNLLVGILNTQLESVRED
FT                   NKRLHELAQKRQAELEAAGQLRRDAEVARQSALTEMMQALSAAAVQQRQLELELDVHRT
FT                   EAEKLSVELSEVRQECAAVKEELTSVSHNAAQQAQTDHATNTAMQAELANQKKDLEIAL
FT                   KAKETAEDDKFNHKILTRAEIDSLKTRLQRLQETMERKDREAFETIAVLKADIAKQESV
FT                   SAQLVREHELDTNALRTHLTTTEKERDFLRSELDSLQESSSKREHELYEQLTEVTARHT
FT                   TASEELERLRSDTARKDSEYIHNTIYLNAECENLRTKISEMTETAT