(data stored in ACNUC9543 zone)

EMBL: FR799573

ID   FR799573; SV 1; linear; genomic DNA; STD; INV; 3343498 BP.
XX
AC   FR799573;
XX
PR   Project:PRJEA60403;
XX
DT   04-FEB-2011 (Rel. 107, Created)
DT   16-DEC-2011 (Rel. 111, Last updated, Version 2)
XX
DE   Leishmania mexicana MHOM/GT/2001/U1103 complete genome, chromosome 20
XX
KW   complete genome.
XX
OS   Leishmania mexicana MHOM/GT/2001/U1103
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Leishmaniinae;
OC   Leishmania.
XX
RN   [1]
RP   1-3343498
RA   Aslett M.;
RT   ;
RL   Submitted (24-JAN-2011) to the INSDC.
RL   Aslett M., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, Cambridgeshire CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   PUBMED; 22038252.
RA   Rogers M.B., Hilley J.D., Dickens N.J., Wilkes J., Bates P.A.,
RA   Depledge D.P., Harris D., Her Y., Herzyk P., Imamura H., Otto T.D.,
RA   Sanders M., Seeger K., Dujardin J.C., Berriman M., Smith D.F.,
RA   Hertz-Fowler C., Mottram J.C.;
RT   "Chromosome and gene copy number variation allow major structural change
RT   between species and strains of Leishmania";
RL   Genome Res. 21(12):2129-2142(2011).
XX
DR   MD5; e58bdc9511a6aa5323cedc50ec08b914.
DR   BioSample; SAMEA2272796.
DR   EnsemblGenomes-Gn; EPrG00000979136.
DR   EnsemblGenomes-Gn; EPrG00000979137.
DR   EnsemblGenomes-Gn; EPrG00000979138.
DR   EnsemblGenomes-Gn; EPrG00000979139.
DR   EnsemblGenomes-Gn; EPrG00000979140.
DR   EnsemblGenomes-Gn; EPrG00000979141.
DR   EnsemblGenomes-Gn; EPrG00000979142.
DR   EnsemblGenomes-Gn; EPrG00000979143.
DR   EnsemblGenomes-Gn; EPrG00000979144.
DR   EnsemblGenomes-Gn; EPrG00000979145.
DR   EnsemblGenomes-Gn; EPrG00000979146.
DR   EnsemblGenomes-Gn; EPrG00000979147.
DR   EnsemblGenomes-Gn; EPrG00000979148.
DR   EnsemblGenomes-Gn; EPrG00000979149.
DR   EnsemblGenomes-Gn; EPrG00000979150.
DR   EnsemblGenomes-Gn; EPrG00000979151.
DR   EnsemblGenomes-Gn; EPrG00000979152.
DR   EnsemblGenomes-Gn; EPrG00000979153.
DR   EnsemblGenomes-Gn; EPrG00000979154.
DR   EnsemblGenomes-Gn; EPrG00000979155.
DR   EnsemblGenomes-Gn; EPrG00000979156.
DR   EnsemblGenomes-Gn; EPrG00000979157.
DR   EnsemblGenomes-Gn; EPrG00000979158.
DR   EnsemblGenomes-Gn; EPrG00000979159.
DR   EnsemblGenomes-Gn; EPrG00000979160.
DR   EnsemblGenomes-Gn; EPrG00000979161.
DR   EnsemblGenomes-Gn; EPrG00000979162.
DR   EnsemblGenomes-Gn; EPrG00000979163.
DR   EnsemblGenomes-Gn; EPrG00000979164.
DR   EnsemblGenomes-Gn; EPrG00000979165.
DR   EnsemblGenomes-Gn; EPrG00000979166.
DR   EnsemblGenomes-Gn; EPrG00000979167.
DR   EnsemblGenomes-Gn; EPrG00000979168.
DR   EnsemblGenomes-Gn; EPrG00000979169.
DR   EnsemblGenomes-Gn; LMXM_20_0355.
DR   EnsemblGenomes-Gn; LMXM_20_1055.
DR   EnsemblGenomes-Gn; LMXM_20_1175.
DR   EnsemblGenomes-Gn; LMXM_20_1340.
DR   EnsemblGenomes-Gn; LMXM_36_0325.
DR   EnsemblGenomes-Gn; LMXM_36_1280.
DR   EnsemblGenomes-Gn; LMXM_36_1395.
DR   EnsemblGenomes-Gn; LMXM_36_4530.
DR   EnsemblGenomes-Gn; LMXM_36_6260.
DR   EnsemblGenomes-Gn; LMXM_36_6720.
DR   EnsemblGenomes-Gn; LMXM_36_6785.
DR   EnsemblGenomes-Tr; EPrT00002517766.
DR   EnsemblGenomes-Tr; EPrT00002517767.
DR   EnsemblGenomes-Tr; EPrT00002517768.
DR   EnsemblGenomes-Tr; EPrT00002517769.
DR   EnsemblGenomes-Tr; EPrT00002517770.
DR   EnsemblGenomes-Tr; EPrT00002517771.
DR   EnsemblGenomes-Tr; EPrT00002517772.
DR   EnsemblGenomes-Tr; EPrT00002517773.
DR   EnsemblGenomes-Tr; EPrT00002517774.
DR   EnsemblGenomes-Tr; EPrT00002517775.
DR   EnsemblGenomes-Tr; EPrT00002517776.
DR   EnsemblGenomes-Tr; EPrT00002517777.
DR   EnsemblGenomes-Tr; EPrT00002517778.
DR   EnsemblGenomes-Tr; EPrT00002517779.
DR   EnsemblGenomes-Tr; EPrT00002517780.
DR   EnsemblGenomes-Tr; EPrT00002517781.
DR   EnsemblGenomes-Tr; EPrT00002517782.
DR   EnsemblGenomes-Tr; EPrT00002517783.
DR   EnsemblGenomes-Tr; EPrT00002517784.
DR   EnsemblGenomes-Tr; EPrT00002517785.
DR   EnsemblGenomes-Tr; EPrT00002517786.
DR   EnsemblGenomes-Tr; EPrT00002517787.
DR   EnsemblGenomes-Tr; EPrT00002517788.
DR   EnsemblGenomes-Tr; EPrT00002517789.
DR   EnsemblGenomes-Tr; EPrT00002517790.
DR   EnsemblGenomes-Tr; EPrT00002517791.
DR   EnsemblGenomes-Tr; EPrT00002517792.
DR   EnsemblGenomes-Tr; EPrT00002517793.
DR   EnsemblGenomes-Tr; EPrT00002517794.
DR   EnsemblGenomes-Tr; EPrT00002517795.
DR   EnsemblGenomes-Tr; EPrT00002517796.
DR   EnsemblGenomes-Tr; EPrT00002517797.
DR   EnsemblGenomes-Tr; EPrT00002517798.
DR   EnsemblGenomes-Tr; EPrT00002517799.
DR   EnsemblGenomes-Tr; LMXM_20_0355.
DR   EnsemblGenomes-Tr; LMXM_20_1055.
DR   EnsemblGenomes-Tr; LMXM_20_1175.
DR   EnsemblGenomes-Tr; LMXM_20_1340.
DR   EnsemblGenomes-Tr; LMXM_36_0325.
DR   EnsemblGenomes-Tr; LMXM_36_1280.
DR   EnsemblGenomes-Tr; LMXM_36_1395.
DR   EnsemblGenomes-Tr; LMXM_36_4530.
DR   EnsemblGenomes-Tr; LMXM_36_6260.
DR   EnsemblGenomes-Tr; LMXM_36_6720.
DR   EnsemblGenomes-Tr; LMXM_36_6785.
DR   GeneDB; LMXM.20.0355.
DR   GeneDB; LMXM.20.1055.
DR   GeneDB; LMXM.20.1175.
DR   GeneDB; LMXM.20.1340.
DR   GeneDB; LMXM.36.0325.
DR   GeneDB; LMXM.36.1280.
DR   GeneDB; LMXM.36.1395.
DR   GeneDB; LMXM.36.4530.
DR   GeneDB; LMXM.36.6260.
DR   GeneDB; LMXM.36.6720.
DR   GeneDB; LMXM.36.6785.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01522; TB10Cs1H1.
DR   RFAM; RF01523; TB10Cs1H2.
DR   RFAM; RF01524; TB10Cs1H3.
DR   RFAM; RF01531; TB10Cs3H1.
DR   RFAM; RF01535; TB10Cs5H2.
DR   RFAM; RF01536; TB10Cs5H3.
DR   RFAM; RF01538; TB11Cs3H1.
DR   RFAM; RF01549; TB8Cs2H1.
XX
CC   Data release policy http://www.sanger.ac.uk/legal/#t_2
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3343498
FT                   /organism="Leishmania mexicana MHOM/GT/2001/U1103"
FT                   /strain="MHOM/GT/2001/U1103"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:929439"
FT   CDS_pept        complement(4037..6484)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0010"
FT                   /product="phosphoglycan beta 1,3 galactosyltransferase 4"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25840"
FT                   /db_xref="GOA:E9ASB8"
FT                   /db_xref="GeneDB:LMXM.36.0010"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASB8"
FT                   /protein_id="CBZ25840.1"
FT                   /translation="MQEENSVPAALAPRDTDRLDPLQLLSSSQRHFGLSSAAESGQGCH
FT                   SRSRGKLEVDSTRAPSGDKRSTESLSKRDDLSNGAAKKPPLRFSGHPRQLTAQGLHSHT
FT                   QHRRLVALAVSLVLIVMVHWSISEFTTNVGLQQEASMRLLEEARLSQFPSPFSVVVQHE
FT                   SAMTRLTTKQRGLAAARADSLVRLDRDQLPSWTLRVIDENCTMCFDSVTYASAAAADPE
FT                   TSTDETGNQRRERLSVFATASAPLGLMGPMLFAMASVTDDVDVAAELPLWQWVTRSYAQ
FT                   QRRFVHASQWRSTGERPRHLIVMGIPSTDQPMRYPLRDAQRATWLTYREVARTENNFTG
FT                   ALLQLYVFAAAERLSEDATHSTVDMAQLAPTVSEYAAATAHRRAVESGDVNNTPTYVQR
FT                   RVVLRDGWRGIPRSDDAAWKSPCAGVRSSVVTTSRRVDGTSSLATLSAQLSLPVTPAFT
FT                   AAAQYVCHVSAALWQEALHHRNSLWLDFLTDRKPTTKKKMGMRISWGIPTEVGMSQKVV
FT                   IWLNYAYTAFPDVPYIMKGDDDMYLKVPQYLSDLRHVRGGWRKPRNLTATIPYNGVIPP
FT                   TLGIDDTEECLYRVWWWFDNHKVVFGHGPGYALDRRLIKAALNPFDVPNQRLLMLLTMP
FT                   YTVSYHSHYVSLLMQYEDLFVGRQLQKHPARVKEVCMNRPLRYVSDKEPRSLQVLRPAS
FT                   SKQTWIWSSVLMHYSMPAIPYFIHYYFKNEFKVAKAAEWALKQGISVSAIEANATQKMK
FT                   EWVASQVPTTLAGMARVRKVSWVRGDPRTAYVVAEGDAVAVYDIPYRRRNTTLVECAIE
FT                   SGK"
FT   CDS_pept        complement(8373..8675)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0020"
FT                   /product="histone H4"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25841"
FT                   /db_xref="GOA:E9ASB9"
FT                   /db_xref="GeneDB:LMXM.36.0020"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASB9"
FT                   /protein_id="CBZ25841.1"
FT                   /translation="MAKGKRSADAKGSQKRQKKVLRDNIRGITRGCVRRMARRGGVKRI
FT                   SSDIYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTASDVVNALRKKGHILYGYA"
FT   CDS_pept        complement(10655..11113)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25842"
FT                   /db_xref="GeneDB:LMXM.36.0030"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC0"
FT                   /protein_id="CBZ25842.1"
FT                   /translation="MGCTTSKTKTPAANAASKGADEFYALATTEQHPVAQMLLEEWVLF
FT                   VDAQARRIAGDSSAARAYQSRLKEVWADTANRPVTHRSVDYVGKMFLEYIKEDLSHRGW
FT                   GGNFDYKVAGVVTQGFLKANANIDTALSDTPEEVSWEIKIHYDSLGMS"
FT   CDS_pept        complement(13246..14544)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0040"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25843"
FT                   /db_xref="GOA:E9ASC1"
FT                   /db_xref="GeneDB:LMXM.36.0040"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC1"
FT                   /protein_id="CBZ25843.1"
FT                   /translation="MDNVTVIKGNIVTTSKVLYGGCVIVVNDLIASVCGNETLVRKELG
FT                   ELENTHPGIGAATWQEAAFVLPGFVDIHNHGLGGASDVIGHWSNPEYSLKELARCGTLT
FT                   TLASIIFSDSHKKLVTDCIDAIEKRVGSYTEDNCILGGIHAEGPVIHDRGGLPECKSEI
FT                   SLDDFKRLVNSMPSLRVMTISPHIEARCNYEKIRHLLKKKVRVALGHDRAATKSEIMCA
FT                   LKLAASEEEKMHVTHLCNVSTFNHRASSLVNAAMCPRFPNAPLYKGARPPTLEIIADLI
FT                   HVDSVTLQSVLSSRSVDDIAIITDCISAHIPGKHVVYNGRDSVVQAGGACYLCDSFGRA
FT                   SSTLAGGTSMLADLFHILITLFGKDVVEACLHTATVPARIANLPDVGAIAVGKKANLLL
FT                   FDAELNTIEKRMIYGQWTSHKPYRILHPSVAHL"
FT   CDS_pept        complement(16690..18351)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0050"
FT                   /product="putative PUF1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25844"
FT                   /db_xref="GOA:E9ASC2"
FT                   /db_xref="GeneDB:LMXM.36.0050"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC2"
FT                   /protein_id="CBZ25844.1"
FT                   /translation="MSSEEKLTALYARRQEILKDLSEVDTSIKFLESEIQTKATEAAKR
FT                   TIDENKSGNADLDRVNEVIASCVRDATGLRDALKLVEACRYVQEYGKEDDAARQKIPFR
FT                   NVFAQECIRHALDLSNDANGSELMQHLVPLLRSGTKPVTMGDIFYDPTTNEQDLSEVLL
FT                   LIRELSSDIVTVACNTNGARVSQRIIDVLCTHEEFDVYTSVLEPSIVDVAKDINGNHSL
FT                   SKLITSPRFCQLGDSDRSASGAAAIYERIFQKIADNCIDICKNRQGCCIIQKCLQHAPK
FT                   PYHTTIINTVLNNSLKLVQDPFGNYVVQFILDKQQDINGTKKEDTDDDAISTAPNYTNQ
FT                   IIRQMLHHVAELSCNKFSSNVIEKCLKTSSPDVRQLLVDELTAPHVLPKLLTDSFANYV
FT                   IQTAISTASDDGQLTQLRDAIIPLQSLLKNSPYGVKIESKLSRRHREAARRLLKKKEAA
FT                   TPVTQAPPAQQEPLLPPYMPPQGMSAIPMMAPDASMGQQVSFTNLNADMASFLQPQRMI
FT                   GMPFVLQGQQMISIPNAPPPSFTMGMINGTGLPEYR"
FT   CDS_pept        complement(19658..21349)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0060"
FT                   /product="putative L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25845"
FT                   /db_xref="GOA:E9ASC3"
FT                   /db_xref="GeneDB:LMXM.36.0060"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC3"
FT                   /protein_id="CBZ25845.1"
FT                   /translation="MFPEQMAEPLVIGLDYGSDSARAVLVRVRDGAELQSAVFDYPRWT
FT                   KGEYCNSKLMQYRQHPCDYMEAAENVITAVLKAAGPAARDNVVGLAFDTTGSTPCMVDE
FT                   TCTPLALRPSFANNPNAMFILWKDHTSVKEAAAINALAHKSTPDYTSFCGGTYSSEWFW
FT                   SKALHVIRNDEQVSQAAYGIVECSEWLPALFTGVTSYQKLIRSRCACGHKAMWHESWGG
FT                   FPPRSFFDQLHPRLGLMRSRMSDVTETIDKPVGTLSEEWARRLGLSTRVVVAGGAIDAH
FT                   LGAVGAGIKPYSFVRVMGTSTCDMMVIDSSILGHRRVKGICGQVDGSIVPHMIGLEAGQ
FT                   SAYGDVFAWFSELLQYSSARLIASTKLLDENAKTELRREIKRRMLSTLTEDASRIQPGE
FT                   SSVHALDWFNGRRTPDANQNLKSVIGGLTLGSDAASVYRALVEATAYGSRAIVERFRRE
FT                   GVRIDNVIAVGGIAKKSPLAIQILSDVLNMPITVCNSEQVCALGSAIAAATAAVCYGSI
FT                   PEAQKKMASGSSTAYKPCPEAARVYDELYQRYIELAANTERMYSHM"
FT   CDS_pept        complement(22189..23157)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25846"
FT                   /db_xref="GeneDB:LMXM.36.0065"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC4"
FT                   /protein_id="CBZ25846.1"
FT                   /translation="MDPVKRRLVYVADENEVLLSELSGTPPTRQSRHTRLLVPLSPPTS
FT                   SQQSPHSVSPPPRPVDETAKAAPVLTADKALLVSYDGFLLTDGSGRFSTPRDAAQAANI
FT                   RASLKTCRSFLKGFLNAGRPESESTESCSSGASSSTYMEEEDSDLEDTSSDYSPPARPR
FT                   AAKAARARPRHSLTHSPSQMTVAELKELLRHRGLSITGNKACLVKRAQKLRAHKSGHVL
FT                   ETAPLSPAASQRTLQSSLPHEITLSSGTSVSSPPLSPRSSQRKSPNCHTSDEKNNSIWG
FT                   ALVHAGSRLFRGGQRASWGFHTRPSEDADDAPFSTRRRLSA"
FT   CDS_pept        complement(24083..24850)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0070"
FT                   /product="stress-inducible protein STI1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25847"
FT                   /db_xref="GeneDB:LMXM.36.0070"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC5"
FT                   /protein_id="CBZ25847.1"
FT                   /translation="MEDYKAKGNDAFKAKRYQEAIDWYTKAIGLNPNDEASGALYSNRA
FT                   GSWQNLNNFEKAAADSEQCIRLRPDWLKGYFRLGVAMESMSKYDEAQKAFQKALQLSPG
FT                   NEEVMDKLHTINTKVRDRNEKIKSQHCKTPEEAKKLGNSFFKDGKYDQAAEFYTRAIEL
FT                   QTGPVKEKAVYYTNRAACHQQTHMYSLMVDDCNAAIEIDPANVKAYLRRGIAYEGMEKW
FT                   KLALEDYTKAQSVSPGVAGASQGILRCQRLLRN"
FT   CDS_pept        complement(27797..28687)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0080"
FT                   /product="putative leucine carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25848"
FT                   /db_xref="GOA:E9ASC6"
FT                   /db_xref="GeneDB:LMXM.36.0080"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016651"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC6"
FT                   /protein_id="CBZ25848.1"
FT                   /translation="MALIQTAHDACSRKVHCVRKGYLNDPFVSFFEKDHTIVNSPLMNR
FT                   GTWLRTTAFENCVRGFATAAGQPIQVINFGAGMDTLYFRLKHSDPKFPVQKFVELDLAD
FT                   LVAEKERIIKRHDEMHSLVGSQYVLVSCDLYDAKGVAKVLKQHLQGGTPTIMIAEMVFV
FT                   YIEGSVTTNLLRTVMSNAIEPGTKTMLVTYDAIQPFDRFGKVMVENLQHFGADFKGIGD
FT                   FPTPEAHAQRCTELGFKAVKSVTMKNLYLGVPRQIQIRLNQLEMIDDWEEWNLMHEHYC
FT                   FVVGSTEDAPLPKLF"
FT   CDS_pept        complement(29417..32587)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25849"
FT                   /db_xref="GeneDB:LMXM.36.0090"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC7"
FT                   /protein_id="CBZ25849.1"
FT                   /translation="MGRVAMSSHIVQAATCLRCGNHSGAAAALRELEVGEGVRTLQTAV
FT                   QCLMNENGASDDVYVRFIAFKVLAYALTRCRDGRRQQSDTVIAFLLGYAYQMAAQVETP
FT                   AWTPVVSELATATAVALKLGCVGDNLDVCVEEVTAVCSGLVDLAQTCTPSPKAYLHRII
FT                   CQSAVEEFGLFSGTSRYRGLPMRVHRRCRELFSEEGRLPNLIQALLRGLLVSAGESSMS
FT                   VDKGLTALVSCLAWPSHQFFEEDSSTEESCGVFYVAHEGWDRLLVGDIGLESGACVTVH
FT                   GVLREWYGSGSVNGVPVNRQKVIEIVQLLCSFKGSEWTETQCLRFLVSSLSLCLDVFEH
FT                   LSQWATEEDFHLFPLLANGILRLVSNYVEFFFHPQACALVSRLTALTAVLIRRDTSSNT
FT                   DTDVMSCVDEMLSVWFHLTSYIDRSSFSGNGTETIAQRHLISQGCQTIFSTYLDTKVNT
FT                   DAAELELDCFADTFTNSHLHLVAQVGRLCASSTCELLIRYLQSLRSTLASTLGAGGAAP
FT                   TPLFEALWTLLKIVGFFIADPLEGEQPYIPRCFLEMGSQGSALLLHLVTEVDALVPLLQ
FT                   NPAAASPAVLAAFLDVLTQYIKTYVEAEESCTLYVDAFSGGADIVAQSLLAVVGALRLT
FT                   PFEEESTSAACRLLDSVADKSSRVRSFCHRQEAFQALTLAVQEIHRFRFYGHTRGRLIA
FT                   FVISCCPDADSVQAQLLEFTLSPSAEDDVNMVLELLSSLAGLFESLHSQQVIRCVFPAL
FT                   LATGQRLIGVSTSKFYECEIVIESVQCVRSMFVTCSPLLEDSDIRMLLDLVLAELRYVV
FT                   TALQTSSAWTSADGEGDKAEFIISTARLLSSLAQWKALDCFLSDDDTRAVSIATVEAAG
FT                   ALLRHMDERSLSLPSLEDGIFTCMEVCAESFTADFVFASCSDAFLSAMLYALNSERANI
FT                   LRAGISVTTSVAAFLEAATPLASHASACCDLLKVVLRSLTSGKVFFNNLRQISRVLLIL
FT                   VRGVPYDSLVATLEAVVREVSNCDAFVAAIFPALQSVAGRANASEPGFEELLQDALSFL
FT                   HGTTIIGA"
FT   CDS_pept        complement(33292..35151)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0100"
FT                   /product="putative DNA damage repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25850"
FT                   /db_xref="GOA:E9ASC8"
FT                   /db_xref="GeneDB:LMXM.36.0100"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC8"
FT                   /protein_id="CBZ25850.1"
FT                   /translation="MTAMSRNTRDQVNSLQHFQQHSRLYFIGQWRTKMEDVFREWFIAH
FT                   PEWNHGTLEQQRTFVHVDMDAFFCSVQLAKPEYAHLKTKPVGIAAGKYNSDISSCNYVA
FT                   RSYGIHAGMYVNSAKERCPELVTLGYDLEACERVAKTLYQIIFDLFPTSVKMSMEVYSI
FT                   DEVMLATDTTDYALLQSFCETVRRELFSATGCTASCGIGPNIMLARVATDRGKPNGICV
FT                   VHAKDVVQTMTSLPLEHIHGAGESTMEKICRALREQGIIDERTDADGVTCGSVQKLKRE
FT                   ALQRILGKRQGETFYHLVRGEDGRVVTRTGDPENQRHLGKRIPNAVGCSMNYAVRPEGV
FT                   DGVWKIVRQLLDDVCTKLRRTDTVAQGLRVTLLERHPLHPKETQKYMGRGKCVEVHLPI
FT                   KLPHAMAADDVEAMELEIRKVVSPLLVASRAMSDAERAAQLGLSSSKVDLVVWTVTTAS
FT                   LRDIVIEDLRGMTVQATGLRQKQQAPFTRQRHSGQQMTLATGFFNAKRPRTPDVVTVVE
FT                   PTPAQPPCGTVCRPPADSSLDAATLYLLYAQPWSHRDDATAAQWRRGCESACRQLDYPV
FT                   VKAYLRCALAKLSEWPKLQEAAETFQELVSFANTRLPAPLDFL"
FT   CDS_pept        complement(36313..39063)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25851"
FT                   /db_xref="GOA:E9ASC9"
FT                   /db_xref="GeneDB:LMXM.36.0110"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASC9"
FT                   /protein_id="CBZ25851.1"
FT                   /translation="MGTTCVCVSVYVLLVGRRGCCLRQRKRTRAAFTTVIISFFLWCTA
FT                   IPRTFRFSFTSAGQSCKEEDCPMSSYQVPRPSDGALRTALKAVLTTSQPPPLVAHPPAR
FT                   NVAWRPRRIVEELKALRCVEALSSFEVELRGLVGMQETRYRTKVVNRAYRDECALREVE
FT                   HLLAAETAERRDATETFFAIVQAPFEVLHLRLQEELTRRSLRCEERSIWRAMQLRASCS
FT                   CLALTEADNRAALGALEECAREELKNRRLIELGNNLQREIIAQRRLAVHLRCVDHSKGA
FT                   KRARQRLDWQEEMDRATVERLYSLHLILLLQGVQVDFTAAVKRDVIRLSEASGAMAQQV
FT                   HVADCEDCVLACLDQEQRLRLTLEEQEHTGFKAVTQAFLLGWRGVYKQITKDSDVTSVF
FT                   GKIELLVRRDIVDQRRLELNTLLLACQAHTCVLKRHQVERRTLCQKYIDGARVISTEEN
FT                   REANQLFCDHHVWQCQQAALQRATVLAVEELASSRAIRGAEAQARLACKLQYLAEKLQI
FT                   QCEEGRRRVAEEEEHCLSALREHYVHVFFIQGAGRLFVSERAGRMLIELEESAAAVDTL
FT                   LPLRQALAHSLVSDACRPLWELEDEFRARVAVEEERECCGLVRQHVVLSEATHRIGLFE
FT                   LEHSFWIRPITAQVSAMEADARGRLCRSAEAEMLLVRQCVLEDREWELRKSIRKCEVLV
FT                   RESLAFTDRSPARPSLLRLTDATDMWGALEADWGDAASDVATWTANWPLDERPSLTCYS
FT                   TLRCEDVLVEAYLERDLIHFMEHREWLQVLHEANTSNSAAKRSFFDLTSWKLHSLSMRL
FT                   EPQQRAASINVWHSNQSFDVSFPLTQQPEEAIVGERTISFYAPDAGTTATLMQRDTDAG
FT                   MVFFLILDDEGTVLACATMVVEVVPKCSAHLCIPLDSNRGFVRLV"
FT   CDS_pept        complement(39663..40634)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0120"
FT                   /product="putative mRNA capping methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25852"
FT                   /db_xref="GOA:E9ASD0"
FT                   /db_xref="GeneDB:LMXM.36.0120"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039753"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD0"
FT                   /protein_id="CBZ25852.1"
FT                   /translation="MPQNQAAAAYDDVTRKRKDDWSSQQVAFRHFNNFVKKTLIQFSLD
FT                   CVLTNAAASPSEGAAVLDLASGRGGDIGKWFFMQSPAQSNPRAPSSVLHTSVYDCYDVS
FT                   LECINEAERRCKDMIAAMEKPPQCCASFTVADCFTESFLRGTLPCSPHFGRYSVVSIQF
FT                   AFHYACKSLDLIRNVFSAVSDALAPGGVVLITTVDIAMLSKRAVEGTLGNELYSISFPN
FT                   PPEYAAASNGNTLLVTGTEYHFRLDGFVDCPEYVVPYDAVVQIASDARLRLCEHMSKPF
FT                   SEFVPDYSASWKANKGNKLSQAELELVTLYRALCFVKEKVAL"
FT   CDS_pept        complement(41509..42612)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25853"
FT                   /db_xref="GeneDB:LMXM.36.0130"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD1"
FT                   /protein_id="CBZ25853.1"
FT                   /translation="MSSEGKETESRQAGEPAAAVKPPSTNSSSSEDSDSDTYTITQTLF
FT                   DALAGRGFSENAIKKSIVAGCIDEATCTQWIQMHEGHPELDTALEDGVEVIIKAKRVLT
FT                   EAERVAKVRELQERVRRKKEEEKLELQGKERERLEMGRKVLRMKSEMEEVRRKMNVEEA
FT                   RRENAADLEARRRIKIRIAADRLERRGHTRDEALALAEKEYEEAATKARAEAAAKLEIL
FT                   QGAQAPAQTATSPSDGAWNLSAITAPSSAQNTLVGLFAGEAPMCAQSLVDNIRKRAPAE
FT                   QTAECVRTLRLILGNIVSDPFDTKKRTLRISTKAFRDVILPVDEAVRLLRWCGFDLSTD
FT                   AANNQTLCLSTVVVRRLRQALALLDSE"
FT   CDS_pept        complement(43424..45367)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0140"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25854"
FT                   /db_xref="GeneDB:LMXM.36.0140"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD2"
FT                   /protein_id="CBZ25854.1"
FT                   /translation="MLKQLKETVVSAISSNPLNAYELDTSGTTLCGRSDLFEKCDAVVR
FT                   ANGKKVSIFTLRIKRVLERCTASEALALIKVVKESVALLTHMRHPGILSIEGQLVEDKK
FT                   KIWFAAERVSMVLAPENVQGLPLQVKLLGLFHCAEAIRFLHEKAELLLFNFALSSIYVT
FT                   EDNQWKIGDLCFAVPRAQLSAPPPPPFPFHSVAAPLLDYLPTEYVQFCTKKDDAANRDL
FT                   FSAGAAPLVYPDSDTYGFLVVTVEVLQGKRLFNCCGNPQEQQRQLSAVEGHISRYFPAA
FT                   ALRLPRPPISTVVVTGPFATPDMKTLTGLFSFGILDSDPRFRLLKALYDGLTKGDFCEA
FT                   VILSGIVPLMVQESKVDAMLRFVLPILLLCAGTLSTSSFHRTLREYFVSLLTAIIRAPS
FT                   LQPAAVYAEQILQKRECIHKHFASVEDKATLIVPLILKLMPSEGNERLQKGSLEWFRDV
FT                   LTQTPTIKLGLPKDIAARLLNVASSNADSFALAFQCLEKILTFSATETKMDVEVNLTRT
FT                   ISNTAISFTSVQLDYMLGLLRGIQEKMNPEHRAVKSIPLLCPLLLHTDGTVRQFAVASI
FT                   VRYAQLLGSGPAPATAPLPPPPSSGGSFSSSAANSGAPAALAGSLTQHALPPSAAPPPA
FT                   RADDDVFASLFS"
FT   CDS_pept        complement(47592..49049)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0150"
FT                   /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
FT                   os phatase-likeprotein"
FT                   /EC_number="2.7.1.105"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25855"
FT                   /db_xref="GOA:E9ASD3"
FT                   /db_xref="GeneDB:LMXM.36.0150"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD3"
FT                   /protein_id="CBZ25855.1"
FT                   /translation="MVLAHLRASNVYDVGDMNEANTIDFRHMVGVEYHTQREVVRQPPS
FT                   LTDTNANDVAMVSMGLYRFSNATSPVVIFVSSEERCSMPARFFCTRFVHYFRWIGESVQ
FT                   LFVASKSFQDHRPTPYATQRDTWLQENRRCVSAALDYFDANPKLGFVATPVAVIFTDCD
FT                   CADARAALVNLLPPDRSFLIRHVRFAEEWESHRHNSYRFIDVSLQRQALRASRSSGSVV
FT                   CSRLTSFLNSMLPTLYQLYSAEPLEGAPDETLKSFPPIFFTRHGQSEYNVEDRLGGDPD
FT                   LTETGRIDAEDIAHFFERQVKTNVNLFDHRPTVWEEDGNFEVWCSQLRRTQRTAQPTAD
FT                   ILCHGVLKPFKSLNEIHAGICEDMTNDEVKSLYPFIQRFRHTDKVGFRYPDGESYVDLV
FT                   RRLTPLLNDLNNCMKCVVVVAHQAVLRTMLSFFGGRPVEEAVHVPCPQRTIWACTMNRL
FT                   GEPQLAEIALSPRQGQDEGSTVHWQGW"
FT   CDS_pept        complement(49584..50441)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25856"
FT                   /db_xref="GeneDB:LMXM.36.0160"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD4"
FT                   /protein_id="CBZ25856.1"
FT                   /translation="MQQLQVSACVLLLALLCVTTVRGSGGLQHGTWDVSTLIPGRGAVP
FT                   PNYELTVQPGKWTVKERDAGRVGRLFDHAAARVGLVYAGVPSDEHALCRMPSSLTLKLA
FT                   AVRTDDGIRLECQTVWFSPSLLRSFDNDGLLHRRFDPAEPLYSADNGECLATPWRVREL
FT                   YVAKMGAGPLLLTGVLVDGTSGTQESCSVHLEVRYRPITSAKDSSSSSTLVSIAMLLIV
FT                   VAARLLPRCILTRKGQLDKASYRGKNPTNLTPAHRLHLLRQQKKIIEKMKAEDVANAAK
FT                   LTAV"
FT   CDS_pept        complement(52330..52797)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25857"
FT                   /db_xref="GeneDB:LMXM.36.0170"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD5"
FT                   /protein_id="CBZ25857.1"
FT                   /translation="MDGTSHFTRIKDAPETLNPITGRSIYYGMRPWRCDDRFQDWLKSF
FT                   TCFDSVSVQYNLLKLFAQCARSQEGEEPIDNYHRLGRAEVMYYVERYRSGMMRTGVLET
FT                   YPYDQNELRRIAEEDGLKMRVWRHQRELEMESKEGKIDEVLHMNVMRRGKP"
FT   CDS_pept        complement(53406..55943)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0180"
FT                   /product="elongation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25858"
FT                   /db_xref="GOA:E9ASD6"
FT                   /db_xref="GeneDB:LMXM.36.0180"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD6"
FT                   /protein_id="CBZ25858.1"
FT                   /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAGI
FT                   IKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLIDSP
FT                   GHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDRAIL
FT                   ELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAFSLTR
FT                   FANMYAAKFGVDELRMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCLDPIYQ
FT                   IFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQMIVAHL
FT                   PSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRGRFFAFGR
FT                   IFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMPCGNVVGLV
FT                   GVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLAKSD
FT                   PLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSFRETVTDVSSQ
FT                   QCLSKSANKHNRLFCRGAPLTEELALAMEEGAAGPEADPKVRARLLADNYEWDVQEARK
FT                   IWCYGPDNRGPNVVVDVTKGVQNMGEMKDSFVAAWQWATREGVLCDENMRGVRVNVEDV
FT                   TMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVEHAMGGIYGVLTRR
FT                   RGVIIGEENRPGTPIYNVRAYLPVSESFGFTADLRAGTGGQAFPQCVFDHWQEYPGDPL
FT                   EPKSLANATTLAIRTRKGLKADIPGLDQFMDKL"
FT   CDS_pept        complement(56414..57091)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0200"
FT                   /product="mitochondrial inner membrane signal
FT                   peptidase,putative"
FT                   /product="putative serine peptidase clan SF, family S26B"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25859"
FT                   /db_xref="GOA:E9ASD7"
FT                   /db_xref="GeneDB:LMXM.36.0200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR026730"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD7"
FT                   /protein_id="CBZ25859.1"
FT                   /translation="MPWRQWWSTLRCSKYGDVPFMLLGVFIGWNCDVSCAVKGVSMVPT
FT                   LHPGEYILFVPYTMLRVRRWFNAPLVNLSDVVVVKVSDDLSVCKRVVKCTSSRAQAEEW
FT                   GKDHYVEVVPAPYSSPAAQHINGHAEDSTEMDSVTNSERAYFDYVARNTVRSKDWDSCT
FT                   DRIPNPSQWVWLEGDNKTDSFDSRRCGPVPVECVRGLVLASIWPSPHTLQRPPPPPRAS
FT                   QLP"
FT   CDS_pept        complement(58862..60283)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0210"
FT                   /product="putative SET domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25860"
FT                   /db_xref="GeneDB:LMXM.36.0210"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD8"
FT                   /protein_id="CBZ25860.1"
FT                   /translation="MSISQRVAVVHDAAATPEQLDAFQRICPNTCDFFSVKDVAQLQYV
FT                   VQHIYAAGPPVYGAVANLCTDGSGGANGGVTSALATLFFHHASLSYTGCRAATLNYPFD
FT                   VLLMMLFYADVPLPPFALIDSVEAARRAAHRLKAPVQIRNTCGLLGLYRSCCTVQDAME
FT                   ATLIRALHEHGKIVAWEVNASKERAVRVLVTGGSVKGAAAAIPVESCAAAPLWAAHAEE
FT                   AAQRLGAAVSRYVLYDCGVASLTLNTLEENPDKWCFEDLVLNPALPDLVLEEATPNLLS
FT                   AVPTAAELVASLLAEARKSHPAPAYEIKLYQDSRKGYHLCAAKALRKGDVVFEDECRSF
FT                   AMVTRPYVERHWDGPLKKTFTEYAWPLDSEGHVYAIWEENPQRWRPINHSCDPNCIFAA
FT                   PHSLNVIAAREIAAGEDLSMDYATFCDGTMKPFECLCGAACCRGMISVDASSLAKYGEH
FT                   SWLRKAPSAVKPLLP"
FT   CDS_pept        complement(61762..62550)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0220"
FT                   /product="conserved dolichyl-phosphate
FT                   beta-D-mannosyltransferase precursor"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25861"
FT                   /db_xref="GOA:E9ASD9"
FT                   /db_xref="GeneDB:LMXM.36.0220"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASD9"
FT                   /protein_id="CBZ25861.1"
FT                   /translation="MQYSIIVPAYKECGNLEPLVRRVFAAVREQGLPTQNVEMLIVDDN
FT                   SCDGSKEVVERFHKEGFNVSMDVRTTERGLSSAVIHGLRHTSGVYKLVMDADLQHPPEC
FT                   VPALFKALSRDGVEFVCGTRYGAGIEIDKNWPAHRRLISWGARLLSRPLTTLSDPMSGF
FT                   FGIRDCVFKRHAGEVNSIGYKIGLELFVKCRVQCFEEVGFNFATRTYGESKLTGKVILH
FT                   YLEHLYALYLFKLGRLFYVFVVVAVMFAVYLLAFLYHSLF"
FT   CDS_pept        complement(63963..64292)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0230"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25862"
FT                   /db_xref="GOA:E9ASE0"
FT                   /db_xref="GeneDB:LMXM.36.0230"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE0"
FT                   /protein_id="CBZ25862.1"
FT                   /translation="MGVIRTVMRAGVGATPKRGQTITVHCTGYLADGKKKFWSTRDDNN
FT                   PFSFNVGVGQVIRGWDEGMLQMQLGETAELLMTADYAYGDRGFPAWGIPSNAALLFEIE
FT                   LLKIQ"
FT   CDS_pept        complement(65224..65898)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25863"
FT                   /db_xref="GeneDB:LMXM.36.0240"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE1"
FT                   /protein_id="CBZ25863.1"
FT                   /translation="MLFDSDDDNLPEVPTVRSNSLIPLTTSDAQAQRLQQLEAEYRASR
FT                   AEIVAVRQRAARRCSSSRSVSPPEPRKAASHVWEERDEAAFYELHSLVPHLSPQFACSY
FT                   SDAVLLIAAIQSGGAASGNRRTLADKCQSLEADRRQLEQRLEKSRVQCEELKREVAEVR
FT                   QRLRVVQEESKNSVNALAQRREEMRKQLLLEEVRAEKLMVRNKKLEQENDSLKGRVRDQ
FT                   FR"
FT   CDS_pept        complement(67200..68834)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0250"
FT                   /product="EIF3-interacting protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25864"
FT                   /db_xref="GOA:E9ASE2"
FT                   /db_xref="GeneDB:LMXM.36.0250"
FT                   /db_xref="InterPro:IPR019382"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE2"
FT                   /protein_id="CBZ25864.1"
FT                   /translation="MATNPDIETDIPRDVYQFFRGLNRAVERRDAAAMHDLYESQFDAL
FT                   TKNYYMAGHGQFRSWPALRLEQVSSCFRGNRMAELVYSFLFYKHLFMDNRSVRAPDAEG
FT                   AWKTYSELLPMLKSYELPNWMLWDIFDEFLYQMTVVYQKVFVTEGIWAVPEVSRLLNEV
FT                   VDNSRLLELVKEPDFLDDIHRGPNTGALSGFYAIVTKSKLSVLLGDYYSALTELEPLDV
FT                   YNKGRAVLTRVSPCAVSVFYHIGFSYLMIHRFEDASNAFRRCVTVKLNGRRFSERVQQD
FT                   AAYMYVCARVLGGMPINNLTSYLDSRKVAAFEDDRESLRTGDEERFRDVFDRCSPKFLT
FT                   VPPSDGSPVKGSEGRELQARMFRRAVQQQQDIIKLRGYFKVYQNTKMNLLETLLEVDDG
FT                   YAPLFALKMRSRQLVHDGVTADLLQGVFTSSSEFDCIVQDDNVEVVPSMTFGGIEQKLL
FT                   NKIKNTQRDIEMAKRKFNQTRNRDEGANKRKDPRDQKRRPNQQLLHGGVGNNTGSANRN
FT                   SNNANRHPRQKMAAQPMTNNLFNRNDN"
FT   CDS_pept        complement(71757..73220)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0260"
FT                   /product="putative xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25865"
FT                   /db_xref="GOA:E9ASE3"
FT                   /db_xref="GeneDB:LMXM.36.0260"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE3"
FT                   /protein_id="CBZ25865.1"
FT                   /translation="MYAGIDIGTSGIKIALMRSDGQIADSASAPLTVSSPHPLWNEQDP
FT                   ASWWTAINSAMDELQRRQDMSSVRAVGLSGQMHGATLLDKNHKVLRPCILWCDGRCYRE
FT                   CEELEKAVPTSRDITGNLMMPGFTAGKLLWVKKHEPEIFAKVDKVLLPKDYVRFLMTGD
FT                   FASEMSDASGSMWMDTGKRDWNDDILRATGLSRANMPKLYEGSEITGKLSADVAKRWNM
FT                   NCVPVVGGGGDNEAGAVGAGLFKPGQAMLSLGTSGVYFVVSDGFHYNTKEAVHSFCHAL
FT                   PKRWHLMSVILSCAICLEWAAKLTGCRSVDEFVSDATKAKNFDERPAYFLPYLAGERTP
FT                   HNNPNAKGVFFGLTSHHGRPELARAVLEGVSFAMAQGMDAVHRCGVEPSNIALIGGGSR
FT                   SRFWRQMLADVSGYPMDYCVGSEVGPALGACRLAQIAIETRPLEELLPCLPLKETHTPD
FT                   MKKHEQYKKRRVIYDELYRQLKLIMNAKL"
FT   CDS_pept        complement(74113..76563)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25866"
FT                   /db_xref="GeneDB:LMXM.36.0270"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE4"
FT                   /protein_id="CBZ25866.1"
FT                   /translation="MVHAHRSETMTDIYAVAQNLIEELRTNLGELRRSPDVQARLQRRV
FT                   VRKIGAERARCHGHCSGLKSTVEKPRFCFLPLTTAPTTHIEFSHDFSRNEDAVTKLNSN
FT                   ATLTTVTATPGPRSCSRSTVSRAKPPSSTSLPSNDTTGAVLTTRPEILASQSIKAAKEQ
FT                   NSQAREPASHVKHVTSAGEPRTGGGAGAATAASSEAHTDSATRAWCIPFSGASRALIDL
FT                   RRLTPLARQLYTDMQRRAAAMPAASPSAEWRRRTAGPQDAEVRRAVRDYLYRMNIISVM
FT                   EAEDTSVTAPHVFRDAVLNGTALCQLVATLREGGEPTLSDPVLCRCPCTLDEVRVNYAV
FT                   ALAALRSTPSTAQELMPRAAWTMTPEEVYLRASPTALLSLFVHLISTYLPAPEELPVWK
FT                   QHMCWQPPADTADYAPVPPAELVAIEAGCCSFLHAWGALPDGSVYQLPGDECLLPIATA
FT                   APYMAKWSGFVARPVAPSSISVPSVWPFLCNGVLLVLLARRSGLEAVAMEAASTPAVQP
FT                   FFANPRTVACCVANITNALHSFQTASKKLPLSFLSEESVAAVIRGDRVHILHLLLHVRA
FT                   AVEGTAQPLDVHSALLSKDTVAEAGCTPAKVSSRAPDGEAAGASSSFSWSPASLAQTPS
FT                   TVAKAALRPSASPLPAHRSLSLCRVPAITSSSSGILRPEAVPADEPQGRGGLCGWLRQQ
FT                   LGTEYRYIAADESFVFDAATFSWRHPCLLFSDGVVLAYLIGRLERRRCSFLDCVQPTSK
FT                   KPAKLFNVRRCLEFLRFNAGVLFDVPLLDEALTEGRVEGVVSVLQGMRRHYCLTNVRRS
FT                   HHNA"
FT   CDS_pept        complement(77630..78235)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25867"
FT                   /db_xref="GeneDB:LMXM.36.0280"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE5"
FT                   /protein_id="CBZ25867.1"
FT                   /translation="MASSATSSSSPDGKIVNLLAVALQKVDDFKGKNADARHYASQVVE
FT                   AVRANSNSEEEFRDQIICIVANVKNLNGELGAGSQERKAGISAAELATMDANAMRSRLQ
FT                   KRTMAATFRKRAREQTNVDKTSLHCTKCGLVRRDRLNINELALESEESGSHFDYNFDNS
FT                   CACSHSSDEERSSSGDEEDDDTAMSKGSCATASDSHSD"
FT   CDS_pept        complement(78733..79683)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25868"
FT                   /db_xref="GOA:E9ASE6"
FT                   /db_xref="GeneDB:LMXM.36.0290"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE6"
FT                   /protein_id="CBZ25868.1"
FT                   /translation="MRRREAESAARFYMAGILVGLFGLLLSCGYSFGLFHAPDKVEQLN
FT                   AAIRAVEGRQVALLLDSVFSNGTRFDAKGHMHPLYSLACVQEEETEEARRMIRNVARRF
FT                   RTEPFDIGYAYHPLTAAYRHHRYAVAQALIEEWRRPVPDVSEEEAVMDEVYASSLTVSE
FT                   LQRVDPSVHVYCRDADAARCRALDPERIRDASNSRLEAAYRQRFGQTQEMPAVTPYRDT
FT                   DMPSKIVAPASTVRAAFWDDPFRPVVPDLLPPRTAMMMNPGYFDSVLDQLSYTLLGHME
FT                   GSSTVVAFVLFAMCTMCLFLGTWCAGVSYWLLHYT"
FT   CDS_pept        complement(80929..81852)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0300"
FT                   /product="conserved NUDIX hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25869"
FT                   /db_xref="GOA:E9ASE7"
FT                   /db_xref="GeneDB:LMXM.36.0300"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE7"
FT                   /protein_id="CBZ25869.1"
FT                   /translation="MIRATAAAARLPQSTQGWVPLMQRALDFPIESVTFPPHFYLHTVN
FT                   NGTASTAGFLPQKTSVELTGLRQCAVLVLLSPAATGNGFQDMCLTLMKRSATTGSQKGE
FT                   MSFPGGHVDGDETLRDAAQREALEEVGLLPSEYEIVGSLTPITAKALSACVTPFVAVAT
FT                   RPAQPYRASPAEVDSIHYLHMSALLLKASTRHARVIKYHSLTSNRPCFFPCFFASPAQT
FT                   VVSSAVCRSHKATGVADDCGFDPMLPEDFPGELVWGLTSFVTCELVARVAKAIMDAPEA
FT                   NSAAAVNALLTPSNVVARDPIAGSAL"
FT   CDS_pept        complement(82928..83620)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25870"
FT                   /db_xref="GOA:E9ASE8"
FT                   /db_xref="GeneDB:LMXM.36.0310"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE8"
FT                   /protein_id="CBZ25870.1"
FT                   /translation="MSSEHWSFFGLPPFFTEQHSPATVDRQCTLWSNLLLDHAIYHAKR
FT                   TAGGDTNALLRFYNTQSDVFYNPAINKRLSPEAAHTMLQSLVARHPNHAVIVSDGGPRD
FT                   FSVLVCTTEDGFKGMEETLLRYILGHGEVQTTAMLSKTGTVMTFDELASGTALGYGQAR
FT                   PVYLARFSSAAVPVADVGRLSEEQAIRMYLHALNHRPVSAMRPFKVTLFNLDGTTTQPY
FT                   QGVKFGGE"
FT   CDS_pept        complement(84824..85444)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0320"
FT                   /product="putative proteasome beta 2 subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25871"
FT                   /db_xref="GOA:E9ASE9"
FT                   /db_xref="GeneDB:LMXM.36.0320"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASE9"
FT                   /protein_id="CBZ25871.1"
FT                   /translation="MAETAIAFRCKDYVMVAAAGLNAFYYIKITDAEDKITQLDTHQLV
FT                   ACTGENGPRVNFTEYVKCNLMLNRMRQHGRHSSCDSTANFMRNCLASAIRSREGAYQVS
FT                   CLFAGYDMPVSEDDDGAVGPQLFYLDYLGTLQAVPYGCHGYGACFVTALLDCLWRPDLT
FT                   QQEGLELMQKCCDEVKRRVVISNAFFFVKAVTKNGVEVITTVH"
FT   CDS_pept        complement(join(86048..86535,86537..86967,86972..87031))
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0325"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(88273..89697)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0330"
FT                   /product="putative ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25873"
FT                   /db_xref="GOA:E9ASF0"
FT                   /db_xref="GeneDB:LMXM.36.0330"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF0"
FT                   /protein_id="CBZ25873.1"
FT                   /translation="MPNAWRFVPLARSTSTLGSGLLRSSRVLRQKRLAYSPFRPPPTWN
FT                   ALQKVEVGHRQTDTGEPTLDGTLDLVGYQLYRDGLLPQTNILGRTLPVPDTSGISAATR
FT                   RKLERERDVAVAHMKRHGVRLRRSIKETAVTIGCDEAGRGPLAGPVVGAAVSRIPVSSF
FT                   NNEFDQLYEAPEQFQIFDSKSVSERQRDLVFAMITGHVDFFDIASCKKFLVQHCAGDEA
FT                   TSLALSSKKFDSHVKLSKLPFKKLLSMQTPYLITYHGYNSAGNYVYFWSIGIANHTYID
FT                   EYNIYNASMNTMHRSAQSIWHMLNDARFSHEAAPRPRSSSIAQYLFSRFCTAANHDNER
FT                   RYQVPHHLELLKGATEYFDFEPIQPPLVLIDGHAVPGPSYDYFTSVRIGGDVQPIIEGD
FT                   KRSLSIAAASCLAKVTRDELMNYIDALYPGYGFRENKGYPVEQHMKYVAKNGLCPIHRK
FT                   TYRPCRTVLEKGLQKK"
FT   CDS_pept        complement(90904..91095)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0340"
FT                   /product="putative nuclear protein family a (nop10p)"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25874"
FT                   /db_xref="GOA:E9ASF1"
FT                   /db_xref="GeneDB:LMXM.36.0340"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF1"
FT                   /protein_id="CBZ25874.1"
FT                   /translation="MHLRVYIVDGKRVYTLKKVDPEGKPTLCAHPARFSPDDKFSRHRV
FT                   TIKRRFKVLPSERRLQPL"
FT   CDS_pept        complement(93140..94651)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25875"
FT                   /db_xref="GeneDB:LMXM.36.0350"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF2"
FT                   /protein_id="CBZ25875.1"
FT                   /translation="MQKPRRVSTTTHPQVVAVPRPPMSGSAGAAPHGRSYKVAITASNR
FT                   PRRVSLNAPRHVPKYIFTEPASVPWPRSLRGAQDIYASVLHSRQRTLRKTSEGSGSQAH
FT                   PPSVSAADSEKELAIQDAPFAADKLGTRKDEDLSQLNDGFDGGLSSSTLTTYSPKGRRH
FT                   RSSQSGCMLRLQLDTASIEDELRWSANSQSANAVSHTTLRPDKFAAYHTLRLLFVPIWK
FT                   LYRFHKQMVWATAIVAKYVLLKVHWRRQRRSERATDTFLHVLRIPRTKLRCAAHLLEGR
FT                   VVRIQRAFRCHRVRVQAVVELNYRKLRRDVEEAYWEAVVVQHEAELAVQQRSFSPVPKT
FT                   AREVFGGRAEARARFGLTQRGTSLPGSAGNSSYDAAVPSYELDVYNFHMIGRLPESLLR
FT                   FEMTSAVFAQLGRSAVRAHLMDDFSETRARRTGMEEFMKSGDITPTNTTFMRSRGKCRA
FT                   QLPRFLPESVYTAILNNTCYLTSLMRDDRKLRAHLRQREHHLELY"
FT   CDS_pept        complement(95797..96576)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25876"
FT                   /db_xref="GOA:E9ASF3"
FT                   /db_xref="GeneDB:LMXM.36.0360"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF3"
FT                   /protein_id="CBZ25876.1"
FT                   /translation="MTAEQNILLDPSIRDWVLLPLIMIVLFMGVLRHYVTILMNSPSKP
FT                   NMARICNVNIQNYGRILLSSGAALSPESFKHRAERMLNGMLKKEVDPVNPMEMMNDPNV
FT                   MMGLLKNQFMMMVPNIGMMMLVSYFFSGFVVAKFPFPLSHRFREMMQRGLEIDVLNCNY
FT                   VTSLSLYFLIMSGNQGLLQLLLGEDVESENHSAMMMQQMPQASGQPVDFAKVFKQISDE
FT                   LAFVKDHHRWSYEKAPDVLLKNWRSQKRAKGMAVKRR"
FT   CDS_pept        complement(97604..98971)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0370"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25877"
FT                   /db_xref="GOA:E9ASF4"
FT                   /db_xref="GeneDB:LMXM.36.0370"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF4"
FT                   /protein_id="CBZ25877.1"
FT                   /translation="MGQVGGTATSGRGLTALQVAVALKVTAAAWLKKAEAPTSSSQAMH
FT                   STHCSPDEQFKAIKPEDCSTLQQLTVLSTDHKGKQVKVRVTEYAPNVFSFLRHLKGVTE
FT                   SQFADEWSLPENRLKMEMGEGRSQALFLKSRTMLFMCKTISAEEVHALLRVLRAYTLHI
FT                   IAHPSSLLMRFYRLLKVSVRSEVGYILCFNNVFDVAAVLHEKWDIKGRVPKNRKHPHYS
FT                   HLIRSGYEPDPHVTKTRKNRHVIANPAIDAPQQHPDREGAVVVRGNEDAQRLPTLHDKD
FT                   LTRRFWLPRTIRKRLVEELLHDYDFLKNAGMMDYSLLIGVAYQDDKTQPADKRYGIEST
FT                   NMTSSSGVAPASTSAEVRPASLAQDNHPSGEMTTLTTFPEFANGVHSFDDQEVYYIGII
FT                   DVLTTYTLKKRSANFFKSLLWEQKTLSTIPPDRYARRITSFTGLIFPDVREEANGG"
FT   CDS_pept        complement(99555..100016)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25878"
FT                   /db_xref="GeneDB:LMXM.36.0380"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF5"
FT                   /protein_id="CBZ25878.1"
FT                   /translation="MADCDGDLSNVHPELLKLCANPEDWREQRRRAMKTKIFGTGDQAG
FT                   ASPAAEAYLPTDRTVGPSPSSARQPSASSYSGQQGPVPQQAAGSYILQQILSHKRRREE
FT                   ANTENASALASTPQPHPQQSMTQQQQNPTASQGADLSLKEKLMRKYGKG"
FT   CDS_pept        complement(103179..105149)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25879"
FT                   /db_xref="GeneDB:LMXM.36.0390"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF6"
FT                   /protein_id="CBZ25879.1"
FT                   /translation="MSSKRTEAMTADEEPRRTSAVSNGSSSVSSTNSDEASSSVSDSSS
FT                   SSGSGSSSGSESSDSERHSFPPQRQNSATTERTTSTQQPQQQRHVQLNPELRFERPDKE
FT                   YIPLPPLRDMQDMAKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYQRQYQQ
FT                   AQRSGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLAPMLIV
FT                   QSRVPETMLSFQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLQSGAGY
FT                   KIEAVQVGSTSAAAPRPSSAAAAAPVQALETRAPFAGRLPGTGSVKVPVAPGAGGPRPP
FT                   VKVPMKHVGGGAAHGSVTAAAAPPLASTSVKQMPPEMKHLFWLSVLAHVKGGDASQAFP
FT                   DDRLEALPGLLRLCEMTEHTEEMCILMDVLAASSSGVQTVFERLGGLLSFRRFASHFIQ
FT                   SEEAEPLMQLVEQLARWRVAAWGNTSQQAWQTDMKQRRTRDLMWLRTLSLIPEGKRAAW
FT                   GALLLVMEQRYIFKAPRPDDTTTTDNPLKRRRPEVELGDLHAVLSDNVDMQRWVVPRVN
FT                   VFSAVRLPVELRVPPLCTKLEEDTVRFLNSKREYAEKAQVTWRERLEKILSAQPRVPGA
FT                   AVAVPLWYDPYALLSVASPQP"
FT   CDS_pept        complement(107574..108914)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25880"
FT                   /db_xref="GeneDB:LMXM.36.0400"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF7"
FT                   /protein_id="CBZ25880.1"
FT                   /translation="MATVLNRRFDVLCHSGTCSPYLIDVLSLLVAHANDTELFKTELRK
FT                   SDGGELGAAATGAGSAYVTSSTDPASRTDRAVGEARERQAADRRTQLMYKQVEDPEALD
FT                   DALRASHETVLIAAERSLQTYTEDLKHINDIAMATSAKQLRAMRVETQQQMEAFRDCVC
FT                   GSVVAQTKEELEVIRSELVASVRADVSDMVSELHQVSLSTQQQLQQLTSSYTDFVAQAH
FT                   DALTIAPLADAHEAVKTVEYMQEQLKCIEAAAATRSDVEALGKRLKDLESVMTTLRSVP
FT                   RTPDIGTAAASRDGFSMNVPLPPALSQQKPVLSNRRASNRSQTPKSTSPPLLHLHVSRS
FT                   GSVKGETSSPPPASPTPPAQRTLAERLGVTVEAAEDGVVLAEVLPGSAAAAHRLGVGHV
FT                   ISHVGRTAVTTPAVFEEALRAIEGQAVRITAYDPFNGRVRVLTAQPF"
FT   CDS_pept        complement(110431..111027)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25881"
FT                   /db_xref="GeneDB:LMXM.36.0410"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF8"
FT                   /protein_id="CBZ25881.1"
FT                   /translation="MYSDGERKTVSELQREAEATRKEIIEEAQRLERIKKATAKTQFSI
FT                   DQLFRFFAREVETEKEKKMLVDLLVSNPPDLHIEYVPVLPVGIAIANGRMTNACRIYAT
FT                   DNAFLDDSVFIFLVHTLRFSPQACKIDFLDISGTRVTERGMCFVLEMMIERNTPFTLVA
FT                   KRLSIPSPEAEAVRGRYASLMSALRDKKCCHFIQE"
FT   CDS_pept        complement(112178..113662)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0420"
FT                   /product="amino acid permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25882"
FT                   /db_xref="GOA:E9ASF9"
FT                   /db_xref="GeneDB:LMXM.36.0420"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASF9"
FT                   /protein_id="CBZ25882.1"
FT                   /translation="MRTHRHTTACAGMMSGGDANLSELSPMLPHGTWLRMSYSHAALDT
FT                   ESNRSIGSNMRRANSVPVLTRRDRHHLTLSPMLFDRYYMAEGGGLISSAFNLSSATCGA
FT                   GVLALPYAMQHCGTVTGTLTLIFVCNLTIYSVFLLTKVSALTKLMTYEELAIDLVGPIT
FT                   EKVTATIIVVFCWGVAVMYIVMMGDFIVPLFEAVGLSHKVHRRTAMVLFWALVMFPLSL
FT                   ARGIQTLRYASIIGTVSTLLLAGALVDRFVQERREDANRSRLDPGRHTLPGAPLARWDS
FT                   GMIGALTTFVFSYCCQPVAPRIYEEMKDRSVKRMSVCTVYSMTAVTLIYIITGVFGAMS
FT                   FGDSVKPNILVNFSSHLDSPPARLAYFGIVVSLTMAFPMTIFPTRDSVVMAMGYHAEAN
FT                   PAPVWLSRTIAGLLALLALLIGIALPNIRVLFDVLGGVCGGSLSFLLPALFALRSGYWT
FT                   TAEVGWRHMASTWLTLVFGVVVCGLGTYNSVKSNFF"
FT   CDS_pept        complement(115768..116307)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25883"
FT                   /db_xref="GeneDB:LMXM.36.0430"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG0"
FT                   /protein_id="CBZ25883.1"
FT                   /translation="MYRQSIAGLALAAALAEIQPALTPRQEEEIWRVFDAAMQAAVADA
FT                   PLMSHISVQTPPPSSVGGGGYAAVTSTASELYVPAGAEDGGGMDVEERAVGKPTAASQD
FT                   GETPFEDSHIAFPVYRLMDDEWTLLLKDPTVVVRNELGVSEKIQLDYLRVRLKDVGAQP
FT                   GATQAKQVHTVRERRV"
FT   CDS_pept        complement(118432..119880)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25884"
FT                   /db_xref="GeneDB:LMXM.36.0440"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG1"
FT                   /protein_id="CBZ25884.1"
FT                   /translation="MRRRLACWPIAALAVARAITTNSFVSSIEQVQQQLQTAQDRRVEL
FT                   LRYGRQLYEVEVLDDLKTAYTPAVASKVCYVASQLRIDATKGQPYSAVLEAAMTAEGEQ
FT                   TMDVASLARIVHSCLVLRSEHLHEVLFTFIPFLREKAGAMDAVTTAVLINAYGRSGVQH
FT                   PGLYKALCDNGATVLKDPRVPLAHIANVAYAVSRVKFLHPALMLTLRDHALRKVTEASP
FT                   IISLTVLEAFTELRQIDEDLFSAYEQRLLGQLNELHAPLMASLVSCVVRAGRGKAEVME
FT                   SLGARTVAIADTFDAASIAKVTNAYYEADVASEDVLGALAERACKVAADFRADEIATVL
FT                   NALSAFDLFDAELFPLLASRFVALHRQGGYVDVADAAVILSSFAAVQERNDELIYVCTQ
FT                   LFAAYPGVAMDPAVRVNALWACASLNVHNEAQTKMLEEVRATPSLVKWESKADMLPKAK
FT                   ATLEERTQFLAKVYGITISSSGAR"
FT   CDS_pept        complement(122090..123673)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25885"
FT                   /db_xref="GeneDB:LMXM.36.0450"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG2"
FT                   /protein_id="CBZ25885.1"
FT                   /translation="MIPGGAGSGVEPAYPRSGLTHPYMDSVPTSSVPGMFSSYTGRSTF
FT                   SAGIGEGDIAGGGGGTRVASAESSPSENEAFTKEDRMLLRLLYHQQQAIQVQLNTMTEW
FT                   MQQVNYRIASLERLSRHTRPVTAFGATSNLTASAAPPPSRSTSAAEGYGTVAGQLQGAQ
FT                   LYSSSPALSARDAPRPQAGSAPASVYSGQGLHQHATSSAPPLSSVLESSRACTPPSEQT
FT                   RHQTGGAGGGSAVPSTTRSFESAMAQPWDPHNTSLQSASGAGVHSRTSSHTSALGRRAN
FT                   PLLSSSATMSKLPTSTSRPNWGDPKQLSRLDASVPSGTAQTSLSSGLTSLDTQQPPPSQ
FT                   QQQQSRQPPVVSPPTAAAVPYGSSPLYMPADAVVPPYRRMPPEPTTRQSHSRAAAAVPV
FT                   STATASRAPPASSGTVDASLAASGREGTLPPAQSSSMASSSNHGDARGRAATGTTAVEG
FT                   SREVRATHSGTGVSHGDPRAAPDPAGGAGRAARPHDGGTRLPSASNDDSLSDGYGSYES
FT                   RMYMKNLGLL"
FT   CDS_pept        complement(125451..127304)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0460"
FT                   /product="vacuolar protein sorting-associated
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25886"
FT                   /db_xref="GOA:E9ASG3"
FT                   /db_xref="GeneDB:LMXM.36.0460"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG3"
FT                   /protein_id="CBZ25886.1"
FT                   /translation="MTSVSSSKVNRGRRNCLEQAWNYLNTAFSATAGLKVLLCDDATRE
FT                   IFSVAYSQHQLLQHNVVLVDMLANQERYPMKHFSCVIVCRPSAASLAAVYQELAEGNFA
FT                   SYDIYFTYMLDSTLVQSLANADVLNLVSHVGELYIDSIPVTEWVCLMQLKPSLLSKGPS
FT                   PFMNPITYSQWDPKSLERMSEGIISMLLSTNRRAVIRYREGSKVSEKLAVEVAARMKNV
FT                   HATFPDLKATESVLVILDRKDDPITPLLMPWTYEAMIHELIGFQRGNEVVIDDPDAKPE
FT                   DRVHVVTPQTDGFFGQHRYDDWGQVCVAVSEMVKAYKEMNKFDRNTVSLDEIKNFMNRF
FT                   PEARKQSVQVTRHCAITSELVAEINGRNLTRLSVLEQDIISNNNVTEHSRLVLEVVQDP
FT                   KTDVDDALRIVMLYHLHYERVTGNIIMQLKQELMHRQCPQEKVQLIDRLIEYAGQDQRC
FT                   HEIFRSSTGHMLKTVAKAVGQFGKDVQNVLTQHVPLVRKIINRVYNGTLSVEKYPVQVV
FT                   PGCPIPAGQAPFVRAKDIIVVYIGGYTFSEAMLLAQINEGNVDNNQETLLNFSKQVSRK
FT                   LGTDGVTGPSTEPYTAKIEAHVSLITTSMLNSKDFIHSLPS"
FT   CDS_pept        complement(128140..129462)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0470"
FT                   /product="dihydrouridine synthase domain protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25887"
FT                   /db_xref="GOA:E9ASG4"
FT                   /db_xref="GeneDB:LMXM.36.0470"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG4"
FT                   /protein_id="CBZ25887.1"
FT                   /translation="MKVEESMLYQKTILAPMVRVCSPGFRALCGAHGADIVFTEEVVAA
FT                   KLAMCQREVVHYPTVDTPMAEYVSYDPFKNTYKRTVVLSTPVLPGITDGGRKAERIAAP
FT                   RIVLQLGVADPVRGAAAALVCSNDIDGIDINMGCPKKFSVHNGFGAALMKRPEVGGAIV
FT                   RAVHDAVNSDSNVDARGGKRIAVSLKTRLKDTAEATVGMLRAMLTAAQHTPANPALHAI
FT                   TIHARTPEQRSEQAPLYDRAAEVVRICRANAAFEGICLVLNGSVLSRQDGEAKCALYGF
FT                   DAAMIARAALEDARCFHRICSELPDSSVAHDGEAQSREDAEEYAMAIMKELFFYSVRYR
FT                   TLFNNFKYHLTRAFPVVKALKPFMEEVQHELRSYTDCYEFFRLTVEETALADSCAHTME
FT                   LLAKKPASTPKRAAATAAASEEDGEQAHKRARVETTTKASS"
FT   CDS_pept        complement(131156..131833)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25888"
FT                   /db_xref="GeneDB:LMXM.36.0480"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG5"
FT                   /protein_id="CBZ25888.1"
FT                   /translation="MLRKTNLFLFAASRALMSGGSSHGPMPYQDKVYSVQPHNLNELQQ
FT                   PPDSWRKSPIMSKLMDQSLPVYDDVVTGVGRLYWQEPARVWHLFEADDTLMLEEHDREE
FT                   WNDRPYVAVNHLYEPPIGSEERPIRVEGTGNPGDQQIVLCFGNCAPHVPQSNYYMMMKG
FT                   YSKTKCPMCQQWFYVHNRPWLVMHPDWTDEPAADEGPAYTFAEIEAEFDRDFHEFGVYL
FT                   NAE"
FT   CDS_pept        complement(133670..134716)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25889"
FT                   /db_xref="GeneDB:LMXM.36.0490"
FT                   /db_xref="InterPro:IPR026319"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG6"
FT                   /protein_id="CBZ25889.1"
FT                   /translation="MPRPQFITCQLCGKGFGSASINIHIPQCFEKAIKRWQLNPQGPRP
FT                   VMPPLHGKPGAKERNGGSSGIAFADQPRGPGMSAIRSLKMQSMPPESVEPENMNLHPCS
FT                   KCGRTFNFDRIAYHESVCKGDQKRRVFDSSKQRCAGSEGDDAYAGGTFGAPSGARRGRT
FT                   KKLGTANTTSRYTPAPAPQTNWRQQHEEFITAIRSARRADAEAQNMWGTGPAAPSYSTS
FT                   RGLARGGLFGATSSGYGDGAGMSARFSASTKRIPPLMAKQNETIKQGIATGGRAARAKE
FT                   GGGIPAPRMGRPVGRPTPPSGRDSFSGRSDRFSSRGGGGGMGGGGGGGRVLNDNTTSVG
FT                   MLQAMGRA"
FT   CDS_pept        complement(136029..137561)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0500"
FT                   /product="putative DNAJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25890"
FT                   /db_xref="GeneDB:LMXM.36.0500"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG7"
FT                   /protein_id="CBZ25890.1"
FT                   /translation="MTQDEAPAASSSGKGNWETLKEQGNQAFKSNAFAEAIQHYSAAIE
FT                   AHPDEPVLYSNRSAAYLKRGQYQEAAHDAEKAVTMDRTFAKAYSRLHSALCNLGLFDRA
FT                   SEALKAGLKAMSTSPKATPQDMKHLRELLNGAEQASRVVPRGRQLIETGCFAEASRTLA
FT                   GPYRDFPGSSTLAFLYAEAHAPSSPDEASRVLSPFAYTHSSDPYYLYLRALVLYYRGQE
FT                   GFSSAQNILRETLQMDPDNTKARILLKRIRAVESHKDAGNVAFKNKNAKVAVDEYTQAV
FT                   ECDPTNARMNATLRSNRAAAKMDLNDYKGALLDCDYAISNGATSAKIYARRSRIQEQLE
FT                   NFDEAVRDMQQAAEEDNQFVAELRQLKARAKRAKRKDYYKILGLPQHESNQDAIKRAYK
FT                   KACLQWHPDKWAHASEEEKSHAETQFKEIGEAFGVLSDPKKKRMYDSGQMDNDVEGANM
FT                   PSGFGGGASQEDIVTVMNMMFGGGGFQTNSFPGAFESAGNGRRRPRGGPGFF"
FT   CDS_pept        complement(141009..143276)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0510"
FT                   /product="putative mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25891"
FT                   /db_xref="GOA:E9ASG8"
FT                   /db_xref="GeneDB:LMXM.36.0510"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG8"
FT                   /protein_id="CBZ25891.1"
FT                   /translation="MLSMTSSSLSAPAAEATASSLASPSNASSSRVMSDTADDPSASSS
FT                   QEEILVVPLHTILEKVTPFCSLSVPELRALVLRYDTDGVGGLTEPQWSLFCHENRHAFS
FT                   SLGEELLDFDRSGEYSVLVVKHGYEGTSNTNAPHSLTKEVIRFIESFAAGGIAGAVSKT
FT                   VIAPGDRVKIIFQVESARYFSLREALYLGAETVRKFGITGLWIGNGATMLRVVPYAAIT
FT                   YASFDFYHSKLRFMFSRSNPDGSPDEARAVTLRFISGSLAGATSTTCTYPLDLMRARFA
FT                   ARSSSGKRRFPSYSTAFKEATSKQGVLSLYGGLFPTLVGIVPYAGCSFACFETLKHYIV
FT                   KVSNLKSDKDIPTYQRLVAGGFAGLLAQSATYPLDIVRRRMQVTPRRYLSVIDALRTVY
FT                   REEGIRQGLYKGLAMNWIKGPIATATSFTVNDLVKRRTRNYYETTVVYSSRHNIVTLPE
FT                   AFLCGGVAAATAKFFSLPFDRLKILYQVGMTEKTSAKKGAQLLYQVVKQSPNMWTSGHV
FT                   TMLRVVPYGALTYCFFDMFQLLAERLMYSHVATPYTNFAAGAAAASLGTTIVYPLDLLR
FT                   TRVAVNAVPSFQSYFWLLRAMARRHGIGSLWKGCYLSMMGVGVLGGIGFALYDYLKERF
FT                   GCHTFLQYMAAGATSGLAGSVITYPLNVMKRNRQAERVVYAQLGTSSVQSLLKSPKTVA
FT                   LLYRKMPFSFTVSSLTFGISFAVNDWCRDVIAATRNDMLREMLFLPSSAVSKSVLSRGD
FT                   TA"
FT   CDS_pept        complement(144020..145354)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25892"
FT                   /db_xref="GeneDB:LMXM.36.0520"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASG9"
FT                   /protein_id="CBZ25892.1"
FT                   /translation="MENIKEEICLVANIIDRLLAANGSLRADELAPLIKRLRVAAGELS
FT                   HIDQQSQSGPVLSPFSRNGDGIEGNGGGSRQGLSKLQLSKSLTSLAATRKQIRECRTAS
FT                   ATSKKTGDSKVFVSSEISQSVCCALYNLLEGTTRLLRASHGHIFVKRGGDMFSIANVSR
FT                   KLGFPPLQVHHRCLGSADAEVLGSSIALNRNVDEVGRKSAVLIFPVHTLLSEGGHGEPI
FT                   ATIHVERREHAFFPFSESDEYTLHFASLFCGELMSRIPQINFLETFYDPSTQLIVAPFE
FT                   PYCPVVLPPIERGIVPMLGGAGKQSSEDPEYAARAVSQLTRRISARAPEILVRRESRPS
FT                   NNTKPFAPGVAHMPSLLEIKAYVENLQSCWKKNMLDNVDLLELDRGTQQDLKVARSELA
FT                   ATRRELAATADKLRLYELGAWDYKREYGAIKSELDAYMDSLERLH"
FT   CDS_pept        complement(146290..147186)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0530"
FT                   /product="protein phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25893"
FT                   /db_xref="GOA:E9ASH0"
FT                   /db_xref="GeneDB:LMXM.36.0530"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH0"
FT                   /protein_id="CBZ25893.1"
FT                   /translation="MGDMLAKPETQKFSTVFETSHLRVGCCSMQGWRKSMEDAHVAQLN
FT                   LNGNKDQAFFGVFDGHQSDEASRYCRAHMLDELLKNIAIYKDDIAKAFEVSFQEVDKQI
FT                   CKKFVSSGTTANCVYLADQKIVCANAGDSRAVLYRGGKVVPLSVDHKPSVPAEEARIVA
FT                   AGCHVENGRVNMTLAVSRALGDVDFKSCAAKSWMDQAVTACPDITVTPSRSDDEFIVMG
FT                   CDGIWDVLSNEECCDLVKTLIQNSDIDKNGHSVAVDISLVCEQVLDRCLAQSNSVKAGT
FT                   DNMTIIVVEFKPPFFKR"
FT   CDS_pept        complement(147774..148199)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0535"
FT                   /product="putative small nuclear ribonucleaoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25894"
FT                   /db_xref="GOA:E9ASH1"
FT                   /db_xref="GeneDB:LMXM.36.0535"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH1"
FT                   /protein_id="CBZ25894.1"
FT                   /translation="MADTSNAKKDIPSSLVFEALNSRVTVETVDGDLYKGTLAAFDVSR
FT                   GNIELVDVRHQAKDSTYGFYERVTVRGSKIRIVLLPPEMKAAPSLQWRRDSVQQELKKS
FT                   LKHAPVLRPVVSVPRPVRTKKAQPKNDKSKQLRRKLR"
FT   CDS_pept        149300..149932
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25895"
FT                   /db_xref="GOA:E9ASH2"
FT                   /db_xref="GeneDB:LMXM.36.0537"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH2"
FT                   /protein_id="CBZ25895.1"
FT                   /translation="MSFFDVSAISSESSSQSDNSSKVDDRIKLTYAETVVSLATAVGLV
FT                   IIVLLDLLYRSTSRHAMLLRVQRETRFDGAYILGKPEGNRARIILENGLKTHEFRIRHP
FT                   PQYSRVVPAVVSDSRDAKQDCVEMLSKVRSILSKSYGRCAELMSMRCCLACVTGALPGE
FT                   QSERFLRIYERVMFCSHRVNGDEKLVTSDDIRYMHAFYYNNVLKVLQ"
FT   CDS_pept        150634..151587
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0540"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25896"
FT                   /db_xref="GOA:E9ASH3"
FT                   /db_xref="GeneDB:LMXM.36.0540"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH3"
FT                   /protein_id="CBZ25896.1"
FT                   /translation="MAVTIKLANGNQHTVEVPDFSITVAEFKKQIAETLEIPASEQRII
FT                   MRGKVLKDDGVLSAIGMEDGNVIHVVRSKKSAAVPSTTNASSTLAASDPTSSPNVQPST
FT                   TTPAQPAPAPAAANPYAALMSNFGLPQTQQPVAGAAGFPAAGNPFASMGTGMGMGSAMG
FT                   GGVNPTPQQAMELMQNPMMQQMMQHALSNPQFMQYIMQNSPQLAGLPQDQQQAIIEMMR
FT                   NPYMMQQAMAMMGSLGGAGGVPPATSQAASTPALGAGFNPAMFAPPVPEGNPREVYREQ
FT                   LQLLRDMGFPNEEANIAALQQAQGNVQFALERLLGA"
FT   CDS_pept        152342..153277
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0550"
FT                   /product="cell division related protein kinase 2"
FT                   /product="cdc2-related kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25897"
FT                   /db_xref="GOA:E9ASH4"
FT                   /db_xref="GeneDB:LMXM.36.0550"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH4"
FT                   /protein_id="CBZ25897.1"
FT                   /translation="MSSFGRVTARSGDAGTRDSLDRYNRLDVLGEGTYGVVYRAVDKIT
FT                   GQYVALKKVRLDRTEEGIPQTALREVSILQEFDHPNIVNLLDVICSDGKLYLVFEYVEA
FT                   DLKKAIEKQEGGYSGMDLKRLIYQLLDGLYFCHRHRIIHRDLKPANILLTSGNVLKLAD
FT                   FGLARAFQVPMHTYTHEVVTLWYRAPEILLGEKHYTPAVDMWSVGCIFAELARRKVLFR
FT                   GDSEIGQLFEIFQVLGTPTDTEGSWPGVSRLPDYRDVFPKWTAKRLGQVLPELHPDAID
FT                   LLSKMLKYDPRERISAKEALQHPWFSDLRW"
FT   CDS_pept        154028..154774
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25898"
FT                   /db_xref="GeneDB:LMXM.36.0560"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH5"
FT                   /protein_id="CBZ25898.1"
FT                   /translation="MAAASYDRDAAVKVAEENYSLRKRLARVEWEEEKQRRAAEYESRF
FT                   EGAVDTSANDRMRSRNSALQDEIAGLESQLKELQMINVTDLQHEYTRLDNRRAYLLNEI
FT                   AGLRRILANQSKEVKRATRSVNSQHELRRHNNEQHASLIEDIQMFRKKRESLAEETQHL
FT                   IAKERQLMSELETLPTPGEDQEVVASRLREDNENKDHTIAQLEATLKEKQLKAGAKLAE
FT                   ANSALDIQHLREEYVRLNDQLKHSKQ"
FT   CDS_pept        155644..157884
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0570"
FT                   /product="putative Mitochondrial elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25899"
FT                   /db_xref="GOA:E9ASH6"
FT                   /db_xref="GeneDB:LMXM.36.0570"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH6"
FT                   /protein_id="CBZ25899.1"
FT                   /translation="MRRSGLAYMLRRSVPLLATPAFLENVKRMRNIGISAHIDSGKTTL
FT                   SERVLFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWKNSTINIIDT
FT                   PGHVDFTIEVERALRVLDGAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDN
FT                   ANPQRAVKQAQERLGINAVFIQLNMGTAQDFEGVVDLIEEKAVYFDGPFGETIRYEPVP
FT                   SYIKEDVVAARKELVSRLAECDEEMELIFLNDQEPTVEQIHAAIRRATIANKFVPVMVG
FT                   SAYRNKGVQLLLDAVERYLPSPVERHNSGYQVKRVKDEDGNVSNVKEGEVALMTDDEKP
FT                   LVALVFKIEETKKSGLSNYVRVYQGKMRKEHLMNIRTGKNFLPPRLVRMHADSAEVVDE
FT                   VRAGDICAIQGEVDASSGDTLMKSGPQSGSQLFSCEDMYVPPRVISASLKTKDDKQQSR
FT                   VRERMLAFMREDPTFVYYRNSETNEDIVEGMGELHLDIYVERLKREYGLHVELGKPTVN
FT                   YREIITERQEFDFVFKRQSGGAGQWAHLKGFVEPLPIDMSVEKGVKNKATTRCSNGDIR
FT                   ESLQKTVVKHLERKIFVKGELMHAPVWGVHFHLNGGAMHEVDSNDQAFKNATQELWETM
FT                   LPKLKPTLVEPFMDVEMTVPAANMTDVATEFSKREGVVTETAVDGPDAVIRGETALDTM
FT                   FGFISDLRRLTKGQGDFSMQFKEYRPMQQYKAQMRMDERNSDIGRKLFKLSD"
FT   CDS_pept        161409..162887
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0580"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25900"
FT                   /db_xref="GeneDB:LMXM.36.0580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH7"
FT                   /protein_id="CBZ25900.1"
FT                   /translation="MRRCRLQEWHHNATGTGGASQAHRGPHRMPRHDYLTDFGTHHVAM
FT                   VDELSRCVASVSNKSFECFSTSVSGTPLNSLTTSCSAVHVNHPSAYCDLQTPLCLSEGS
FT                   LTRASVIDLGGRPSRSFLQGISPCPATPCNKARRFQSYSLHPCNCGYAHRAKLVLFAVQ
FT                   ADILLSCSTKDRHMTAYHISLGVEVGRLVGHDDLILGGAVNLDDTLVATTSRDCTAILW
FT                   DLPLCKQRRSLTHPQLVHTCRFSSSGTELATACADGLCRIWTWSSSAIVNILVPSDTGF
FT                   NDALSSLAYSLGDKVLLAGGSGRNVYVWDCESFSAPGAAFQQHRSAVLTVDASRTHQDI
FT                   VMTAEEATLLVWNCATLGVLQRIDISFCYAQSPWPRGGTLTASEVSMKRITFPHELYWT
FT                   AARLMDSRFGLVLVAATSDKCLYLFDLVATHTRRSADDIQTQPTGAVLQVQPNAVSEML
FT                   SLSLRSSVSSIDSGSPSRVVFGDTCGNRYILDLS"
FT   CDS_pept        167353..168612
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0581"
FT                   /product="sec14, cytosolic factor"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25901"
FT                   /db_xref="GeneDB:LMXM.36.0581"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH8"
FT                   /protein_id="CBZ25901.1"
FT                   /translation="MGATPLTFDDAKVGMRVQDYWGCCGTLRWMGKLENDNSPNKETGK
FT                   FFGIEYNDESDNPLRSNGTWNGRKYFECGPRKGLLVKVGQVYAEINTERVAMLRERFGD
FT                   RVATWHDFELVKFCIAQRFDMEKVYEMLERHLQWRERFQPCADEYFPQAIREDYPCGYT
FT                   GTTDYDENLIYCERPGNAGRCHASEFVRKHTLPVIARWHACVIEMGIARMRPTNYRSKR
FT                   VCCIVDLLDVKAMPRSMIGFAQTLAAVKQDNYPENLGRIFIVNCPTLFCFAWKLLKIFI
FT                   DERTNKKINFCAPNKAVEAMLAVMRKEDIPNFCGGPSNKWMETANGIIGSTNPKMVYKD
FT                   EDYNLPKMTGEELNEMQLRADSESPLRSLRGGEAPTTTRSIGPATVPASFTPTSSPKLP
FT                   VEPKTTSKAQSSSDAASDNK"
FT   CDS_pept        171098..171742
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25902"
FT                   /db_xref="GOA:E9ASH9"
FT                   /db_xref="GeneDB:LMXM.36.0590"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASH9"
FT                   /protein_id="CBZ25902.1"
FT                   /translation="MSATHALRDKWFVSFLPLLTADMVNTDYKGNWQLAAQERTQKLDW
FT                   ITSVEELWSTMNSLPKVHQLGMGSTLIFARNNKEPPSYEAYPNGSRIMINLLKPPTTDA
FT                   GLELVLAVVMGETAAEKASDGKPVCDVLRIAARPSREHSEQIRVEVWLSDSTRSHAVAE
FT                   FLAEAMKEKGLAANSYNIAEASFDAAAPSKDKKVLTASTMLSPSSPPMVKD"
FT   CDS_pept        173922..174380
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0600"
FT                   /product="putative ubiquitin/ribosomal protein S27a"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25903"
FT                   /db_xref="GOA:E9ASI0"
FT                   /db_xref="GeneDB:LMXM.36.0600"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI0"
FT                   /protein_id="CBZ25903.1"
FT                   /translation="MQIFVKNAAGRSVAVRVSAEDTVASLKAQANVTQGNLFFAGMCLA
FT                   EEETLAAYGLSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVT
FT                   ENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLTYKAESK"
FT   CDS_pept        175546..176328
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0610"
FT                   /product="DNAJ protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25904"
FT                   /db_xref="GeneDB:LMXM.36.0610"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI1"
FT                   /protein_id="CBZ25904.1"
FT                   /translation="MTKFNQNSTSSNASVLDDLFSSINASAPSSAAGASAPFMYFSSTG
FT                   SATKNVTPTAAAATASSVLNDLFSGPDVASSERSDKYGSAGETHAMIYVDGNSGRVEDG
FT                   VNNLFDLSRPVKKDKYNNAESLLEAFERQGKKSGSGGGRPDERETLANLTRNKDDNKVR
FT                   ARLLPLMNYYDVLGVAPTASEEEIKRSYKKKALQLHPDRAGRDQTQEEAELFKVITKAN
FT                   EVLTDAEQRRMYDASLASGAVQPAMAPSAADWWSHMQS"
FT   CDS_pept        178497..178718
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25905"
FT                   /db_xref="GOA:E9ASI2"
FT                   /db_xref="GeneDB:LMXM.36.0620"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI2"
FT                   /protein_id="CBZ25905.1"
FT                   /translation="MFRRSLIALNWRDQGISYVKYLNVTTEALHMATKEKVRAKYSRFS
FT                   APNYVAVKNDGTGVMEEVKKVPAFTKDY"
FT   CDS_pept        180385..180951
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25906"
FT                   /db_xref="GOA:E9ASI3"
FT                   /db_xref="GeneDB:LMXM.36.0630"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI3"
FT                   /protein_id="CBZ25906.1"
FT                   /translation="MPWYLSTFRVGFCAIYAYFGYVQVRWLLETEDRYRRSSTWKPAVG
FT                   TIFDHKVVMTRGGSSYVQYKFNVDGVEYIGDRFRSGGIHKEEMVSNPTLLGAGTQLVVY
FT                   YNPADPSESAIKLQADRGAESVFVIGSLLSFLIAFRAVRCETILPNMFYRFLGVNRRVG
FT                   GISGLRQARPHAKQRMKYGKHSGSL"
FT   CDS_pept        181807..182757
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0640"
FT                   /product="putative ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25907"
FT                   /db_xref="GOA:E9ASI4"
FT                   /db_xref="GeneDB:LMXM.36.0640"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI4"
FT                   /protein_id="CBZ25907.1"
FT                   /translation="MTDTPSARRARPSARLSGTKRQRESLIEFSVQDIMESLGVSADYL
FT                   VLGIDEAGRGSVIGPMVYTGAVISLGEHDELVRLCHVADRKMPNVRPRLASLQKLRQLK
FT                   TFRSFTVFVSSEEISNTMAGHNGRNLNALSHETAIQIISEATLASAGKLCAAYVDTVGP
FT                   PGTYQARLAGRFPHLRVTVAKKAESKFPIVSAASVVAKTARDAAIEALGENIGSGYLID
FT                   PRTMAWLRSPVHRCFAFSHAYDSVRQSWGPVVQLANDSAVCVPVVFEQDPEEASQQGGG
FT                   GDNRQQNLSIAKPPPKRHTVYTHFLKLRYPTNLVE"
FT   CDS_pept        184120..185604
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25908"
FT                   /db_xref="GOA:E9ASI5"
FT                   /db_xref="GeneDB:LMXM.36.0650"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI5"
FT                   /protein_id="CBZ25908.1"
FT                   /translation="MATATSARVAELPPVRTSVERLLLNPFVVFLVTFAIRATLFTFRD
FT                   SVEPYIAFSVIPRPSLEDIVGKAATGAWHDAAQSAYVSGGGRQAERLMTPPPVHFSMSI
FT                   SMTEASTWREVVYWRESGFAEVAPYYLQELALWYVRFIPAVLAKPPVTGLVLSAMDGLT
FT                   AALVSRWSSASAALLYAFFVLNPIMILTTTSESLTSFELLLLTVTVDLCARRAKSALAY
FT                   TGALVGAFTLGSHFIAVPVILLAPLGTQSYRIAFAVAAALAAGVGAYAVLYLYSTEVSH
FT                   RFASLYAPPDNGVMWYVRQLVLPSFERCLEVFMLQLAPMLLIPAAVAFPVGYLRQPLSS
FT                   TAHPHLFTDGRVFLLLMAEGLSVLFRNQLTLPYCFLIILHFYSSLNPTASKKVTLEDQR
FT                   VVTYSPYMRVRLLVPIVIQLTSIPLEASFYAGWVLRETANANWKFFSDVAFMLGATAFF
FT                   VLWYAEVVEDAVLCENDAGADAVTCSASPFKTTKRD"
FT   CDS_pept        190095..190700
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25909"
FT                   /db_xref="GeneDB:LMXM.36.0660"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI6"
FT                   /protein_id="CBZ25909.1"
FT                   /translation="MPGLGKSVYHVLFHLSRYFCAAVVAALLLLALSGGSLAGTRIRVD
FT                   SNSGGAKSDTTWTVRTTTPPTAAAPGSLQEACHTEMKLYCSDHPISPLRCLVEQYYHTT
FT                   KNNGEEPRRRTSALYSDVCGSWLAAREACLGFVHQRGRELCGNSVGEVRECLRQIPPLV
FT                   LPHACVTSAYYESVRLVGKLRQHQNEDARLRLLRKKLP"
FT   CDS_pept        195133..196524
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25910"
FT                   /db_xref="GOA:E9ASI7"
FT                   /db_xref="GeneDB:LMXM.36.0670"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI7"
FT                   /protein_id="CBZ25910.1"
FT                   /translation="MVDGLSSALFTVLAIFFLFAGTVQTLSLKWADTIEASDGFTGPTS
FT                   GQGGSHAVNFRLLYSFAHPFTQAFFMFCAETCCLVLLVCMLVWKKYVAPRLHNSREDTG
FT                   AAPTGELVAGEDYALPCSPSLWLLPSGADFLASIVQNVGLMLTYASVYQILCGSTVVWI
FT                   ALISYFWLGYRFTKVELWGMGCVALGVFLVGLSNLLERGIDFESTSHGRHKNQVLGNLL
FT                   VLMAQILHAYQGVCEERLIRLYKVPSLQMVGTEGIYGIGLSLSLLAFLQLVPMATWGHN
FT                   LVAVEEFLGSGELGVLHANVTWVRQLQPALKVPYDDVVLAFAQIRESWECKVFIFVYIL
FT                   SGFFYNACHMSVIKHVSATATVMIGSLRNVTVWLVCLLIPSVFEEHFNVVQFIGFVFLV
FT                   LGNVLFHRILITRFDAILPAQMIDACPVLFRDAQKAREGVAKVENRSRDISLEPQPREL
FT                   RSKED"
FT   CDS_pept        198858..201728
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25911"
FT                   /db_xref="GeneDB:LMXM.36.0680"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI8"
FT                   /protein_id="CBZ25911.1"
FT                   /translation="MFADLLATTSCHAGDRSSDVVVSPVSPPFSPRCTSASSSAGSSSG
FT                   CRRRPLSDDGDGGSYPRVSPFVGTAYPSAHPDGRARRPGFSECLSPLSIPEGCASSTTA
FT                   MVSSSSSHPEGHSLSLGGTSEPPPRESSGDTPGNTLEGYIPTSDSFSSHRGDSARPPPS
FT                   STPTLSLYDHGQQASEVASSTPSRGATALLPEDGASPALDSVESSANGAGFVVMRSGTR
FT                   EGGQQSPQLFSSSKSSPPSSMPCAPPLGQPTAGAVVVEKYAPALQTPASPLRFSVLYTE
FT                   EEHRVRLETRETEERRCLYQAHKAVLSVYHMWTAAGADADYGDGDRLLLTSSRMGDGAS
FT                   TRFLEDNCYPKAPNTPNAQAAGSRAQPSALATATAANAVATERVRSFLKSSIDSARGRR
FT                   CVGAGQEGDAAICVLPHRSTTIRITYADSDAEALRGSPGHGPHPQASHSSSPAASRMLD
FT                   YSSVHMPGAASSLMHTSSEPPSLVHQARLFSPWRATRTDQHDAAVRRAVGKPDVHLEPR
FT                   TARDDSRGLPQRRPRTSLVPHLVSTSPAAVHLSSASHSLGASSAALRRRGLLEPRLSAD
FT                   TAAPREDLPRSAVLPAARAAAAARAPSPSLRAVLSAGVGSFSSPSAAQRVGGPDASRGT
FT                   SSRAWNGSVNLVSTSAASRRISPFAGDDTTNDHVAGGSVVYASNESFRLRQRAALSGTS
FT                   SGELLSSPLHGIDTDRRTLLAVNRLKDHRRERLSSYVHYKRFFDAVYGEQSASPLASRE
FT                   LDGRHSSAGRTSPAPSRTVRTRPSMSFDVGDGDKHARAWPWRSSLSSSLYPRARSPELV
FT                   ARRDLRPFSPRGSTAATRSAASPSKVPTTFCARLTGAAASLIVPTDTTLFAARLTRLST
FT                   LEKLCRAELQRRCMEDQSLLLHHFIVEGTATLQRGGRATAPLHRHRQRAAGRHNGGVPN
FT                   ALGVDLHSERRGWAVSSSQPLAGIHF"
FT   CDS_pept        202554..203360
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25912"
FT                   /db_xref="GeneDB:LMXM.36.0690"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASI9"
FT                   /protein_id="CBZ25912.1"
FT                   /translation="MRHCRRLFAGSGNNTTASSSGPIVSLREATRLAKIAGCFDSATGS
FT                   SSSLLRRCTDPVCTQNRNVASSSSSWEVIKRRQHQVFNERHLTAENTIAVTVSCVNMAH
FT                   LSVYVRSVQCGCPVSHAPGPSGEGAPGKRTIATATLTNQSCAVLLLWVSMGSPELLAVR
FT                   CALSPGAVDTCWRAAPAAASSDTTKTGGTSQSAAPSSMLSEKDKLRRIKAWAEELVLHR
FT                   WVVVTGQLRMEDVYDGDLQKVVTVPVLEVARDNFKGSVRTLPPEFL"
FT   CDS_pept        204116..204805
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0700"
FT                   /product="putative MP18 RNA editing complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25913"
FT                   /db_xref="GOA:E9ASJ0"
FT                   /db_xref="GeneDB:LMXM.36.0700"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017084"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ0"
FT                   /protein_id="CBZ25913.1"
FT                   /translation="MFRRISSAAATRPMATMAHPLTSAVQFQSVTSTHAAVSCIAMRGC
FT                   SSTSGTSSGDVSSTKGAAFSASRLGQRAPSINCVTLVGVVHDIQTGYVFEDAVTQFTLT
FT                   TTSLDAANQAQECVVEKDHHTVRCYGDVFSREVRAKLSEGNVVCVNGRLRLNPQMEPSC
FT                   NKYYYFPYIQVQPPHGQVSVVYGDRRSPPSPVNVAAGELNNGNGNSTNSGGPAENGDAS
FT                   VKTQRTP"
FT   CDS_pept        207133..207912
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25914"
FT                   /db_xref="GeneDB:LMXM.36.0710"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ1"
FT                   /protein_id="CBZ25914.1"
FT                   /translation="MGTDKVLSEKLVLEKTKVKSLSDVQRLDMWGEGLTDISLIAKLPR
FT                   LEVLALAANNVSSLKALQGCEMLQELYLRKNKVANLREVTTLRALPTLSVLWLRDNPCT
FT                   QHPYYREFVLHCCPGLRQLDGVEITAEERKAAAKRLTTKALDEILGRSASADAASSPRP
FT                   KKSTGAGSSPAKATEATPSSTPGGASDSTATIEERNASGRTVLFTTVAAQRAMLLSIVS
FT                   LLSELTVESLELLQREVQERVEKQKEKLAKYVQENSQ"
FT   CDS_pept        210499..211875
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0720"
FT                   /product="putative protein kinase"
FT                   /product="putative mitogen-activated protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25915"
FT                   /db_xref="GOA:E9ASJ2"
FT                   /db_xref="GeneDB:LMXM.36.0720"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ2"
FT                   /protein_id="CBZ25915.1"
FT                   /translation="MSAEIESHILKKYEIQTQLGQGAYGIVWRALERKHNRVVALKKIY
FT                   DAFQNSTDAQRTFREIMFLHRLHHPNIIRLLHVHRAFNDRDIYLVFEYMETDLHVVIRA
FT                   NILEGIHKQFIIYQLLKTMKFLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSL
FT                   EGEQASRPVLTDYIATRWYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPMFPGRST
FT                   TNQLELICSVTGMPSAADVAATNSQFANAMLRDIHCAHRRTFAELLPSASADALNLIER
FT                   LMCFNPNRRLSAAEALEHPYVAAFHRPDDEPVAPEPITVSLPDSQRLPLAKYRDAIYEQ
FT                   IASLRRISTSTDHRHRAERHGAGGTASRKTSASGGGGAAGGSRGGTGTSGATRPATSCS
FT                   SSTAARAAPQRSVVKPTSTSGVNESSSSKAYGRPGFRSVASTSSGLESRPVEREAAVRK
FT                   "
FT   CDS_pept        221047..222408
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25916"
FT                   /db_xref="GOA:E9ASJ3"
FT                   /db_xref="GeneDB:LMXM.36.0730"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ3"
FT                   /protein_id="CBZ25916.1"
FT                   /translation="MCTKLNRVQRTKTKPENDAELCESFLKGHCDSGNGCQYVHVPKQY
FT                   LWRLLSPHVDPKTLFYYPGFNIRCYTPDMNVYYDIPSEFIYQTKGSDRYVELFNDNGDN
FT                   FKDKCRLCPSLQSHGMCDNNEQCDDIHCAVADLDQFPHIATHRATREAVARYEHMPPEL
FT                   IVRVYQPNTPGDGMDFNGDDVLRTAGATQYEDAYEQTGGIPALKMQHCAHFQTKKLCRM
FT                   GDGCRFLHVVSVALASPAPDEEASMRSSPAPATTTACATSAPSAATPTPTAAKTPTATA
FT                   MIVTMTAGRQLREEDVVMNAAAEMAAIAMAAEEPRYTGSHVDSTVPHDSRNGHPHKYGT
FT                   QAVVPQQLQPHQQPQLYPPPQQPNSIYPYGPVSMGSMKERVSPVQYRSSGRLSPIKVVV
FT                   TPGQMEGAPAQRLSPISLPSGGSSGTPTQQPHSRTSPLRRNNPYSLSPSSTSLN"
FT   gap             228891..228990
FT                   /estimated_length=unknown
FT   CDS_pept        234522..236144
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0740"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25917"
FT                   /db_xref="GOA:E9ASJ4"
FT                   /db_xref="GeneDB:LMXM.36.0740"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ4"
FT                   /protein_id="CBZ25917.1"
FT                   /translation="MFPMDIANSGNQQMVYRNNQPPQQRQQHQMPQHHLQQQHHQIPQQ
FT                   QMFPSQYGYQQQQPYLAYPSTASPSAGKGAMDFIPSQQYMPQQQMFPYGYTQQHQSPLN
FT                   QQFFPSVMAPQTQPPPPPLRYNQQGNSNTTNQYMGGHVGGHPRYHGGRGRGGMHSGYGG
FT                   QFHRQVHNNYFYNQQHHYSSNNAVPEKTPTVHLIHPETKKIISIKLNRIYSTMADIRPQ
FT                   FQHQQSHSNGASASNVASVVEDSKSEKASANERPKEKSDSSPAPKFDPKTTKLVLCLSF
FT                   LSPKGCMHGSGCDKVHIAGLEYTWPQVEAKEVKKEGKKAYSAGFFVHCYDPTLTRYYKV
FT                   PSGSVYVTKGSADYVNMFNDHGDNFKMKFKLCAPTLEGAECEKGEECEDIHCSVADLEA
FT                   VRENSANATHINNIEAMADVPRLPADMTVRVFNQNSFDTWRDYPGGNLLITEGAKAYQK
FT                   QYEQEMNSVPTRKRMQHCAHFRLKDMCRLGESCRFLHVLPTEQELKERKDAEAAEAAAK
FT                   TMEEATGEGNMKADERGAGAKIE"
FT   CDS_pept        252660..256517
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0750"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25918"
FT                   /db_xref="GOA:E9ASJ5"
FT                   /db_xref="GeneDB:LMXM.36.0750"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ5"
FT                   /protein_id="CBZ25918.1"
FT                   /translation="MSAISPSVTPVTLRSVSGKSLLLTPPVTLATVLEVATAPPFSFAP
FT                   ESVKVILHGRIVRLLQYQQQHGSDLFKLPLDASAYTPPRTTAKCANSVVLASSSSSGAE
FT                   FKAEPRSVIVYGVPQRIRATASAPRSGAQEPVALSTPFAEASGKSLPLSTPPRAGQQEC
FT                   SDSTCTTVAATPTTAKVSRRASLVRLPINSPTTHVAAIKGPLPYPHSPDGLHELGKICA
FT                   EFDSDDDEDLITLLQGAPPSIYNHPTVLYMSNKVKGDLVILQAAMEQIARVSPVFFDWI
FT                   VENPQRFLSALNRGGERSLQQVKDQLRMLAMRAMADQMSGETPSRHVMMLEVNTRDGSP
FT                   DVYQVEVQVGDFSDASTPSDSLTANSLADNNSAEEEREDGEDSVNTGDELEENDTAASS
FT                   IDASAKDGGVAGGTEEEEEEDERHRGAILLSSTPAPHEDPLASHPPSDAVPSPDRAVTG
FT                   AMLSNEGSVTTAEERTSAEERELSLTPSTPADAVARRSFPPLPSTSSTAARSASLNVAA
FT                   SLATPAVSPHEDIDAEDVLLSGLRKELQHVHSLTQQWVHQATGDAAHRTHTAIMKLRRD
FT                   LFTVLNDLITTSSTPASLLRSFGDVRRLALLACDFFSAAEEFYVQLDEQGVRSSVFGET
FT                   PQDSVAAWAVVAALSRLLVCDVDAAVERQLQQGAPGLSRVGALRSLQHINSIRENPALR
FT                   WTTAEGPEELLMALLQLCRQQRAVVLWYSSHYVLKEVGKTIQTMAYILGGRGEAQQTVT
FT                   VQRLKVTSKAHKQDEVADCITTLSDARAETDTLSYAVRCQWFSLMRSRYQRLVLPIEKD
FT                   LPLPHMTSDPLYVCDTRHVLPPKGSGARPETLRGTMDSAARWWAGYCDDRHTCCADKWC
FT                   LALTERLWNVVTAMENATAEATAENVALVLTCDGTEASSTNSLSLEAAARDWLGDITWI
FT                   PVDKVVVPSAATASTTVSRSVARHSAVLFEQVCPPAEAKDETAAADHPSSVAGVHGMPP
FT                   LFSGDVHMVDVAAMAPGHRPVLELACGAALPTYLATVVRNFVLPASARERIFLRHLFGM
FT                   FAKYPRIPVAAAVRDAALANARCQDSPWLVSEYVLYDYGGALSTFANADAKADTTAAVG
FT                   AAGTAKPASSTTAAALPSPMTNPSTECVSDNFVRMPSVPLSKRLSMPRPLPPTQRRPVR
FT                   ATLRSQLARAQAAAGEMEKRQYARSHAVDELYEMMLGSLLEHRPTGEADVLDHLVHYVE
FT                   SSQDAMRDRVYERQAEAAAAAAQKVAHSTKPSHSAVGGGSGCTKPQPPGGKPNTFARRR
FT                   Q"
FT   CDS_pept        260441..263008
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0760"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25919"
FT                   /db_xref="GeneDB:LMXM.36.0760"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ6"
FT                   /protein_id="CBZ25919.1"
FT                   /translation="MTRSSTLNRPVLLTKDASRAHPGAAYDTSSGARAATAAGARSYAL
FT                   PSPSVSSGDLCDTKGASSGEARAGPAAGTVQSVYLSRPSPPTPPPRPAGHRRSRRNSLI
FT                   SVKTNSSASFVHHEQNVSQDEEATATLHFFSAMLDLPVAEEEAEKEPWCSSLDEDLTMG
FT                   TSSSVLGGTGNIPFTGQSSGSEAAATPVCEARKGGSDGGGTRAHSHDAMDFAGPPPSPY
FT                   TSKASVHEAGTAGVVARLKERGNAFFLREEFELAIATYTEAIRLDPTHEALWGNRACAF
FT                   LLSFRYLPAVADCLYVLHIHPGHTKACWRAAKAYAAAYRLVEAKKYYQLAQQACERDGM
FT                   GRGSASTTRRTASSSSIRTDRGGDEAPDDSLARGAAESSSPAAAGTFCEHDSRLLKSQR
FT                   ERQVLATEEAALGMVETYWQHLRHERWADALATMDKVLSLASYTGPTAVSWQALRIEAL
FT                   LHLHPKKALSEAEALYRAYPDSLELYPVLAKAIFYDVHDAAATKRCLRLLDEAAEKRCG
FT                   HNHLLKVHVRYCATQLRERLPADTGKTTAVHMEAWGKLHYLREDSRTAELRHTIEKFAR
FT                   HRDAGNAAYEAGDWEAAASAYTRCLETDRLNHALLAAVYCNRTAVYMQAGRWRDALGDA
FT                   DSAVALCPQYATAYARRGRVKLYLLAQEYRRQRAVLASSCAAPWSAAMKERLQGYADAA
FT                   VTDLTRAVELSPTIEHKTQLQQALAQRRAIKASLKPTCETPKSSMPFSAASASQGERHR
FT                   GQSAHSPPPHADARRAESAAVCELTDQLKLLGLSILAPSAPGEFGRLPEPKVIAKAYRE
FT                   AALRWHPDKWITATPHEKQQAEQQFKSICVAYQALRERSGVVF"
FT   CDS_pept        264638..265951
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0770"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25920"
FT                   /db_xref="GeneDB:LMXM.36.0770"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ7"
FT                   /protein_id="CBZ25920.1"
FT                   /translation="MATDLDCFSTYIDHLILLLAARFHAPLDVSVEDLLPSSVNLSAKA
FT                   QCPWELVARSVQQALRTPQTAQERLLMRHLDVHHFSASMCRERARYMQWKLQECRRRRG
FT                   DKQQLLQSPAVPSEARATASSTDATSATAAVQPRDVKCTSLHNDVSSIYKLVHQSLPCT
FT                   LGDSESDDDSEDAQAPTGSVQSVASASEPSAFERVHEVFMRTPAEQERDELVARARDEF
FT                   LSQVQALQSVYYDKYHRWMDAPASVLDPPPASSKQPARTNGAAAAFESAAPQRDSESER
FT                   AALLEALGAAAPPPPCPRTQANYINGSGATHRTEKPHTLASMLRQVQLQRPLRPSAVPD
FT                   DVLESMYRARAESEEATKNLCIASGLRSSPPAASTSVTPSFAGGSADTIVAKVVAVAPS
FT                   LSQPSSSAEAVRKDTAPPASRRRRWQIVEYDDDDDGEG"
FT   CDS_pept        267881..271096
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0780"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0780"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25921"
FT                   /db_xref="GOA:E9ASJ8"
FT                   /db_xref="GeneDB:LMXM.36.0780"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ8"
FT                   /protein_id="CBZ25921.1"
FT                   /translation="MSTLSLAPPSPPTPVICGADSGDGDGAQRRVQQQRVLQQRKEEVA
FT                   RLEATLARERVDNVNSLNTLRASLQREHLLRTTAEKGRQAAQAEGRHLRTALRALLAQI
FT                   PNNSSTGSLSSTVPVCLYEEARRLLLRCERTFAELKALQLRSTDPAGLEVLRRYDIPVL
FT                   DEIPPAWPPGTPQRSGKEEEVHAAGVTRADGGPNSTTAAREKAASGTTLFPMEETLTGL
FT                   EISELTTLSPDTPCSPSPATRQVRAVTAACEASEKWCEKGHGPPAHTSSNGMAKSDVGG
FT                   ETLSPDGRRRSRPALLSPPLPSSETSAAKVVQPWMGPMHKFAGSKLLLAATPSQELHAE
FT                   HHTQLSELGREDTICDMDHLLRSLAEEIATLATSQGLRTASEVAALCRRCGLHYVDAAF
FT                   LPVPETLGFNRSGACCGYDADRRTSFVVEWRPRDAVVPRGRKAELLTSAGIDPDSLRCG
FT                   LLGDIGVVAALAALAESAGAVMSVLASTTGEDEDNGVYVVWLCVHGWWTRVTVDAYLPC
FT                   VIEENRPVDLYGCSSTTTYDLWAPVCEKALAKVLCGYHPLCSLSAETAIGNFTGGPVEC
FT                   WDWWHRRSNTALEEMEAALNTNARGAGIVLLSTFSTAALRDTSTRSVAGAGAHAAYQRL
FT                   GLRPGTPYRVLAVADTAEGEPMVLLRNWTRRCEQRESDQACCLFDRDPAVGGGDRRNIS
FT                   PRRDSNDGTAAAKGWLTRPLSQSSPASSQCDSCVWLSYTKEVLPYFDGCHVCFDCRRYH
FT                   DLRVPIAFSGSQPAIPAQLVRVRVQEGLARPPHGVTRCPTRLWIGLHQPFSSVDTSDAA
FT                   PASFPWGLKMTLVGQEEAPAPFGESGGCARPARRSYILSESFLGEPKELPAVWMYLELE
FT                   PVTNSAPHLVTDLKHEDAAAVTTTTEFFVVPQMEWIVRKDRAHTGHDDDGLGSLGCDVP
FT                   SVQHWRGVGQASQRRHFGKSAAPHSGQSGCSGDAERAVWYQGSHHHPTSIAEHSFDNAT
FT                   TAIVAVLAERRESVLVDVVDAPEELRAAMYHDVLDRIDFSDCTGSGGSGQRHTSHLSQR
FT                   SAAKVPGEVRCQVNGRCLPTFSW"
FT   CDS_pept        275125..276807
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0790"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0790"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25922"
FT                   /db_xref="GeneDB:LMXM.36.0790"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASJ9"
FT                   /protein_id="CBZ25922.1"
FT                   /translation="MERDKPPPALRFARQWTLPSSAASDAGFPTLDYPSRHTESPSPIS
FT                   RSQVPLTPSPDRPGRRQQRDGSLAPDSPSPLPPSELSALTSGGAGHHADASPQQTSCPA
FT                   PAASSARNVAAQCVQRVMSASDADGKSFWRRQAQRLEATCTALEEELRTVYRCLGKDAD
FT                   GIPRVLEASSHTSLMAVGSVNPTYEKVVQERDVARLELAREREKNFLLRHRLREMDAEV
FT                   HRLQSRHARDEGKQRVGDASKRTFPSSNSVSNVGVLSRHRRTSSRCCSSSRSSAQFTRD
FT                   MWRSPTYRRSRSITRPYTSSSARREESPRRTSVSVTTSCVHYSDDSMVTLSSAASRSPL
FT                   ARRESGRRAANTPAAAPAAFRRPHRGSTQSPLKPSRHAADAYEAEARDLLTWLLSARSS
FT                   SSSPSRCQPSAWRKGGAGSRGPEPVCHSNLASPSRRVFHTGLFSAAVAVSEGEEEGGRL
FT                   ARGTARGAARACPAIRDSRLLSPIPPQQERDAVDGEKARDHPTGAVRSFSAMPLGMRAT
FT                   RSSTDPSGNALFSKVTPTAHAGDGEWVAWQPHVLAPRPQSGGA"
FT   CDS_pept        277678..279357
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0800"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25923"
FT                   /db_xref="GOA:E9ASK0"
FT                   /db_xref="GeneDB:LMXM.36.0800"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK0"
FT                   /protein_id="CBZ25923.1"
FT                   /translation="MSSSSSALDVPLVEVICSYPTREVLCAECPALLLLVYQHVVAELQ
FT                   AGRRAVDVFRGTSRQDHLSELLAVRSLSKLFERLYPLSQSCSLDESTAGSQFWGQVRVT
FT                   LEAAWAPPHDAKARALLTQVRGQPRFHFCGPHDAETPGEGYPLHPVSLERALAASKRFL
FT                   RTAMTCALDGSTDALAGRQPELRAVLQLAHLVPDTPSTGAPPKKGVTPEGISFCMVSLQ
FT                   QRWWVLVNAALERVLLLTRAVVNRNGSTSASSGVTKPLLWQLLAVLSVLDTAHYVFAFP
FT                   EREQDLAAHHLLARLSEVGLVYPLLSNDRKCFVLSPDFLHAIHWHASAPLSLTFNHHLV
FT                   RSVSGAGVGDIRREDTDTIITETNFRLYAYTDDADLLNILNQFAELEEIVNGNLHCYRV
FT                   TRDSFAAAMRKGITAAQVLRFLSLRAHPSMLRRHGEREESGDTAAPSSAGGVSSSLTFS
FT                   APHRRGAVPGTCGGTTAIDAVSTIVVPQSFCDQMRMWESECHRVVFEHHVVLLRHMSME
FT                   QQKAVTAYLADAGEVDAIVHAERGYMVIREEVFERLVAPLLG"
FT   CDS_pept        280207..281586
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0810"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25924"
FT                   /db_xref="GeneDB:LMXM.36.0810"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK1"
FT                   /protein_id="CBZ25924.1"
FT                   /translation="MMRRGAPEWFTQGKARERFHRYWPWALSSICAGLYLYNGEPFEDA
FT                   AGAIVTKIRRPLLKTMEWVELHDVDPETMSLELPPDMLFGPLEFPKQMRFLLAALMADN
FT                   ELADGYLARVIIDRMDLSLDPPILSEGDFLAAGGKELLDFSVEDFTGTKSRAKRKHIFF
FT                   QPDQFLQLINIIAAYPSLTEYFVNEKDGVELVFQAYRHSKNPYARVMAMRSLTLFSFTQ
FT                   AIDGTVERRILQSNGVKTIVDAYKQSTGDPTETRFPTLLLSSIMRHYPKEGGKEFIDAD
FT                   GVEAVVNNLNIARYKGIPQHIRVLHDAQRLPKQSIGKKSVDARLEEADFLGVAMGLLDT
FT                   FPEFYEATGDLLKLLTSVAPAHAGPLELLEYRAMPILSKYYVKWCEDQSFQTDGTRTLV
FT                   AKLFELMLNDKMCQRCYDPSVASYELLECLKTAKLAVKDEQEKRVTRFPDPQQQPASAA
FT                   A"
FT   CDS_pept        282617..283522
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0820"
FT                   /product="ADP-ribosylation factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0820"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25925"
FT                   /db_xref="GOA:E9ASK2"
FT                   /db_xref="GeneDB:LMXM.36.0820"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK2"
FT                   /protein_id="CBZ25925.1"
FT                   /translation="MSKDDASIAYAKRHNIHHLFELMATKVLLNRPENPFAYLRNLLKD
FT                   VEESEKNRVPYDPTQVHFNNDVSAAAPPAGDSGGSGAAAPAATPTSAKKEKRTVTLATF
FT                   GLDQAGKTCALSVLESGEADTKYTPTIGFSPIKFPLDDYNLCVFDLGGAANFRGIWVHY
FT                   YHDCFGIVYVIDSAASDERVAESLKVLHETLQHPYVKGKPLLVLANKKDLPESRGVGVV
FT                   PQGFLEEAMGEPTAPHRVLATCAIEDDPTLVEGIEWLLEVVSKEYDALVKRVAKDSDEV
FT                   KNEKARQRAARLAEIRGENK"
FT   CDS_pept        286229..292036
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0830"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25926"
FT                   /db_xref="GeneDB:LMXM.36.0830"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK3"
FT                   /protein_id="CBZ25926.1"
FT                   /translation="MPTSSQASASSRRASTTKPGPPPRASSTAPPLPARFQSHAQAKLS
FT                   SATTSRRGSGIPELIGTRRDSSIGATSTNPRLRGGSVIDAAAAQRSSSAPRNAIDFASK
FT                   ESQEALNRLRRLFLPVMMRVILRSRRRSRWKDGQPPRQYTPESVVAAIMRTKSLLADCP
FT                   QRMVESLAAGATFMSLTPKEIIVYANESHVSCGIVVLLYGQLEERRPEPGGKKPKTDDG
FT                   GSTRPICTQPHRLHKAMNVLCLMPVMCEDRATSFLATRESEEADVAIISSRWFWEVTYS
FT                   MTQASPTTADVMGRMLREVVLPHRRDLLLVDYFPTSVVLLRSWMWSMLTASDRVKLSRS
FT                   MEVRVLSVGDVLFDEGDYCPYIYVVRRGALHAIVKGETLAVLEAGTAVGEESVLFHDRR
FT                   NCRVVAVTVCEIYALHAHHLLRRFLKYPENARRIMAAAVERQVWWMEEGRTRDVFGLVS
FT                   ILSGVPCLGHTTDAMREEIAQCASVLILPQGHTLVSTNTPCTFFCVIGRGSVTLISSVK
FT                   AAPVAETPSSANGIDRKGESQPSMRRSSGVKQMGTPPTEMRRESRSAGDFFGELCLKPH
FT                   LWPYDVVCDSTVSLWQFDREAVLRVLERNRADAQALEVSRQGIGLYRTQRGETSIIDGF
FT                   EPPATPNASTNGWRSYIGGQRSRAQSTDFSTAPPGARSSSAGSRSGRRLSLSHVAAPEW
FT                   FSRGSPSEGLTPRGGRHAGVDWTPEQWTTYAMTRLQDGLRAEDAKEIPPAPSRELRGVD
FT                   KEVEKTMNEKVLQLVAVQPETPPNPADCDISGDSSELQSIIVGQLFLIVTEKQSRFLRQ
FT                   VNDSNVRLITEDADTQLVGELNDSLGDMSAMDAMHNSEALVEVTEVVQLEDISASPLEG
FT                   SRFLPQRAMPSLSVRDSTDVTDYVNVHRVDDGLSVEANGGAQAGWLLPNTSISRTRRST
FT                   SVGALGEASGVFGGSWNPRSSLNRSHFLRPSSAVPPSPRCASGRDDLLSPGAIGVMRPA
FT                   SSSEPRVMPPMRTRPASVDFNQFNNRLSVDRSTSMLDRYVKIEDQNYFDNFVKVLPLQR
FT                   DEMWAPDGVSTDSEMGTSSMVLLLLHVRKCDYLSAEVMQRCARPMVKVTLGERVLVRTS
FT                   VMKNCTAPRWPIEHSSFISFVRRGTDIVFSVCDADDESRIVYQASFSTASIHENGGVEQ
FT                   RAMSLTELSVTGSPVNAEMDADVTSTESSGRIQKSARKPRLAMTMLAVTANKYKALRQY
FT                   LETKEKVIVDPPGTPESTKLFLQVLSVEGLKHRIEAFVTASLYNGETSTTVLKTERVIP
FT                   KTRSPAWPGETSFVIISGEGGILSFDLHHKEAVIGSTETAVDELIFGGVGLRRLPLLQA
FT                   QTGRVVIGHLVVGVLGARLGDSVESRNRDWVTHLAVEQLSLAREGFSINPDPFIVLRSG
FT                   TGAELMRTPLAFSAFEASWSMAEASCLLQCPRLCGSTVSYQLEVCDSDEKEVIGRATIL
FT                   LSDRGLGRDHLHDVSLNPPGRGVVRLRSFCLPVLELPVRGAADKASAAAALCPPFASQL
FT                   HLSESATLLLLHMSGCANLPGGATVELQIDAIGTLSIDAQPYLRTAVQEATTALQWPLS
FT                   KASVLLRIPSRVGVYDRTGDEVGLCQWGCRHQCHFAVYDGVVDDVSQIGQVAVPLSQLL
FT                   NTALHTYPLFPRCMDAGGGGLDQEPSVGTTAHPRVAAERTSGNLQVFTLLGSLDHEVRG
FT                   TAEQEPDTPSTSVPVVGGDAPPDQLPYYNPESADITAARPASTLPTTVVLSVSNICHVL
FT                   PSASEKYVHLVVRHGATAVLSVERQMGVLSHAEWSPAEASAVVSCETLPADAALVVELV
FT                   AMDVVEGGNEEEEDGSTPSAAAAKAESTTRGRARHRTITNGSASAAHLPLGHAQLPVSR
FT                   LSSVEAGEVRVVTLMLSSSQRSSSLPETTGCLPRVAPSMRAPEDAQVVCPTVSFCIFGN
FT                   RV"
FT   gap             296161..296260
FT                   /estimated_length=unknown
FT   CDS_pept        296833..299193
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0840"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25927"
FT                   /db_xref="GOA:E9ASK4"
FT                   /db_xref="GeneDB:LMXM.36.0840"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK4"
FT                   /protein_id="CBZ25927.1"
FT                   /translation="MIYKVYGSPDNNSGNTHMYSMYAPPNAYLPGQGGSRTMYGYAGTG
FT                   AHGSGHPYGYHANPSMGVTYEYDGASNMHNNGCAYRVSGGTNRRDRGGDVVSLRNPYGY
FT                   DQQAASDYEVHDNQLKAPVVVTPATVVLTLGSARLFSKPPKPIAYGSRCVVRICDAFQD
FT                   GRCTAGDRCHDIHVRPEYLAETRMEMSSWLFDRECEFRQATEIDSEKTFSIFVADLKEV
FT                   VEVPINSLIFTKGLYVDPATRAKRARGAGNHAHVHAMMQVPTSCGLYSTDPLQCKWERW
FT                   CNQVHIDHRWMQAKKAEFDQWFIELQNRYLSLAPDDTFTVHDPQLKSSISLPKFSIAGF
FT                   SRGLFQGSMKKLASVCLLFQRGKCTAGSCCNQIHVFPQYLGLAREFAALEQSLDALPEK
FT                   QRLRREMELLRGPLMKQELQEKRETAATESASLPDVVSVANEGNHSDAMDVKAAAEEDL
FT                   GSCGALFEHVQVDEDVEPVSHLVSANTSLTRRMNASAPDISLSDARHMNSDGSYSFNPY
FT                   GSVTSLTDGSTSYSRFPGTRGSGQPMDGNGSVQYTPGSVQLLSTGTKGMRRLVALVSPE
FT                   SGNGGVESHRNGDDMCIGAHTGDGGCPTGAHDRAPQVAAGHRSNGGYRAVAHPLGDEGC
FT                   RYDGGAHGEQSCSLHPLDFDASWHFSPTPLLGFDASTTSTHRNGSIRDEDPAMHAHLRL
FT                   AASNSSYIYPGSSTTSQQNLLSTPMQRGVTSSATAAAKVRLAASAASSRTHAHRSATSL
FT                   PDSSATNPTMGGSVSSIPTARPAFVGEQLTGTR"
FT   gap             302479..302578
FT                   /estimated_length=unknown
FT   CDS_pept        304401..307046
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0850"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25928"
FT                   /db_xref="GeneDB:LMXM.36.0850"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK5"
FT                   /protein_id="CBZ25928.1"
FT                   /translation="MWSAGVDVGGREVQVRLPPGVYRAAYSVPPTDTDAGTNCASTAEM
FT                   PPKDVTKTLSDARSRFHQLRDLRRELSGRPLPNTGGLSATAAPAVHASSAFPSTAPPTT
FT                   TLAQTSLSVTCTPSAASFGLPLDRLSADDPATRSVLRTAAAERALRLQQAENDELKRAM
FT                   LMQQQETAQMQCLIDRLSSELTEMRETVLRQTATMKSLAAEMERRDAYHLIKEKRSSQA
FT                   AALAVATANASSGTLSSQSSLSHQHRLEQQVEQLTKEKAELQQQVSHAGKLRSTPAIEV
FT                   IDKDDDAMAEGSGANRWISSARVELQRLVQALGAILRAGASPLAHFGADSEPVYELELS
FT                   CVTRQAPLRTHRIPDDDAPAPGNVNSVVCICGPYNMRDVVLRVQTARENAGSLLRRSHR
FT                   LEEVPVQSQRSCVLYAMRDTCSVVRICLYEGVAKTEVDTGESCSTESPAPAATATVAVQ
FT                   TLIATALASSRDLETMHAIYNVHTVHLADDKGTLRDTVTFRVRVTEVQHRRYSGYRGIN
FT                   CSDNDLDGRRRASPFPSPGALDPGGVRVRERSATPLSSADAGSAEAESVTKSLHRGQSR
FT                   GPMLSPSRNDEATPIKGQRLFAHSSLPCSTTPPAATDDANSRGSPVDANGILEQVEPQT
FT                   KPLPALLTPSEDSKKAVTRAAAPISASESKTRATLDGANESQITDDLASAAAKTTALLP
FT                   LHDTPVPMSPRVAVSSDPPSTVGVHPTPSAPSLSWPPPPPMAVVPTPPPSSIPTATPPA
FT                   AAACAMRIRIKEVRSLHEDCDDDVVENMLEHCSLQVVVRVDGEPVFTAPTRRDASHAVW
FT                   SAEEGSFTHTLSSGQEVHFEVLHGDKTRGRAVLPVSEILNVSGEKDLTLFSVSGGRPCG
FT                   LLTMAFEGSV"
FT   CDS_pept        309099..310676
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0860"
FT                   /product="putative protein kinase"
FT                   /product="putative mitogen activated protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0860"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25929"
FT                   /db_xref="GOA:E9ASK6"
FT                   /db_xref="GeneDB:LMXM.36.0860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK6"
FT                   /protein_id="CBZ25929.1"
FT                   /translation="MSRLKINLDAIERDGASATEGFCADGVRIGSLLVSSEGVRDNQGN
FT                   LCVLSLSDLEVVPETEGGFLGKGSSGSVRRAVHRGSNKVVALKEIKVTGQTHINEIRRE
FT                   LETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPVLACITRLMLK
FT                   GLTYLHRNRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTVTYMS
FT                   PERLRGEHYSYGADIWSLGLVVAELAVGVCPYAGLRGGSSEARFWALLQHLNGDGTALE
FT                   LPPEMDSDLADFISACVVKSPDRRPTCTELLRHPFIVRYTGAAPEAEAKPFSTTTPTVL
FT                   APGGLSSLLNRASPAAGSALPLASEGGTPKATSPSPAPVSPLTLSCPLERHDGETDADI
FT                   ADRTVVARWIHAVMKRAVLHKARGHGREELHQEPLAAVSASVATDSGEGGGAAGVSAAS
FT                   LDNGQAAQHREFRAERNLDGHSGDGGSAPVEEDCTAGVRSLTCDDLRWTSTGEPSVNLD
FT                   DELNRLLF"
FT   CDS_pept        313880..>316448
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0870"
FT                   /product="putative DEAH-box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0870"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25930"
FT                   /db_xref="GOA:E9ASK7"
FT                   /db_xref="GeneDB:LMXM.36.0870"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK7"
FT                   /protein_id="CBZ25930.1"
FT                   /translation="MEKEALRRAQQASRAAFLRKEASQRQKAANTVVEQKLRDIEQGIV
FT                   PASVVEADFLLHRSAEVNTASELFDVARRRQALAGEGEALDRWGELAAELQSHPHSSTS
FT                   PTETFKVAEEACNIRDAGVVSAPASAAVVDATSRPLSSAGYVAMSEAEVAERVAKHAYV
FT                   REKTFTELQEDRAAALQGQKERLQQQRRSLPMYQAREELVKLIRDNRVVIIVGETGSGK
FT                   TTQLLQYLYEEGFHLGPKARERLLTTPAGTAASSKVKAEANSEGDRAMVDEEQEEELRL
FT                   ICTQPRRIAAISVAERVAQEVGCPCGSVVGYKVRFDDKTGPLTRILFVTDGMMLKEFTN
FT                   DPDLSSVGAIMVDEAHERSLSTDILLGLLRDVIRRNPNLKVIVASATINAEKFSDFFDK
FT                   APVFTVSGRTYPVELFYSDEPVADYVTESAQTVLGLHLSKPLPGDVLVFLPGQDAIETC
FT                   AETLQSYVAEAKGHLRPLLILPIYSSMPPKEQARIYERTPPGTRKVVIATNIAETSITI
FT                   DGAVYVVDCGLCKQDYYNPQAMVEELRVVPTSQASATQRAGRAGRTQPGECYRLFTAYT
FT                   FHNELPPETIPEILRCSMSAVVLQLKALGIHNLLQFDFLDAPSTASLERALDHLFLLGA
FT                   MKADGRLTVTGRRMAEFPLEPSLSKCLIRACALGCGRHMAMAAAMITLDSIFVNTRDAK
FT                   ERQHIKSAREHLFGFGNGDVTGYIRLMEEWLRAGPRAGEFCRSNCINARSMLRARDVLD
FT                   QILKTFDRIGLDVERVPSKSRNDGKYLDDEDDALEKALSAAANQIDVEAVTRALLSGFF
FT                   FNVAKLEADKWSYLVVRPMDTSVPTGAKRLESAGAAETSVAEIH"
FT   gap             316449..316548
FT                   /estimated_length=unknown
FT   CDS_pept        <316551..317456
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0880"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25931"
FT                   /db_xref="GOA:E9ASK8"
FT                   /db_xref="GeneDB:LMXM.36.0880"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK8"
FT                   /protein_id="CBZ25931.1"
FT                   /translation="TRHASLSNSSCPYSLSRLVFASSSLSSQGCALPWVTRFMCSMLRR
FT                   TLCRRMMQLHAQPTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQ
FT                   YSQEVMSVFIAPRHVSISVYTNVEWSKIEWSISSFLGHYLIFNNTCISPAKEYTLIEDD
FT                   LELKDTDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACKTCPSS
FT                   QNTLKDGIERVMKHFLPEVTEVIEDKEHQFYEDYGLLFDSEKALFKEAARLDRERQAHL
FT                   RHKLTPTVLSYDALNEPDGD"
FT   CDS_pept        318544..319293
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0890"
FT                   /product="putative eukaryotic translation initiation factor
FT                   6 (eIF-6)"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0890"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25932"
FT                   /db_xref="GOA:E9ASK9"
FT                   /db_xref="GeneDB:LMXM.36.0890"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASK9"
FT                   /protein_id="CBZ25932.1"
FT                   /translation="MTLRTRFESSDDIGVFSRLTNAYCLVAAGASQNFYSVFEQELANH
FT                   ICVVYTSIGDARVIGRLTIGNRHGLIVPSITTDQELQHLRNSLPDSVKVQRVEERLSAL
FT                   GNCVVCNDHVALIHTDLSRETEEVIRDTLQVQTFRTSIAENALVGSYAVATNKGCMVHP
FT                   KTPAQDMDEISSLLQVPVVAGTINRGNAAIGSGLVVNDWAAFCGLNTTATEITVVERIF
FT                   QLRRETAGGDEGNLLQNVRETLVDELA"
FT   gap             323101..323200
FT                   /estimated_length=unknown
FT   CDS_pept        <323201..>324660
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0900"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0900"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25933"
FT                   /db_xref="GOA:E9ASL0"
FT                   /db_xref="GeneDB:LMXM.36.0900"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL0"
FT                   /protein_id="CBZ25933.1"
FT                   /translation="WKPRAGVPRHSSSSLPEIRNRKAWRMMAEAYHNNPAVSKIGQRFG
FT                   PYQVGDTIGRGTFAKVKIGYHETTKVRVALKIISRKLMDSDARSALKIKREIKIMRVLR
FT                   HPHITRLYDVVKTKHDIVLVMEYVSGGELFDYVTHKGRLEEPTARALFQQLTAAVAYCH
FT                   RYRVTHRDIKPENIMMEHGCRSVKLSDFGLSSITHDGRFFETSCGTPNYASPEVVSGRL
FT                   YGGPEADVWSCGVVLYAMLCGTLPFDDSNIAFLFKKIQTADYAIPSHVSPQAQDLLHRV
FT                   LVVNPLERATMEQVMQHPWLRPNFPRYLLSLHYAAIVETTRFASTYYLTEDMLDDEVLN
FT                   VVASRFRVSPQEVASIIMSEEERIPSMRAVISDEDNPNSMARRYPAANYFEMYSNVLDS
FT                   KLWPTPVEIAAAEVALRDEAHDIYVSYVILTQKKQNKLAPQEHTANPSFGESANSLLQS
FT                   QAQQGYGSLNANSLQQLTGNSSYTGLSF"
FT   gap             324661..324760
FT                   /estimated_length=unknown
FT   CDS_pept        333984..338675
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0910"
FT                   /product="mitogen-activated protein kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0910"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25934"
FT                   /db_xref="GOA:E9ASL1"
FT                   /db_xref="GeneDB:LMXM.36.0910"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL1"
FT                   /protein_id="CBZ25934.1"
FT                   /translation="MPSSSSATEPKPEATQGIKLPDCARQPQQRDSTAADALHSEFKDR
FT                   NPLVLVQPPCPILCSEHERKMRSCFKSCVVSPPRQHQRIGDVVGFKVPDLLAGWNLPRC
FT                   SSAHRCVRAAGAVVTVEPQPSSPADTTTRCPAGTPACASSPTQGPDGEDGVIVVSEADQ
FT                   PASLVNLRRRYSKESKTAVTGEDGVLLSEYEEDPADAAVRQTLARVRNKNCVLLIVLLV
FT                   IIIVLAVAGGVGVGFVNKHYTTLTHRMHLESGERVVLNSSIMLLKNYHETLRADARNLL
FT                   SFVRSSMADRKPESIAVVQNILYLPFFDAWSTWLYSSQVPSTHSIYVSMCGEPLITTAD
FT                   CPVMALTIVCMPNTVQASCFYMRSDEFNSSQMIVNHIDVDEFGIPRIGSFFKYVPLKVR
FT                   YAYNQTNNNYGYFLDSDCVTLLDGKAHTTLTIRRQSVMDGLLIVCDASSFFERWFQRFE
FT                   RGLQKKKDSYSVLFINDGTILAYDCSNQLGGGEAVAPRSGGVAPPTVRECGVVGKHMID
FT                   HMVDTFTVAMQRHKLFWREAFASKDVSLTERVSDHIVVYQDFLRFLVDEDKPQAIFIAA
FT                   YAVPLDTSLGRDGFVQISICVVIIIICMFLLGGVAMVAVNQMMHVVEVISQLSTHAATY
FT                   DTKRMRRVLDRQKPGMLARIITSADIINCEFQHILTNLNAYRPFLPQSLLTKSSYSFSD
FT                   EPLERPNLRRHDVALDANAADDFAVGENGVPAKTLPRFHLKNTLEGSVGNPVENLRLLQ
FT                   RGFHRTKSTILVVSLSNVALDAGDSVDVVNLFVQTVLNHAASANGVVEVIEFQKIVVSF
FT                   NSHFPVPRHQEKACLCALAIREEFRDRGCNVSIGIASGYNYVGTTGTEQQKARVIMGES
FT                   VVVAQSLTSLKTYLGCSILATDQVVFEALVTAVAVDVVQLYYEHNHQWVQYGVSEIIGN
FT                   RYAVLSPDMQLVKSVFKLVRYRQAEEALEAVRRYMDGAAERRETPSWPVRRIHALVERQ
FT                   QLLIKSGYRRQRLQWQALEGDEIIMNHLSEENQSYNSKRQPRLMTTVSIATVDSFATLA
FT                   THGKTIPCEFGYVSSDIFNAGSEAELARALVGEQSKLSMSRRHLAAVSSSCFIEDALFP
FT                   VFTVRSSDGDEEERSQGSLRLSSQHERGTDDNAEAAGADSEEMRPVLVVGPQTLPSEER
FT                   HDVRIGALLPSTTVTTSPPFLPSHGIEYPCPTSGISSMLSKGRRHPSLDRQRHIAATPL
FT                   HGCTFHTGAYVTSGALGGDSGGRPPIAASPATTSAGNLGRTADSALKQSSENVASLAKM
FT                   HCAYKLPQRIVSVNGQVFHRTSQLVGRGSFGEVYLSISETGSLGAMKVFPLSDNNAPQL
FT                   IREVETLSQMRHENIVGYDCCAVQDNFFFIICEYLAAGTLGSLIQKLGVIPERAARKYA
FT                   CDMLFGLGYLHQHSWLHCDIKPENILVTSDGTCKLADFGAASLGRSLMDAVSVRGTPRF
FT                   SAPEAILGTWNQQADIYSFGITVAQMVTGVHPWHNYTEPDHLFVAHYAGEIRHSLQTGT
FT                   LCAMQPDLPTNLQDKELQSAIHRCCEFDPTRRPTAEELVTLLS"
FT   CDS_pept        341566..343308
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0920"
FT                   /product="RNA editing complex protein MP67"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0920"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25935"
FT                   /db_xref="GOA:E9ASL2"
FT                   /db_xref="GeneDB:LMXM.36.0920"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL2"
FT                   /protein_id="CBZ25935.1"
FT                   /translation="MVQEWCVNAAQEAVISRKAISQAERIVTEADDPRSDKRYFYDSDA
FT                   RLCLVCNARLEGSYSTHIHSVDHIPRVALLKRTIGMILTFLEQATSSPSLPSESDQPNS
FT                   SAESKRFLRTVSSHTATPAAPAPSCFHALYAESPLFAEDGVPSRALLYNRPRTLREFDL
FT                   VDVIMRRWWNNLHNPPPRRGSLSFDRLLSLSSTELRMRRWRVRYLLYFLKSRGVLRSCL
FT                   SVRSDQANEAPPPNERIHRGEAFERLEMVGDFFFKSLTPDRMHTVFPADEGGLTAELQY
FT                   FERVLDSNHGLLAIYDYLGLDDIAGCFLANNKAKADVVEAVIGELKVLLWSTEVVWGME
FT                   YYALPGERATHVYLRALVAHTIAELGHTVLMWQLGSTLRNCRDFILKHTVEEYLGVEKR
FT                   NERRAKRGGDECDIASGLPKYALLPPLLAWDRRRPDVSVRRCQVPFAGKLSRSSIPPSP
FT                   QDPLRKLAPTASCIPEAIRHHYAVGQKKWSSSACKTAIQALCGSLTQTALQPDSGHTAD
FT                   ALSSNPKCPSLPLSPGPQPSPTTLVCGDVPRSVLRALVAANCVVIRSSSPPLARTTSTR
FT                   RLAG"
FT   CDS_pept        348875..349336
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0930"
FT                   /product="putative 40S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0930"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25936"
FT                   /db_xref="GOA:E9ASL3"
FT                   /db_xref="GeneDB:LMXM.36.0930"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL3"
FT                   /protein_id="CBZ25936.1"
FT                   /translation="MSLTLIPDHFQHIVRLLNTNVEGKRKVAFALRMVKGVGIRFAYLV
FT                   CKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGKTEHLSSSMV
FT                   DTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK"
FT   CDS_pept        350343..350804
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0940"
FT                   /product="putative 40S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0940"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25937"
FT                   /db_xref="GOA:E9ASL3"
FT                   /db_xref="GeneDB:LMXM.36.0940"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL3"
FT                   /protein_id="CBZ25937.1"
FT                   /translation="MSLTLIPDHFQHIVRLLNTNVEGKRKVAFALRMVKGVGIRFAYLV
FT                   CKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGKTEHLSSSMV
FT                   DTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK"
FT   CDS_pept        352463..>365074
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0950"
FT                   /product="putative dynein heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0950"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25938"
FT                   /db_xref="GOA:E9ASL5"
FT                   /db_xref="GeneDB:LMXM.36.0950"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR024317"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR035706"
FT                   /db_xref="InterPro:IPR041228"
FT                   /db_xref="InterPro:IPR041466"
FT                   /db_xref="InterPro:IPR041589"
FT                   /db_xref="InterPro:IPR041658"
FT                   /db_xref="InterPro:IPR042219"
FT                   /db_xref="InterPro:IPR042222"
FT                   /db_xref="InterPro:IPR042228"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL5"
FT                   /protein_id="CBZ25938.1"
FT                   /translation="MQAEALNPYLRRPDKKVAEYASVTVAVELEPKVMAAHLSVRGEVP
FT                   RAELLQRKRQRIDAGPTLSQLLMARGMHTAAANNLDLNPENGSADIASCAAAGDYATWL
FT                   PVEAFDDAFRFEELSPEDWAERVAAAPSGLPCLFWKLDHRQHQRGGIWASGRVVEVDVD
FT                   KQRYHVLPDDVRDPRSAQKQKTDSNGSGEDTRPLVLPRVFVCFAAEDPENFANRFAAAH
FT                   KRRTIAEAALRTELYVDSIPLDEYAALDPLVIRRVLDAALSTPALVESESNLNVTGVLE
FT                   QVRAGYSRIMNADLFHSITQGGGLSQLMGPSATSSTTLSASSLFVSDTARPVPLFGVPS
FT                   HQAKRFAATVGAFRQECFWNTSPVLAGLTRAVRQADDALLSRCVFVLYSTTRMKRPLSL
FT                   MELEEIETTATRVSFLHARDQWLAQTADMVKRTLSTFPSKDPVHLHHYDVNTYTGCSTE
FT                   RYLRQIQLHMQDTLQHYLTSSLEALIRFFEHAGDNHVTVHGMTEVEVTHGIYPAPRTPF
FT                   GADERITAGFLVPPPHPLPPLLSVVLLCTKHVSDAGAKAAQEALETPATETQAPNPVAG
FT                   DVPEENEGTGKAEKPSTACLSYSCSIESMRVSLQGLLKRCLTQHSTLRTVERVLFDFLY
FT                   DPTTAFLNVPEASSMLMESWVQRINVVLDRVAVAMMSYRETYTPFTAVIELDLNAYMSS
FT                   FDERFPGTRGVEAEVQRFLTLQQQVLDDIPVSADLGLVRVECSEVRRELSKKCAMGAAK
FT                   VLDVMAARALCKEIEVNDRYSELYAALLKPTETPEEVVATKDFIKTIPERVVDLEMAIE
FT                   ESKEIHELLKGFKRPLSEEEFNKKWKAIGWPSQLDNAVNERVEELEETKRRLLASMNRA
FT                   QDLFEQEVERIQKIVEQYGQHRNPHRMTEIAEDVLRVQEKIHQLRSQASTFNSDESLFN
FT                   IEQTDYSAVHQLATDFEPYEALWITSAKWSASLEKWHELPFMSIDADEVERIVGDTLRI
FT                   MNTCVRNPQLRPELVQVAERTRENVQQFRPLVPTVKYLRMKGMQERHWSQLSKELGQAI
FT                   EPGVTLQSLDDVVRMSLTQQNDVLMRISEIASREFHIETSLAKMKAAWADMRMSVTAYK
FT                   ETGCFVISKDVVDQTQEKLDDQMLLTQSLSFSPFKQLFEDEIADWETSLKLVQDVLDAW
FT                   LRCQKSWLYLEPIFQSEDISRQLPGEYKRFQVVHKNWKFLTNKAKEVDLTLEFCTTTER
FT                   CLELLKENNDTLEVVERGLNQYLENKRASFARFYFLSDDELLAILSEARDPQKIQPQFR
FT                   KLFENIARIDMRNDDNEMFGMYSQMEEYIPFAQSVLPRKYVENWLTEIEHMMKISIRLQ
FT                   LEAGVKNAATMKRQAFVLQSPGQVAIAVNQIMWTHECEMSLKEQGSLAPYMETAQQNLM
FT                   VLVETVRLPLTNLQRMNLSGLITIEVHARDIVEQLAKAGVDSIYAFEWVSQLRSYWENN
FT                   DCVLRQVEAQFRYGGEYLGNTTRLVITPLTDRIYLTLTGAMHMFLGGAPAGPAGTGKTE
FT                   TVKDLAKAVAKQCVVFNCQEGMTYASMAKFFKGLAQAGAWACFDEFNRIDVEVLSVVAQ
FT                   QVSSLQEAARTRQFRIPFEGTEIVVDPSYSVFITMNPGYAGRTELPDNLKVLFRPVACM
FT                   VPDYAMIAEIRLFSFGYSDSRKLAQKMVATFRLSSEQLSSQDHYDFGMRAVNTVISAAG
FT                   LMKREHPDEAEDVLLLRALRDSNAPKFLEEDLLLFDGITSDLFPGVQLTPAGYGDFIAA
FT                   LETKASSMRLQPTEMFVKKCVQLYEMSVLRHGQMAVGPTMGGKTSATRVLQAAMTHLRK
FT                   ELKSTKFAEVKTYCLNPKSIMMAQLYGGFDEATGEWRDGIIGEVFRIAARDTTDARQWI
FT                   IFDGPVDALWIESMNTVLDDNKKLCLISGEIIAMTPYMNCWFEVEDLAVASPATVSRAG
FT                   MIYLEPNTCIGVRNFILSWQQYRLPVTMEPYKEHLQELCEQLFPSLIHFVQTEVTEYSP
FT                   SSWPNLVTSCFNLFDCFMSPYTPTRTYEVPQDKLDLLREIHLHLLIFSVVWSFGATGDR
FT                   PSRQRFDKFLRDELRLRNVNIELPVIGCLQDYQFIPEERRWIAWAERLPPFTTQVTQSN
FT                   FSDIIVLTADVARYKYVNRILLEHSYHTLCCGPTGTGKTVLMRQLLMHEMPKECTPIFF
FT                   TFSARTSANQTQDLIFSKFEVRRRASPQVWGAPLNRKFIILVDDMNMPLKEQYGAQPPI
FT                   ELLRQFMDYKGWYDRRTREFFSIVDVVLAGTMGPPGGGRHFITQRFLRHFHQIAFPEIE
FT                   DDSMSRIFLSLLESYFSLFAEDVRGKLSSVVMASIEVFNTAVKELKPTPARPHYLFNLR
FT                   DLAKVMDGLTNATPATVKTVPALVRLWLHEEMRTFQDRLTNDADRSWFQEVLGKQLQKH
FT                   LKVSVNDVTQRHRGDGGAGADSKTPKTPVADMNALMFVDFMGGKSEQRVYQEATDFDAV
FT                   VKTLEQQLRDYNHQCIGGRQLHLVMFADAAQHVCRIARVLRKPNGHALLLGVGGSGRQS
FT                   LSRLAAHLNEYELFQVEIAKGYTMNAWREDLKAVLQRVALQKKQVLFLFADTQIVHEAM
FT                   LEDVNNLLNSGEVPNLFVGPELDDLLNAMRHVCVAEGLPVDKVTIFARFVRSCRSQLHI
FT                   SLCMSPLGEVFRSRLRMFPALVNCCTVDWFSAWPQQALRSVARNYFAMMPLLAQQAKAV
FT                   EACTEVCVRVHVSVDAVSVRFLAETQRHNYVTPTSFLELLHTFRALMETQTEKNQTTKD
FT                   RFINGLAKLRETEDAVAELQQTLSQSQPVLLEKNESIKALVAEMEVQTTEAEKTKKEAQ
FT                   KEREAVATMQGECAAIEGAAQEQLAEALPELDRALESLKNLKSAQITEVAGYKAPTAGV
FT                   VMTMQGICILFQIKPQMRAASLMEKKADFWATAKEQLLNNPNLLLQRLIQYDKENIPEK
FT                   LIQAVMPLVTSDDFTPKKIAGASQACAAMCQWTHAMVRFHEVNKKVAPLRQKLAVAQQA
FT                   NQKAQQKLKEAETQLADVAERLADMQRRKEEAERELEELDQTVKRTALRLERAAMLIDG
FT                   LAGEKRSWTKSLERIDESAQYLMGDMLVAAGQIAYCGPFTSVYREELFKSWGKELEERF
FT                   ILHSAQYSIYHTLQDAVETREWILNGLPMDTLSIENALFAKNARRWPLLIDPQTQGNRW
FT                   IRRTYKDSLEVVRPSQKDLIKRIEYCIRAGRPVLLENVGEDIETSLNPLLERRTFMEGG
FT                   TEMLRISDTPIPWNPKFKFFMTTKLPNPHYIPEVMVRVTLLNFFITPRGLEDQLLGVVV
FT                   GQERRELEMRRSDLIQKNAAMKADLVNTQESILCKLKEVQGDVLDDVELIAYLNQSKEK
FT                   TLEITTRVAEAESAEVELTASREEYRPIAHHSSCLYFCCSTLSNVDPMYQYSLQWFVQL
FT                   FIASIEQARRADDVAQRLENLTEYFTYSFYQNVSRSLFEKHKLMFSVYLCVRLMDQRGR
FT                   VDAAEFRFLLQGPTLVTDANDNPAPGWITPATWNEWCYLDHNFGPFKGLKAHLCTHLPH
FT                   YKELFMSSAAHRQPMAADWADKLTPMQHLMFLRCVRPDKLMERLQDFVLAEMGEKFIRP
FT                   PPFDLLTSFKDSAPTVPLIFILSQGADPYDDWKRFADAQNMSKKLYDVSLGQGQGPRAE
FT                   RMVQEGMESGSWVLLQNCHLATSWMPTLERLVEAITPNTHPSFRLWLTSMPNAHFPVAV
FT                   LQNGVKMTNEPPKGLQANVSRSVGAYSGEFLESCQKSVELKKLFFSMCFFHALLQERRK
FT                   FGPLGWNIAYEFTSGDLGCCAAQIKMFLDKYAEVPYTVIRELSGNIHYGGRVTDEWDRR
FT                   TLNTLLERFVTPDVMVDGYLLCPRLQEYQSIPVTNRQGYLDYVASWPLNTNPETFGLHE
FT                   NADITCARTETFETLQAIVLLHGDEGRRGDCVPSSSAAVSTPDDMVKTFAAAIHRKVAG
FT                   PFDVDQFRRKYPTKYEDSMNTVLAQEAIRFNRLVTLLHQTLEQLPMAIHGEVVMSKELE
FT                   EVYSALYNNQVPALWSEKAYPSLKSLGAWVDDLVRRLAMVQNWYAHGHPKAYWISGFFF
FT                   PQAFLTSVLQNYARTMHISIDTISYEFEWMSTDPASVTAPPEVGCYIHGMFIEGARFDP
FT                   ATLTLAESLPKVLYEQAPLLWLKPVINRLPPASGIYECPLYKTVRRAGTLSTTGHSTNY
FT                   VLTVEIQTPPKADAKHWIRRGVALVCALS"
FT   gap             365075..365174
FT                   /estimated_length=unknown
FT   CDS_pept        368502..371249
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0960"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0960"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25939"
FT                   /db_xref="GOA:E9ASL6"
FT                   /db_xref="GeneDB:LMXM.36.0960"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL6"
FT                   /protein_id="CBZ25939.1"
FT                   /translation="MFAHRNQHDGPCSSLFPTPPSTEPLPMSGCGKVQCIASWKEAFGS
FT                   LPVKATAGMTYLRAFAGVFVCFSTVSAMLHVCILGLDVVYSVHNNQNVYHSNKSLAVAS
FT                   DALGGTANTTDSPTLLFPQLSATVGLHTVCLGYNCFLRSRLNGVSALVANAAQGTAGLS
FT                   LPRELAAAYEEATYEYIFGFDIGAHCGTPRTKTQSLSNFGIAASALSLVLLLALLAVSM
FT                   ALCSLVGKTDFLMSTATPYGDFHVNNLDGLYVPAWYGMLQINRHLRMKTPLLLSAGILG
FT                   LLAFCTSVCTMGVTVALSQSKSKCGQSVCAAFKQRMEHFYELADSLHVNVSTPRAYACQ
FT                   PGSSYILVFITFCISAVCLTIGTAILFCYHHSRHHEKMLEMRDQLRRMADVDGLASGRN
FT                   VVSAGSRRGTASANTSPLLVSMSSPSQAFSDKHSSDFFADGGLAQRRQFGNPAEDAQRR
FT                   ARSVGAGIELYRLLTQFRAAEEHSRRYIIMTESVHFRVFPALREAVWLAENLCRLHKFT
FT                   LDCFAGPALEICVLETQCRQQLIREYDAGVTEVLASLRDDAGVGPSQLRQPRGEGAVLQ
FT                   ERERALWDEHVRLWQQVRAEMSRSFQRTASHAAAEARLRRRPSSLAHSRTASSAGPNID
FT                   EWSQKLEELNVTSVTKLFLADSFAELPLRRNGRHQEADTSSSFSNPTCSRAAFPCSGGD
FT                   SSAACDAARLNVCADGVSATGAAEAYAPSSEQQRQLQEGPSEQPNEVPQLSDVSDARLE
FT                   CSGSARAKAAQKGTENKSLEVLTSPSAASTYSFRSSVSLAPSPTRAASESQALRPAVGI
FT                   SKSNNMVDPMNVAGGGMRLQTVSRRTDNASGAAEWQSVYHGASEKKRENGTILGRKRLH
FT                   SWTGPTFSSASTQQADTTFSCATPTAAFSLTSPWRKRRDEQNLL"
FT   CDS_pept        374840..375436
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0970"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25940"
FT                   /db_xref="GeneDB:LMXM.36.0970"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL7"
FT                   /protein_id="CBZ25940.1"
FT                   /translation="MSSKSVDVFNVSQNRLRAATFQDEEERQNAEYAERHNLQALFSEF
FT                   ASQLREKDPKTEHEAERVLLDLLSHRKAERDRAALRLHFVTSFEVNLDNGRKILKLTSG
FT                   SETSTLQIVQKTRSVAVDETFTVSLEEAEELTEMFYELGRFVVESGKGELNGFISIDDR
FT                   DVFLLAGGKDCSDIGDELFNMAFLMKASSKNRGTE"
FT   CDS_pept        376436..376942
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0980"
FT                   /product="putative 40S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0980"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25941"
FT                   /db_xref="GOA:E9ASL8"
FT                   /db_xref="GeneDB:LMXM.36.0980"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL8"
FT                   /protein_id="CBZ25941.1"
FT                   /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDPMGTWTGTLGGNTFTVP
FT                   CIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVN
FT                   FEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERTNYRAAAAASDGEVVP
FT                   TPAAE"
FT   CDS_pept        377628..378134
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_0990"
FT                   /product="putative 40S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_0990"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25942"
FT                   /db_xref="GOA:E9ASL9"
FT                   /db_xref="GeneDB:LMXM.36.0990"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASL9"
FT                   /protein_id="CBZ25942.1"
FT                   /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDPMGTWTGTLGGNTFTVP
FT                   CIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVN
FT                   FEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERTNYRAAAAASDGEVVL
FT                   APAAE"
FT   CDS_pept        379080..382970
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1000"
FT                   /product="conserved hypothetical protein"
FT                   /product="predicted WD40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1000"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25943"
FT                   /db_xref="GOA:E9ASM0"
FT                   /db_xref="GeneDB:LMXM.36.1000"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039857"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM0"
FT                   /protein_id="CBZ25943.1"
FT                   /translation="MRTSVRWSETADAVKGIRPPINSLCYSPSGDYVVASCGVRVLVYA
FT                   ASTGTLLHSLKGHENTIYCVDYASDGKCFASGGADRTVIVWSNKGEGIVKYQHKESIQA
FT                   LAHNPSSSHLASVSSSDWGIWSPDQPKVSKYSLPSKGLCAAWTPNGKTLAIGLLNGTIM
FT                   MMDKTSDETVLIRRPAPVWTLAFTPLREKGIDVLAVGSWDQRLSFYNLSGASVGREREL
FT                   DFDPCSLSYFNDGEYILLSGSDHRVTLFTNDGNRLIEVAGADDWIWSARQRPRHKQLCY
FT                   GTNDGTITCIDIAITTVHAIHDDQYVFRKDMTNLVVHQLLLDRKMVIPCNEYVHKIATF
FT                   LDRLAVQLQERVIVFEFFYDDERNMRYQDIAQIRRRLECSLLCVTTNAIVVCNDRRITL
FT                   YDFQGNKRREWSMESAVQFMKVAGGMEGREILLVGLTGGQVMKVFVDNPFPTLLHKGSA
FT                   PVKSADFSCSRSRLAVIDSTSTLQVLRLGEKNELLFSEDNVTAVAFNVDLEDSIAFTTG
FT                   DNTLHIKTGSLPAYQQAVRGIVVGFKANRVFNLHYSNVMVLDVPHAHALYKYVEMRDLD
FT                   RAYDVARLGVADADWKMLGLHAMSQLRLDIARKAFTHIQDVKLVELLKSLELRRRQSRI
FT                   EDGVPPTVRNGSATSAAVAATTDKGAVDPGGEPTSVRAAAKDGVLYGSILAFQGKYHDA
FT                   ARQFMKAGCELKAVEMYCDLKMWDNAKKICTNEKVLKDLIRQQARWAEDSQNFIEAATL
FT                   YESSGDYAKAIGMMGQAGQVEKLMKMCRSLPKSEFILITECANFFRKHNAIPFAIEAYE
FT                   KAQDHQALIGIYVARGDWRNAFTILEKAPTLAREVYVPWASWLAENDKFDEALEAFRAA
FT                   EWPKEAMRLMETLATNSVTCRKFRDAAFYYVHLAEEYGRFEDGERPTDVEKAARIRRSK
FT                   ECVRRADIYYAFSSVYAHTTQPLPYNELSLFRAAKYLFGVCAECAMPMNVGKGAILYTL
FT                   SRIANRLEMVRTARAVFEKLQGVILPVSMMEQVDIETLIVRSKPVKDREELLDRCFRCN
FT                   QLLAQLPMAGDRCPNCFHQCVRSFVNFECLPLVEFILADDLTDEEAERIIVSGVGRRRS
FT                   ADDEHNNGQSDAADAQASSKVREWKSDTGANVISFDDGNIDYEIDQQLVAMGRSKAAAN
FT                   KGNDPFFTQLQYVLRPGRSTSAYQPFVASADILKGFRRDEVFIVRPRYGTLPVPNRYYR
FT                   LMRSDVNVCLCNGCQHFFIAEDYEAECTKGSGCPLCRYRPGKQVGRSMKQILFDMEAAA
FT                   AVATTSSTPAAL"
FT   CDS_pept        384194..389131
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25944"
FT                   /db_xref="GeneDB:LMXM.36.1010"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM1"
FT                   /protein_id="CBZ25944.1"
FT                   /translation="MVRVRNASQPLRCWLGLLLTFSILLVSAEVVRLEKGTFFMDDDVE
FT                   WPWLPQLDLPLRPDFMSGQRILSTPEQWMVLAHVGAPFRVFTDTKMDLMRILEIVKFMR
FT                   PADAGVCPRYRTTRRILHYWFHPGQLSLLFGEERWSALQRLQRPAAWSLVLKDDAGPAV
FT                   RAAERFIAELQALDPPGQITLISRRQDSGLMTTRVSLADVKAVSRRTRMTSTIEYRLTH
FT                   LTVDAEAPLHRVQTQRLLRAKLRYHEHINAFDTAVAEAQRDLHTSLQELLESEQAAYAD
FT                   HMRFKRCYQRFLVERRSRLRAEKEVEDAPGKTDGGSSMGRNAGWRRIAAVHIRPAAGTS
FT                   FASPHDGGRGVSCRKVLAAWSTLRATGVRHEAERRVAQLRRLHSRHRCKEPLPELPVPS
FT                   STARGVAGLSHAAARVWRDGVAEMKAQRRKSGLSPTLAQVLAILYGVWEEEKAATREPG
FT                   HAQEATSAAGAVATPVVVDEDFNASAFAEFVNHLVQSGDALSAAPHSRLPRWIRAELHY
FT                   TLALLELIKPKTLLPEKHPATASSSVRAVVHLHESLSAGSHHAAGALATLREHGIFARQ
FT                   HSKAAMMLLLQSMEQASTHLWRELLLRGSPRRSHEAVGGASSGADPSRLLRFEQFYAVD
FT                   HTFSEVDDPLMTRQTISTLVAVTNENIHAGDEEPELEDVYREAEVGLGDDEYKGRLTVR
FT                   LNRRLLKASLLFSGFKGVQRDAREAQCELLVILRRLGYVCDLDLRRFFTTGAPSHVVPD
FT                   SPPASSAAPMTIIGVPLPDCCAEHETELLDVMSNDRHTLLSCPSGAPFPSRRSRRQLGV
FT                   PNSEALFELLLQTLLTLSYVQLTHRHRYDLSHLYASLALEMSLRVPRATVKRCAQAANM
FT                   SAFFEAHQHLGGSNGSWARSFVEAVNHVADGNSEVAWAAEVLLDQLQSIKNAASKARGD
FT                   DAALGDRAQRVLRRFASVADSPFVSTESLLLIGTSRWAAGGPLSGTTAEAAAFEKDLSE
FT                   WTMEPFDLFHRLLPKRPRSSSAAAAQQTLQPSRSCAAPESSMGVSLSTTVMDAHALFLV
FT                   CLAAMKRWKSDFPLVHTLDSTAYSARRTDPFVLSSFLLRTRDTATGAPLISIEKLRDVA
FT                   YAASPHFLGECPHFLPLVDDTVDSYAARLLRFAGRHIHALEPSIELLRSGGYGVRRTDA
FT                   GGAASIGMRMSGHWGSALDDGPPRKSRLQILRKVKQHTMENADLQPLLYAADVHDYVNK
FT                   SRWTRVATVLNAVYNTVLSPFTTTASEALVADMETQMQLVTPEERGAEPSRRRHASPEE
FT                   SRSQETAKGPARLAETGVSAFVDGFAKDVALREFFIAGQLLTVALESGMPEGFSLILLE
FT                   VSDRGNRHLRPFAEHLAESVFGRMAPSVWTEHHLTAQWQREEEELVGGGPLFALDTRTP
FT                   FRYASAEARQELFARVNRWNAAKAQQGGSGEVRLLRERQGTRVSQALDQLLWCAGFLTR
FT                   RVYKDTHRVYPYAYEGSVFPASDLDCVADMNRLLKTQRPAAVSAASVGTGEESTWTWAE
FT                   WRHAQQNGTALLRDLSERLGYVYDTVKGAPTRRFPLSTADFSRNATVEEHALLLAERNR
FT                   DYTSRFERVSTQFVEPWNRLSKDYSDQVVAYGEGFYYNQRLHRISGYRWGAILQMWWLR
FT                   VRNMWPW"
FT   CDS_pept        390790..392430
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25945"
FT                   /db_xref="GOA:E9ASM2"
FT                   /db_xref="GeneDB:LMXM.36.1020"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM2"
FT                   /protein_id="CBZ25945.1"
FT                   /translation="MLARLVCVVAIVAAVGLLSPVSADTAHPHHRLSHTVTIESGILPE
FT                   AKAFAPLRLRAGEWVYNFNPGEEAFFFEPEDAANRQWQQWKADLGLLQAYQEKQRLSNH
FT                   PAGGEKTNTPDNPGDTERREPGALPIAEYFSDRNVQRRYTARLKEQSLHNLSDAQGAAD
FT                   ARMFAEGEIATMWQHVQSAGSSDTRNDQEFLDLVERHFSHTIVNTSAAAAATASSSSRF
FT                   ALLRVPLVLEAEVLPFMEREVAHVRDLWKSRRAGGATPAASSVEVESQLQLLSSAVEDS
FT                   KTIGREVAALVEPLADAAIRWVALTLTTTREAIVANDESTEAKRLELKQLLKVQSRLRK
FT                   VKPVLEKYSKVYQRVLRQGQLPNAEATLFALQLIAKQRFGDDVSGLLEAVPLLSTTAPL
FT                   TGLLEQEWRVHVLAPCGMCIVVTAALVWVCEEIKERFMTRVRARRLCMPLGIPASSSGC
FT                   TRQMFMLVSLLELVVPPLLPAIALLVHLRGARMWMWGMIALMRPSQRAMCLVSVSLLMF
FT                   LDYLVARMARRVFQILDPSVYRRRLAKKK"
FT   CDS_pept        393855..398873
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25946"
FT                   /db_xref="GeneDB:LMXM.36.1030"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM3"
FT                   /protein_id="CBZ25946.1"
FT                   /translation="MRSLRLRAVGSLHPSHRASSYNDTATSTCSAWRCLNTAAENRQRN
FT                   AATDSALPPLEQTFPSPLSGPVASNSVLLSPIDSAHPCSRLSQRQMRQRQRKWGALRRY
FT                   RWENHSPRPIPLSLLGTPALISSLPRTSVGATHGGVSEDTRAKTVPCDAARGALVKTCS
FT                   PSRSRSLSRAPAECEATEGTRPRADTGSAGGAVVDSVALSSTRNAAPGSSSVEDPLLSF
FT                   LDSHEEDAALLLAMWTSLHRSCVFGSALSESLVLQVRCFLHSLLRYRAIGAAVNFYYRL
FT                   MGIGVQLRQSDLLLLFSSLTYEAAASTEEAQLRRAAETATMENDRKIWTQRRRQFRESA
FT                   ARTHTTDAPGQSQRERGEEGGDTVFAGQMGVMNAVVKKTGAPALCEERPARVNATATDN
FT                   IQDPASYTHIARATHIADDRSVGASSASRGDWGEVGDDVHPPGSIARRVAFHQQPEWVK
FT                   RWILYEASMGTLDDLDEVEDPSRRSTLSTSSSADALLSASDVEADTAAQSEQAMRGMKV
FT                   AAIVDHLHLLTLGAMQRDHLSATEANTPPPSPWRPQRRTWRLSRSWSAERAYWKEALDL
FT                   IRSAYTLAPRHRALSECGGTSCPPAAEDLLLPSDVVFALQSMLREVHSWEGTLSLLRLT
FT                   IPEAKQRDADPPRAVGMASDCFLRGAVLFMALAASAQPWKTQAKVEGWMHRVMLPRLAR
FT                   DTRAQTEVTSTATAATAALHALWLSHLCSVKASRPDEFVVLGEEAAAYFTSLSVQQAIH
FT                   GDLTLMMSEVCATTERAVDALHETLQRAAQHRRTSEVLAKSIRTGAYRVENGKGKHDLG
FT                   SDPERDHMFDPLSITSVAAPATVMNGIRCSLFTEYTTKSPLSPPALLPSDSVDAFVLCC
FT                   AAVKETVWLRFTTAASTSPAAVTVEVLQFLEQSVHGPSGLLNAFQLLYDSPASRLARNG
FT                   KVSTLTPTVNTPAAPECAYVSCILATTLLQLVQLLCAQPDQQQHHFSCQIWNGAELVLL
FT                   VELAAKVLEGIAAAQVQQAPWRWAVEERLKELATVTARTVRLVVHQLDIHRMNEKVMFG
FT                   AMTDQNVELLALLARVLNKSSELMVVSRACGASRGSSHSPVWRILTSTCSPRILQGVHL
FT                   CFRSSCALGKRVRYRLCRRDADNLDHWIQPPRSRQRTSDRLRGARGAALSSPKLPMKAI
FT                   AASGGAAVGRDVGRDFPLTVSLRDSVYKIMTRERTSAGVGQALQRLAAATVNWKASLLL
FT                   CELVTKDVSLARGTCSVDFFATTLDRMAQDVAKSSAAAQAGLRASRLQGSCVVPSRKGY
FT                   GRLAAPRAFGPPNLWLSAIDVFWSAVDHAGHVEAAAAQQSHSSSVAASATTPGSNLVSV
FT                   DAQERAVLARLLLPLLRFSRAVHQREVGRQWRRTWAAMYAPPEKKNPQWRQQNIEALSV
FT                   LGDSAALSHCVSDYHGCGSEALLCSVAVQHGNWHAALEAVFQTYGAVEERHATGTTYSL
FT                   VIARTILTLLAKSPMNLSNTAMRLRTVQRETWDEECSLAVVRLLLRGRRWRLAMTHVDE
FT                   ALGLPDMQRVRALVLVDPAGRLRQGASPTASSAATLVRYAQLLTAALQATAIGGDSERA
FT                   PAYYDAFKALVRYVFGEVVDMDTLHTAEVDSQSGDDALDAALDMTHFTEREEKHSSGLE
FT                   DQVHEAVRELAPRARILFFRAMTKKMLASHAGSR"
FT   CDS_pept        400252..401112
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25947"
FT                   /db_xref="GeneDB:LMXM.36.1040"
FT                   /db_xref="InterPro:IPR032727"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM4"
FT                   /protein_id="CBZ25947.1"
FT                   /translation="MAQCLTWQVLDQRQTGECLDAVDLEALRVVIKRIDDDHGGALLQS
FT                   GKRTATQVNVLLDLYGHLVLFAKASQFSQFKTSTLFGIVHRVHEASIVDRLSRFHSYDL
FT                   LRELVVRHSVHRPPYSTMVFNVREVQDIDTYMMSTYYRHYKMYVYCFVPREVASLRTVM
FT                   LNDTAEVPPAQLPPLSAAIKEDAWKQKMQEKVRTLEEAEMEEELIVSDAVSEAQKNAAT
FT                   LDNSRFMAGIRVQLEAIRDAVSTKSSERLDFIEEKLTAIEAKVNEAQSSGNRSRQGSRG
FT                   SSKKK"
FT   CDS_pept        402328..404070
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1050"
FT                   /product="RNA editing complex protein MP61"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25948"
FT                   /db_xref="GOA:E9ASM5"
FT                   /db_xref="GeneDB:LMXM.36.1050"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM5"
FT                   /protein_id="CBZ25948.1"
FT                   /translation="MRLSLRLPAVPIAGVLRRAPRAAGTRGRSVALRVAAASIGSSTSL
FT                   VSSSGRKAPVYYNFATPVSVLRDAAAGESVSHRRQRREVSVREGGLLLVAPRTPNPNDP
FT                   LQRLNIFRRDFSDFSSSAKLNQNIMVSVDTSPRRFLEMFCDFDAKRCKLCNESFLQWHI
FT                   HANGIPHAGREGMLLELVRPYCGTPDELIEMWWQRLNSCAAFHRIPALSHDNPHERKRR
FT                   LLYLLKVLKDRGILVEAFNVSDTLSTNSARSWEFERLEFVGDNVVKYVLNSIISCAFPP
FT                   HEGGTKGKVTCFQFVMDGNDGLARGYDHLDLQQLASSSRVVSKFKSDIVETLFAELQMY
FT                   LWSTQHDVGTCPLVFPFTKDIYTLRALVQHVLYELAIELFLYHTRHINGMLQRVMRENH
FT                   LQFVKADSALKPTAGGRTGSLGVSTRRGDWNDADDDYGSPKSYGAPAVPTPTTTLMKVR
FT                   SQRAHLQGSGAALFFASTNYDNFKRVVPIGGLLPRPFAREDLSVIPNYMPHLRSDGAMT
FT                   LKMRRAGNVSWSALRTTAAALATREGVADGLGLSGEITPRVGSVPVHLSVPRLKDEELI
FT                   AELI"
FT   CDS_pept        405395..408406
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25949"
FT                   /db_xref="GeneDB:LMXM.36.1060"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="InterPro:IPR028941"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM6"
FT                   /protein_id="CBZ25949.1"
FT                   /translation="MITARSPYQVYKAADVDGTVANFNSLPSEEVLPYKIMSSEETLVA
FT                   SLSVVEGNEEQRERYAVSALHAARVYISHLISYIPLCARSQTAKKVQINVDAIVRTVML
FT                   FATNAELLQSVKNMVLTNASGEQVSLKDLSDLEGALNAMEKMYRQKAKGAGEKVDMLRK
FT                   VAPVPVIVSSSPAKLQGTTSVMESEDSSDAASNSTGCPRQRRRRSESTGGPAAHADLHG
FT                   DAAALKVAKIEGDPDNAPLAAVYTPKTSGGPKSVRGGGRGGLVWGRLRGLTNCEKKVVA
FT                   MLHAMIQVLGHIFATKFNDLVPIFDMLDERLRAVQAIIDAERAQYKAKEDKRIPEPFHE
FT                   VTLDAVQLALEHSSDTFRNEEECRYELDEDLLHPIAHACLRVINHIEGFSTEPFKGLTP
FT                   EELVKKQQLRDAAGAKREEAKRRILEKAEAKAELERKKEEERQLMRRRLGDGNNEHEKD
FT                   LEEDTTLVTPSTLGYVSYAAELPLGTPELFEKALYVWSILSSVPRALNLSQMHFATFVK
FT                   GIECVDQDANGLMEEVTKCLLDVSMESVRLRSPETPRIVTRGKNWFGLLVEFVGVASGN
FT                   KKRRQQQRHVSSTEDEEESDSDSDAASSTSSSPSSSSSKETDAKTSAEEEDLQPEEAPA
FT                   AAMATKGEGTAEATAEEEVDTDPFSLELKATMDKVAGLRSLASWGNVDTIDRLNLLQFC
FT                   VLEALASDDVRNEADRVQKDREEETLNAEKKLREIREEAEKELKALLRTLPSVASTAAR
FT                   KKKKQNTKQNAEPVKTEDNPETSNAEDEKKGIDEAGDGETATEKDVREKAERNFEAERE
FT                   AILKEVDRKREEVYARLFGVQDGRDDGAIVEPLGMDRYRRLYWRFPMERVVYVQSVPNL
FT                   TAVTFPVLEEPPELKQRRASSRSLLLDDEEESSLLGGRRRGGRGATAVGDAVHAKDDKG
FT                   VGQMRWGVIPHDYLSAFVQTLDRRGEREAPLRHALEMLEPYLTALKEPREGRETRARAH
FT                   MFGYVNLLKVDFTY"
FT   CDS_pept        408928..409302
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1070"
FT                   /product="putative ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25950"
FT                   /db_xref="GOA:E9ASM7"
FT                   /db_xref="GeneDB:LMXM.36.1070"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM7"
FT                   /protein_id="CBZ25950.1"
FT                   /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYM
FT                   RKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARKED
FT                   RSAKAKAVRAEVAERKAAKK"
FT   CDS_pept        410061..411797
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25951"
FT                   /db_xref="GOA:E9ASM8"
FT                   /db_xref="GeneDB:LMXM.36.1080"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM8"
FT                   /protein_id="CBZ25951.1"
FT                   /translation="MPPTSTRSTVGGGRRVYHLGNAVLSVVVFVITLVLSMVVLDPERS
FT                   SHLLSAQRRTPPIDFADSVLVGGFTPVVVGVNKHTVLVVPAAAIHGTRYVSRALDSFFS
FT                   VGLGSASGTGSAGYGEEAERHWQGMVTLSDVYSAVLLRKGVTDGTQAPDATAETVETSP
FT                   QSSRQPSVLHLCSALSCVTPYVAQQWSDRAAAALLLTKKTNDDATTVRSRARPVTNFAL
FT                   VFGEAGESLAVMRELGEHRVLTAQIPVAHSDHPQSAMPLVGKLELADLQASCSPLKQCS
FT                   YRSPVKHAQLATLLKAQAQHLPEEASRKRLFQEWMRRNDSQSGALTWGTVDVLPFPFVI
FT                   FEKSYTLHDFPLDLVHVDVGSADSVAALAYLEALASATATAENLRPRNLLVSVFASEWV
FT                   NAVVETLLLLEVEQRYSAIPLHDSCLGLERNFTPRQRWSLSHMRSWMGKHALEGAYISP
FT                   SLERSRAAQIPLCTVLLSRQVNTLGELLQMASNAIGSCPPAASPVERFFYYSLGLSPED
FT                   EGLLTPLPEAASGAKTFAMASTSDVVRGVIGLVVQYIYFLIPIGVGFSLMRNLCRRRRV
FT                   CG"
FT   CDS_pept        413218..413679
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1090"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25952"
FT                   /db_xref="GeneDB:LMXM.36.1090"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM9"
FT                   /protein_id="CBZ25952.1"
FT                   /translation="MVSFLRTFVVLCIIAGVLLQGGTAQAPPRAVRSLETKFNSVTQAC
FT                   RGVLETECPSDGLARTDCLMEHIVDNANHECKMWLSWRATCFAYATVYLIPQGKCNFKP
FT                   HQATSELIRNCLRNTDKSELPAVCAGSPYYRSLMLRASRRMDSDAAADL"
FT   CDS_pept        414586..414960
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1100"
FT                   /product="putative ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25953"
FT                   /db_xref="GOA:E9ASM7"
FT                   /db_xref="GeneDB:LMXM.36.1100"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASM7"
FT                   /protein_id="CBZ25953.1"
FT                   /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYM
FT                   RKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARKED
FT                   RSAKAKAVRAEVAERKAAKK"
FT   CDS_pept        415628..417286
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25954"
FT                   /db_xref="GeneDB:LMXM.36.1110"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN1"
FT                   /protein_id="CBZ25954.1"
FT                   /translation="MTSTITAVNQTQSLAAIRNFVRASVSCITYARGLCSDNAFEQRPF
FT                   LGLPLRQLIPSTTESITISEWIEKGAFDALNRNYLKEMSLCVYDAACRELLESYCFGFN
FT                   YTGDGERAQMTLNASQTIADGANTAAVSQRSGGAAGIPAYRKRRCTKQEVQHLLTSILE
FT                   RLMDVVESLPPLLSERVLTMRLTYYDEVTPASYEPPCFAPASEHMARLYQNEVRHHVHI
FT                   GSMDTSHHLFSVAIRHPLLQQIHRQVAGRTTSAAAAATGRAPLVVGKSAEVSTPSDPLR
FT                   SGWESSFSSDPPVASAVAATGATVTQGVVANHVSCGRPLCGDGECAAFDAERAGEENAA
FT                   CSSLGEVGRGGAVAACTSETLRPCEVAKLDGLYRLLEKSTSGGEHRLLRPAELTYLLFA
FT                   AFVLTKAPSARGGRGELRTDEVEAYRALHCPVDVSAKTVLLVLQRLSTENFLEPCNARG
FT                   ASAPKKPRVQEERTPIPAIREWLVPDPPASLLQQLMQVDALTELLTHESHLILQELSVY
FT                   LTREEWRRAPRAMTAKANAGRISTTGGSGKRRSSR"
FT   CDS_pept        418716..419807
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25955"
FT                   /db_xref="GOA:E9ASN2"
FT                   /db_xref="GeneDB:LMXM.36.1120"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN2"
FT                   /protein_id="CBZ25955.1"
FT                   /translation="MFRSASTSPQTLALLARSAGAAVGSAAASSSAYVTARRGYHGFQF
FT                   ASFHGWTLPYGGKSTRVTKEELEHQRFFTERPREKWDYHRVDENINSQSEFRSQEGREQ
FT                   FYQGSREDNSTMSHGSLHTPHKYRLYEYFDEYTKPGVDRKVAAAYAVKEQWDAEEFYYP
FT                   GEAWQRNRPGFRSVPKELLNRQTWYHWSHALTKWDEIQPTIRTRSWNPDWPPPGYEVPK
FT                   LQCKKEFYFGMEEEGLVSEVERYSWFRSWSDNNMRVGWREIPLFIILFGTLYFFARNAM
FT                   SVTAMRAMSSNMYYPGRTMIRPFGVPKDWETECFWWQRPLEEFPNQDQVWYWNQARFGY
FT                   INYIKQRDAREKAVADAEAPAAE"
FT   CDS_pept        420951..422315
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1130"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25956"
FT                   /db_xref="GeneDB:LMXM.36.1130"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN3"
FT                   /protein_id="CBZ25956.1"
FT                   /translation="MQSYQRHLTLSSNPVVVFIVEHQATAVANVWAPLLKSVSKGFDSF
FT                   GIEVAHASTSSEIGQQLLEVMNAGSGPIILFFQGVGDTPAEGGKALKMPIAYEGNIDIV
FT                   HIISWGLSCISSSVTHRVHNDVDLARFFAQYPKYPALPHVLYFPSTSYTPGGYLALSQH
FT                   FALDAVFGVVPNAFTAPNATLVAQRYNISSKDELPVLLVLHRSGADDGGGAGESDRVVR
FT                   MPTTLTSLSYREALAFLSTHITDTVAALVAKAQSTRNQHFFEVAESRRVYMMEQLIERQ
FT                   LDIVKEERLQMAREPVLVKEQAVWAKECMQLPKKHRCLAAFVDSTHDPAAKDNAIKVLS
FT                   LVSVKLLEIMGREAQKVSLVVVDREGSDAVREYFDVGHNGFPDVLFLSLDRPAKYYNFV
FT                   GTFSAEGVTQFVASHDAHLTQNDVRGGHTFIPRMVPRLEEAVAVPSSGHEDEDDL"
FT   CDS_pept        423445..424362
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1140"
FT                   /product="short chain 3-hydroxyacyl-CoA
FT                   dehydrogenase,putative"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25957"
FT                   /db_xref="GOA:E9ASN4"
FT                   /db_xref="GeneDB:LMXM.36.1140"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN4"
FT                   /protein_id="CBZ25957.1"
FT                   /translation="MLRCTPSALFKSLAVWGGGTMGSGIAQITAQAAVPVTVVEVSQAR
FT                   LDASRKAIETSLLRIANKKCDGDQEKMKAFVDTVLSHVTFTTDEAAAAGDADLIIEAIV
FT                   ENIGAKKELFGRLDKMAPKSTVFCSNTSSLSITEMASATTRKDRFAGLHFFSPVPMMKL
FT                   LEVVRTEEVSPAIIEQLTAFGKRVGKIPVVAKDTEGFIVNRLLVPYQMEACRLVERGVA
FT                   TFQDVDTAMKFGCGYPMGPFELCDSVGIDVIKFIVDGWHAQYPNEPLFKPSPLINERVA
FT                   AGKLGKKTGEGYYKYDSKGRKIES"
FT   CDS_pept        426214..428997
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1150"
FT                   /product="putative endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25958"
FT                   /db_xref="GOA:E9ASN5"
FT                   /db_xref="GeneDB:LMXM.36.1150"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN5"
FT                   /protein_id="CBZ25958.1"
FT                   /translation="MTEYAGSQTTRQAQSVKSTPLANQTRVSMPAATALPSTSDIEMYP
FT                   RALPPLARNGAWSDNNTACSAQYNVDPSAAGNVSTTTATGAAFPDSSSPSTRTNRDPSR
FT                   GPLRLGVSDPAPSPLTSTASPNTAPALSGQQVLHFPRKPAGSTGAPRMPIGLTSVSLKN
FT                   PEENDTCPQLQSTGQGDEAARRSSQKACNPAPTEDYVHKCADCRPPLTAEQRPRGREST
FT                   AALHAPPSRSDNTEVDFLARQFVQRTVLWSSMCNCVSQRESPAHRNRDELVKSTLRNVS
FT                   VGAGSSACLHEVTASVPVFSKTAGASSRSCVGVVNSTSVHSSHRDETDNGALGDSPSTH
FT                   ADNPALSTRETFPIPRCCPDDLLRGDDKIWAPGKPLRIAYVTWNMASRRPRTGEISAYC
FT                   IYPNAHLVVVGTQENGPYVSSNEHQRRWTKIVSQVCLGGQYELVGKHHMWAVQMLVFAR
FT                   RRDVAHYISRAHASHVKTGVLNGLGGNKGGVAVGLVLSLTPKDAAPPHRAKAHLTTASV
FT                   PQTLPLKSKTAWSRVMPMKRAATTPQNLDSSMVAGRESSAAFMMSKSSANRSVEIPPAL
FT                   TSDPYMLHDADDEYGELLHKRSFPDGNSTGNFFFDNSDTVVDNDGAFSPAEVISRNTSS
FT                   DLTTEHGDDDHSDCHTQRSENGMDRHERCGGDDDASSDGKPDRVTPNYMTLLFITAHLT
FT                   AHQGAVSNRNKDYRQIVYGLQLGGRGPHRKFFKLLLGRKKVLEGDDEEASDEDDEADCW
FT                   EDNSPEEGVTPLRLPAVSGVEQKRKTRRDVTEEFDLTLFGGDLNYRINGTRKAIEYVIQ
FT                   HHSNIRSILINNDQLSLERARGKVFQGFQEGNLLFRPTYKYEVSAGGGVTLNEYNFSHK
FT                   KNRMPAYCDRILYKKRITSAARRVAIRLYTDVPNVRSSDHRPVVALFDVGTRAYTD"
FT   CDS_pept        430699..431811
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25959"
FT                   /db_xref="GeneDB:LMXM.36.1160"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN6"
FT                   /protein_id="CBZ25959.1"
FT                   /translation="MNSHKQKRTRSKRLIRPHSTSTTTHHSPALLSQITTPASASRMRF
FT                   VRPATHAAPHGRGWYEAIPERLKVTIDDYFSEATHCYDNEGKECARMTCLIAPHAGMSY
FT                   SGRTAAEAFAVFREYLYAKGSKGCELERIFILGPSHTKGFEGCELSAASAYETPFGSLK
FT                   VDTAAVDLVITDLRKAGVGAATASRRTDEAEHSIEMETPYLSHILHYPPTTTGAPAQPA
FT                   AGRVSIVPIIVGWTTRQDEKAIYDVLKPYMDDARNFFIFSSDFCHWGERFSYTYHYKRS
FT                   EYPHIGDSIIAMDHAAMELLEKRDLEKWYAYLQITKNTICGRAPISIGMQRWANEVNKA
FT                   QVKFVHYSQSNKCKDADDSSVSYAAAIIME"
FT   CDS_pept        433531..435444
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25960"
FT                   /db_xref="GOA:E9ASN7"
FT                   /db_xref="GeneDB:LMXM.36.1170"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN7"
FT                   /protein_id="CBZ25960.1"
FT                   /translation="MKTHRRHATVEEVVDPSPFDYTLLSHLYVHSDGTDVIDFSGLAPG
FT                   RESRCRVNSFFKNRSFVPGVTEVEPETVGSYLHLRIDENDGNTVDASECSKIPGAHTTA
FT                   PPRGGSAPASNLVRIEDSAEHWWLMCQATEDTAPYARLFNGAGDLLSYLEHHNLQLPTG
FT                   TSWVSDPSTDAGLPHGGQPQPYHDSSNSVTGSTTPVLPLTKWLDIQIDRSNSRSAERVT
FT                   QLLNRLPISQETKDSCLYLSTVDSIDISVLTTGEVSSTMSDYVFLNVMCTPVVENDANG
FT                   AGAAPATTASDEKRSLHKPDGGKFGVSSTDKKKGPAKSGKTRKRGGAHIPSQGTLSTTR
FT                   SVMEMRFEAVRTGAPRSSVPEPVAVAVIVFADWMFTIHEKPFAEMDDMLRMVQLHCAPS
FT                   EVTTSHLRYAPALSPTMQRRFTAPFAMSVLLQIVVGHHLDSITLAKAVDALGECVFDVR
FT                   ERKKDQDAVLKHITAVRRCFGECGTETARREVLFASLLQPMFADRFFVADPTIRRELEN
FT                   AQAHLRHFQRDIADCRDTVALSNWHNNVAIQWVLLRRGNRALRMILLLAQMTNIMQPIV
FT                   IVQTLYAMNVPLPFEAEGDPPHTTLAPFFVLAAIFFIYCCLTVGSIRRTVVRKSFETRL
FT                   LA"
FT   CDS_pept        436885..437889
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25961"
FT                   /db_xref="GeneDB:LMXM.36.1180"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN8"
FT                   /protein_id="CBZ25961.1"
FT                   /translation="MLCRSRATFPRAAVAFFNMKHFQTKKKYNLTPQNIYETFSTVLSP
FT                   RDRLLRQSVSGGGGSRVLVLDAQQRVKGVYLPVFCMPHPSTITNGSNSLGVAVSDYTRF
FT                   IEATSAMHKAGGGGTASTLPTVLVVLSHPQGLAYGTFRADGIPGVPMKNLALAPTLVNA
FT                   RAQQKSTNIASTPLRTSGLGTVIPLLNVSHGRVDVIRDIYKELNECERVAALKACSTFV
FT                   WAQKDNTSSTTFETAQSSERYWERAKRDGDAAMAPPPGAISFLDRRWVLVTDVALHPDT
FT                   GVGLYARDPATGDRIVNATGVQSALCRGLLLLDHVPRTAAETGTANTDTRTSG"
FT   CDS_pept        439174..439596
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1190"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25962"
FT                   /db_xref="GeneDB:LMXM.36.1190"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASN9"
FT                   /protein_id="CBZ25962.1"
FT                   /translation="MRRATCHVSVRCTQPAAALTPVRTIIAAKGIVENRIAKHYTNRTV
FT                   DESKVEQAESVKKTLHPNPRNRKEELSHLTQHCSYEYVPEFQRWANDMMAVYSDPQGYG
FT                   HDMAYHYQRIWKAKSLTRRGVEDGSGAFDVCRVHPH"
FT   CDS_pept        440994..442877
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1200"
FT                   /product="putative GPI anchor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25963"
FT                   /db_xref="GOA:E9ASP0"
FT                   /db_xref="GeneDB:LMXM.36.1200"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039521"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP0"
FT                   /protein_id="CBZ25963.1"
FT                   /translation="MDVLGAFSRWPRPLQSWWLLLLLLLYRVTLCLTLRTAESPDEWWQ
FT                   SEEVAYKMVFDRGQLTWEWDEAIRSYVFPAIFAGPLFVLKWTGMDTAVTVWASNRCVQA
FT                   LIFFAHDCTMLALAQRLDDLWSCLNRRKSGRDAFSAPLSSSVSESTKAKRRAPTIASTT
FT                   LAVVVVEWFLIGTGVRSYSNVSESLFFLLSLYQTSYPSFLLWAGVACAMRVTAAIATLP
FT                   VFIMHACRLCGKMGVARGLLFTALITIGMVAAISASVCLIDYIFYKRLVFTPYNFLKFN
FT                   CLLGMSKYYGVHAPYWYFVTLPAMAAPFVFFLAWMPVCWSCMQEMEKHHSSGSAPRVQS
FT                   TLFSGSSSWTLRQEIQRWFFVSAPTLMVYSALDHKEMRFIYFLLPLLLLISSVVVVVLC
FT                   PGSLSALKQSSRVRSRSWCLAVPSADTVRRLFTLSWIATAVFAIVLLYGYRRGAPTLFR
FT                   AIRSADQHYRHLEILTHCHATPGFAQLHGKVDRVDWVNCRMKLDAVSGVPEVTQDRLFT
FT                   EQPKAYALWRYLRDPSILDVEDVGKESASKLGKDAWWREMHRLMPKGEAPALPDGIILF
FT                   QKIAILLETDFLQPMGYHRVAVVYHAPHSFEEHEDRYLELWSRETAQKRES"
FT   CDS_pept        443630..444394
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25964"
FT                   /db_xref="GeneDB:LMXM.36.1210"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP1"
FT                   /protein_id="CBZ25964.1"
FT                   /translation="MATSSPRTAMFSSAAMKQYLQQSMEDDVLCAFGPDYFYGARAGAC
FT                   VGSLFSATLCWYTFRLLKEDHREADFLAGLKQGQRNPHFSTWTLLRGLRTQPMLTTGCI
FT                   ALAITSAMKCVKCYLANLRCREFFIDDVHFDMISKLSETDSEARDFMATVSHNATGCGA
FT                   GAHDAFPTFREDCSEGQPTQSPAPRASASRSTVNGLFHTHSSRLDNKESTLIHRAPTYY
FT                   DGVAVALLGSVLDCYLPQKPVQKYYNMRVGTW"
FT   CDS_pept        444985..446481
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25965"
FT                   /db_xref="GeneDB:LMXM.36.1220"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP2"
FT                   /protein_id="CBZ25965.1"
FT                   /translation="MHMKSSTDRPTTTPLAADTAAYATPQTHGVDSVDGMFGSPLQLDS
FT                   STRGTAELHSVLESLSLVTVPNTTSSSQSNLSLAENLLADKDGATTRSSNADHDDATAT
FT                   LWWRYATEDERQNFFASNVTGKDDGSVRGAGNVRVCVKAPVEGQERLLPGGVSPKTTSF
FT                   STKCDTSHVTAPAREFSAIWNPQGMLGGTRETLDTRPSVDDASSMVAVVLSEEVPDDLP
FT                   RAPSTYAELRSSPSTPSVNTIHLNLQYTRVTSFMSISSPFSASVQSISFLRTSVQHLMS
FT                   NSQHFYASSSSCASANEVPLFGEVGVAEQKPFCASLLETGSVVTQSALEPAKLREGTFA
FT                   PSSVEARGSSEVVPLIDLSAISAADNASMAQEASPRNPGAPTLPCTPMAYRAVTTSVEG
FT                   CLLEEEQKRMALVDGQASGIETILAREVSAYLAMSRQRRRAPRQRSEYVGVTEQRKSVE
FT                   EKASLLHDSMQARMRMAEDEHENFMSSYRQIDQVQLHNAG"
FT   CDS_pept        448221..449966
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25966"
FT                   /db_xref="GOA:E9ASP3"
FT                   /db_xref="GeneDB:LMXM.36.1230"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP3"
FT                   /protein_id="CBZ25966.1"
FT                   /translation="MKSFPLQHKMMQRLKLPYIQVGTCEVMNLASSYNMDSFNVFNGKN
FT                   RGLYQSTAAGATPRASTTPTDGPATWSLSQRQDPFLGEMVAGGLLDSYTGRQASTFVST
FT                   YLAKALSMHTVLPSELRSLRKEDPTNPLLAVMMAALARRRGMHTASGSLVTEWELQQYA
FT                   ISADAAFFRMCKDGGRPPYPSSAQEQRDRDAGAESHRPSPLPPEESGCRGVWFSATVTP
FT                   TWLAEQQRRALTEHKQRLAPSPQRTLAGAEAAEEREIRELLANAPFCLDIAVSCLGNSR
FT                   AFGVARNALTGGMQSRLDASRERTVPLSIDHNPLRTSEYRRVVQAGGIVDSTVGDMIDG
FT                   NPYYNVARSFGHWSMKKDGRRSPVEQKMIALPTVKTWRMLAGDALVLCNHAVFETRHQD
FT                   DSSMDELAKVVGRGLSLDLPPEAIAASLCDFAIRFGAEHSLQVMVAVAGSAAGTAASGD
FT                   DSGMSAPEFAEWVDPGPLYVGACQRFPELRRRLQQDCARCEITLASLIRRRWERVRDLL
FT                   PTRHSLSLLPYYGKECGALQQIMEEEAIFFEHEILRDVTDVSDPRLDVVFQKLAKRLQP
FT                   SAPVA"
FT   CDS_pept        450509..452830
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25967"
FT                   /db_xref="GeneDB:LMXM.36.1240"
FT                   /db_xref="InterPro:IPR035155"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP4"
FT                   /protein_id="CBZ25967.1"
FT                   /translation="MRCASFTPTATPAVARSSNLRHYRALLQVMTYAGQREQTAEQVIR
FT                   DAMVGGVVVPFTVMHNTNALAVAVKTGDPPCITPLDAPVSADNLSREEVGIITLLMPSS
FT                   KFIGTAASLLADGFFSFAPLSSTVDKSRSTSYQHRSECQVRDLFTLIMLLFPECFIAET
FT                   LPRTLLEMREAEGSVSDTQSSNRAESEVPHPSSVSRVSPPISPTPPILPRGQGTQSAER
FT                   IHASASEGRGIAVDAESLSNSIVDATVGGFQAGPLEGSLGVLTPAKLVTTDTGATDGEG
FT                   LGVSSTSASMTANLMTLPIVNAVPLSLDVLDVLLESRQSLAVVLLSLINDAVREVQYRQ
FT                   LEQSHTSTTATGSTAAARLPSCEGGVLQFSAEVLLTAKLLLMSVISASAVWRQRFSKTM
FT                   ESAKAVLQGAAILPLPPPSPFHVFSELLGEDAEGATPFLTVPVERWSWGKEKDALGQWY
FT                   DRLLDRLLVATDAAGVGLDAYLKSAKSTAVSCGRSVSAFPALLLHQPSDGQPAVEMNLA
FT                   SVARLSGSVRLPSLPIQQGELHLLLCPGMQEDKTGVPQARGHELLLDATASPTADFFQA
FT                   CASSACTEAQLQASGDAVPWLFRQRFTELSTTEQGIVTAALCDPATLSAVLEKNAAMLA
FT                   RLTLWCRNRWPPTLDASTVLASTARQSHDEVNENESPQAVHSIGDQVEQHILFQRPFSA
FT                   SVGRYVRELVTLRGLSKDVLEAWMRHVCTGADAAAGAAVDGSIASPHRAMFSALVKFAV
FT                   LHNRWQLHPEVEALQKEYAM"
FT   CDS_pept        454638..455207
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1250"
FT                   /product="putative 40S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25968"
FT                   /db_xref="GOA:E9ASP5"
FT                   /db_xref="GeneDB:LMXM.36.1250"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP5"
FT                   /protein_id="CBZ25968.1"
FT                   /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVN
FT                   MTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPDIL
FT                   ERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADASPF
FT                   GNGRPGRVKRVRAKAAKRRAGGDDDK"
FT   CDS_pept        456180..457295
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1260"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25969"
FT                   /db_xref="GOA:E9ASP6"
FT                   /db_xref="GeneDB:LMXM.36.1260"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP6"
FT                   /protein_id="CBZ25969.1"
FT                   /translation="MSRVTVFQSQLPAHNRLKTPYESELVATVKKLTTPGKGLLAADES
FT                   IGSCMKRFEPIGLSNTEEHRRQYRALMLEAEGLEQYISGVILHDETVGQKAANGQTFPE
FT                   YLTTRGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYAKRASAYYKKGCRFCKWRNVYKI
FT                   QNGTVSEAAVRFNAETLARYAILSQMSGLVPIVEPEVMIDGKHDIDTCQRVSEHVWREV
FT                   VAALQRHGVIWEGCLLKPNMVVPGAESGKTATPEQVAHYTVMTLARTMPAMLPGVMFLS
FT                   GGLSEVQASEYLNAINKSPLPRPYFLSFSYARALQSSALKAWGGKESGVPAGRRAFLHR
FT                   ARMNSLAQLGKYKRADDDASTSSLYVKGNTY"
FT   CDS_pept        460469..462379
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1280"
FT                   /product="tuzin-like protein"
FT   gap             462958..463057
FT                   /estimated_length=unknown
FT   CDS_pept        464687..465316
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1270"
FT                   /product="amastin-like surface protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25971"
FT                   /db_xref="GOA:E9ASP7"
FT                   /db_xref="GeneDB:LMXM.36.1270"
FT                   /db_xref="InterPro:IPR009944"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP7"
FT                   /protein_id="CBZ25971.1"
FT                   /translation="MPAFNLASLRSCLLGAVADNVLLLVYIILQFIAFFFVLVATPIDM
FT                   FRRKDVLPDGTFTCYTLWGFKSDCYFLHYLFTINEEFSQCPALLHRFRAAQAFAIISIL
FT                   VYGGAFVASFAILYGYSFIRWVCLALNIVGIVTLCVVWAAMAVTYNSNDDSQCLRFKNL
FT                   LTYGAGFVLFVIAWILDIINTVILLLPCTVTDSDEDKHTKRPAAEE"
FT   CDS_pept        469564..470145
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25972"
FT                   /db_xref="GeneDB:LMXM.36.1290"
FT                   /db_xref="InterPro:IPR039963"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP8"
FT                   /protein_id="CBZ25972.1"
FT                   /translation="MMESYDTITAGKRLTPEDLDQHIKRLTAPRREVELRDPFEVCPTK
FT                   RISPEALSRMTDRLYTQSLQHKQERLAAAEQAAYGAHTRGTLLRAAPLSPQDEETSVKR
FT                   LFNNALERKQANMEQVRHQHQYHRPTSETKVPLKSFVQHMYYDRLEAKKKTEKRLYDTY
FT                   LAPTEIHTGTISRAQADEASNRLCTTKAGA"
FT   CDS_pept        470574..472418
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25973"
FT                   /db_xref="GeneDB:LMXM.36.1300"
FT                   /db_xref="InterPro:IPR035426"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASP9"
FT                   /protein_id="CBZ25973.1"
FT                   /translation="MYACTRRIFSSAPLPRIISSGDDTHDIIESGEVLPILLLFLFLSV
FT                   PAVYRECNRTFPHPPRPPTHPPVFHMADAAAYLKLGKKIQSSRFGWAGVAREEATVPNN
FT                   DGYAASASDGGTSGIYVTSNSTTSGLVVVQVHDAQREVQQLPMKKKRLAKRSRSGSDEK
FT                   DRLAASPVKSNAMVTATPATSTGQPLSVDLSPRGVTFEDGLNLTNVASPTAPVPPVEGV
FT                   AQRINLMAKWFPASLQERKLDAAVAPSMMFVEATVDRVNKMREYVLILRYGIEDVEALL
FT                   EETRQTQSNVWEKESVNDNSTHQGSRRDYWDLSSSDVRELVRSVGLPSFTQALAEFSDA
FT                   VFSSHWSAAAAVYRLLSRRRRVCAPMDYNIKAWHDYLNNHGPEGGCAPRLSDILWLSAA
FT                   STSAMFTATASRLLRGARSCAEQISVSDASLDDRASCSASESDAGSSDRPRFFDNTEAA
FT                   TEENEPVPTRVWLLTAPVIFPTTLSPDQRAVLSFLRFLMPTSHSSRERTTSVGYGVWLF
FT                   AAFSALDIPLDPDTDRLAHDLFRTCCRHLRTLAAWQGVSGSTRDLLLSKLHARSSDAAP
FT                   PLYASLDDICREDVLALYTIVVVLARFFRQNQDHFMPL"
FT   CDS_pept        473834..474607
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25974"
FT                   /db_xref="GeneDB:LMXM.36.1310"
FT                   /db_xref="InterPro:IPR040747"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ0"
FT                   /protein_id="CBZ25974.1"
FT                   /translation="MFTLLCCADLAGKKVNLEIALDTFPATLRCLESDIARIFNREVEE
FT                   SGGVEHSTSLTEAFQVMSVFIYDDVLLRWTTLKSLTQLHEYDQLYVFQPQTQWHVDLQK
FT                   ELPPPRPPARSRASSMTGTLGAFASLHANCRASSPWPKSGISTRVSAAGDVDPSHSSVP
FT                   SRSPARAQLEEHRREEERLGHQLSTLRRERERLEREAQREEEEERRRRSLETYRVLKCK
FT                   EEEIWSQRDALARAEEEFRQFLVEKQRLMGQSPTP"
FT   CDS_pept        475408..476679
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25975"
FT                   /db_xref="GeneDB:LMXM.36.1320"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ1"
FT                   /protein_id="CBZ25975.1"
FT                   /translation="MSYGSYAALRSSANALRRPKSDYGISLEAKGRSQGKISNKRTSAS
FT                   SYTAAEQTGQHLSSPRWPFICETACVKQPTTTAAKRTTSLLSAPRGQRTSTPQRGQTSP
FT                   RGEQHVTIAGSDHYMDDAASALLSELQQVVVRVSHQMVGERRCAAQQRKQIRALETIVA
FT                   EQDAMLDALRTHCDAAQCENSQLLKGYQQELRWRGADSAQATRRSSDICGTSDTRVSAA
FT                   QVDTVVLAEFRRLSTIYESCSFSGFDDVTPIVAAVLRSLATQLLQLRGAARNDEAEIRN
FT                   MSKDAQPAPLQPHAASPPLRASAPATTASSFMPAFNRSAAPTDDRGKAGVVNRVTSVAV
FT                   LEKRKKTSMFAAAITRRNHSPSETAGRTNGEQADFHCVDVDAGTNGDAEAAASMASEAN
FT                   ASIASSVYEDAASILSDIRARYGL"
FT   CDS_pept        477138..478541
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25976"
FT                   /db_xref="GOA:E9ASQ2"
FT                   /db_xref="GeneDB:LMXM.36.1330"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ2"
FT                   /protein_id="CBZ25976.1"
FT                   /translation="MVHTPRRPYLHESRPHRLYASAPRFHFVSTSFLIFSHTWTTIYVT
FT                   TYLSDDAPLRDTLFLVVCEVDNLSVTGDSTTTHPVSTLHIRPHRLLRTDTLFFQHSVSM
FT                   WKTVCRSKGAASAMLSVRCRPAMCCRALLGTRSSFLSGVVSTTGPVLVMSGRRWCATTP
FT                   PHGTGSSGSQSIDEEAVVRAAKWSSSNFEERLGFRTGETITEERLKRHYRILAKHYHPD
FT                   TAAGSGRGSGVRYEGETSAGKDVAFQNIKEAYDVVNAAVKRGGRRGGNASRGSATADFA
FT                   GGFEFSDEARRRSQMRLLGDAVLLFIFMTVAFIVVVSSHNKSRMQSRYLWHLVGIFFII
FT                   QLFPRLFAAAILFAVHSMHLLEKATLQEQAAISLIVERTERICSVQLEGLRTEAQPNVV
FT                   VQVTTTADANNDAAERVSSTLTFDKGVTAFTLPLPVDSSCVYHVKAVDEARKIVLVDRS
FT                   LSARMPATV"
FT   CDS_pept        479478..481613
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1340"
FT                   /product="putative N-acetyltransferase subunit Nat1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25977"
FT                   /db_xref="GOA:E9ASQ3"
FT                   /db_xref="GeneDB:LMXM.36.1340"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ3"
FT                   /protein_id="CBZ25977.1"
FT                   /translation="MSSASSTLPPDQQRLFDRMNREYSNREYSKALRTSECILRVVPDH
FT                   VDTFAGRGLVLYNMERQEEGYESIKQAILLNPKSMVAWHALGMCQRLDKKFGEAVKAFK
FT                   RALTFDPANTEVLRDLASACIQVRDWPLFLEAREKMVTAKASVRANWVALSCGHRILGH
FT                   SRIAAAVMDTMTSIMDAGDNPVEVSEAQLYRVELELESGAPQRALELLKKHDSEIIDVE
FT                   TKLLLRAKAHAQLGQRMEAEKRYIEVISMGVSEADSIAALAHLRKIPLDRYLRPAAEYT
FT                   EKYMEIIDRVLKACPKCHYAKRHALDCVPIEEFRERLAAFTTPYIQRMIPSLFSVLKSL
FT                   YVDAERAIIIGDVFAMMERELEAKDFSRFGEEANPCYILWVRTFLASHYRRTGEYALAH
FT                   AYIEKAINHTPTLELLYLEKAKIFAREGKTAEAAEQADLARRLDLQDKYLNSKAAKYYF
FT                   RDNQVEKGEATMQLFYKPSVVVGDTYLTALESQCYWYEREVGEAFYRKGDYISALQNLL
FT                   MFERHHEQNHCELSDFHNYVFRRNTMRPWFDVLDCDDNMGRNKFFLKFCPAIVRTYMRI
FT                   HEKGEEVVRAAHVPRPELKFDEVAADEVKRVKQQQKDYYIGDVVLSEPLVKASRYMGYL
FT                   LAHRNTEASTHTLAIELYTAAEKPLLVARALLALHQQRYKKTKDLAVAFKTGLYTTTTM
FT                   DSRVQAIVDEILATVLE"
FT   CDS_pept        482514..483233
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25978"
FT                   /db_xref="GOA:E9ASQ4"
FT                   /db_xref="GeneDB:LMXM.36.1350"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR019406"
FT                   /db_xref="InterPro:IPR036957"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ4"
FT                   /protein_id="CBZ25978.1"
FT                   /translation="MPKLCVEYSKSGRAKCSNTSCGKKIEKHELRIGTEVIMSFNEEGV
FT                   ESWKWRHLCCFTERQLSNARSSGDIDAIQGEGDLAPADKVFVQKMREGRLVGDTSILGR
FT                   IGDVAHSAVAEELKEKGSKAAKPKTKASGSAVDGGLPSASTGEKRPRAPPRKTKMPNTK
FT                   IQDDDVDSEATDEYEVAVEAVTGKPKCPYGANCFRTNQEHFRQYTHGDENGTATDAAVP
FT                   SDHGGAKLKPVIKRRKP"
FT   CDS_pept        complement(488450..489112)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1360"
FT                   /product="putative adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25979"
FT                   /db_xref="GOA:E9ASQ5"
FT                   /db_xref="GeneDB:LMXM.36.1360"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ5"
FT                   /protein_id="CBZ25979.1"
FT                   /translation="MLLSIILFGPPGSGKGTVSHLLVKEYGFVHLSAGNLLREEVLKRS
FT                   PLGLRCAEMMSEGSLIPDELVVDLVCNRLSDQAVQKHGILLDGFPRTLRQAEVLRTRGF
FT                   KFDMMIFLDVSPEVLLDRCLSRRLDPVTGRIYNLKSDPPSLDIVDRLQIRSDDTKEKHE
FT                   RRMQVYNSQKATLIAHYSDIIIEVDAEPEIKVVFKELQMKINKRLQGTTTQAPVAKL"
FT   CDS_pept        complement(490580..492937)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1370"
FT                   /product="Transitional endoplasmic reticulum
FT                   ATPase,putative"
FT                   /product="valosin-containing protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25980"
FT                   /db_xref="GOA:E9ASQ6"
FT                   /db_xref="GeneDB:LMXM.36.1370"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ6"
FT                   /protein_id="CBZ25980.1"
FT                   /translation="MADAVGNTNAKVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFRG
FT                   DTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIVPCKDVPYGNR
FT                   VHVLPIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGAMRSVEFKVVEVDPGD
FT                   YCIVSPDTIIHSEGDPIHREDEEALDGVGYDDIGGCRKQLNQIREMVELPIRHPELFKN
FT                   IGIKPPRGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFE
FT                   EAEKNAPAIIFIDEIDSIAPKREKAQGEVEKRIVSQLLTLMDGMKSRSQVIVMAATNRP
FT                   NTIDPALRRFGRFDRELDIGVPDETGRLEIIRIHTKNMKLADDIDLEKVAKDSHGFVGA
FT                   DLAQLCTEAAMQCIREKLSVIDWEDDTIDVEVMNAMCVTQEHFREAMAKTNPSALRETQ
FT                   VETPNVVWEDVGGLLDVKRELQELVQYPVEYPWKFEKYGMSPPKGVLFYGPPGCGKTLL
FT                   AKAIATECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSVAKSR
FT                   GAHGDGGASDRVINQILTEMDGMNVKKNVFIIGATNRPDVLDPAIMRPGRLDQLIYIPL
FT                   PDKASRVAIIKASFRKSPLASDVDVDQIAAATHGFSGADLSGICQRACKMAIRESINKE
FT                   IQLEELKKSGQLDENADIDPVPEITRAHVEEAMRGARRSVSDADIRRYDMFKTSLQQSR
FT                   TFGASNPPPAEAGAPAGSGAPPPPADDDDLYS"
FT   CDS_pept        complement(496035..497903)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25981"
FT                   /db_xref="GeneDB:LMXM.36.1380"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ7"
FT                   /protein_id="CBZ25981.1"
FT                   /translation="MWLSEWFSALFILIGHDAHVQVTACLFPCALAHAPFPKASSRIWT
FT                   DRDTPHWLDGRADVCARTKTRASKLVPMTSTLTNSNRINIPAVCRLRERNTSKTVGSGV
FT                   LVAPGLLLTSATAIPTQSRATHVVATFFEGTKKNAVDVPLQPQRYYFASRYPPEMDYCL
FT                   ISCEEAPLFNVTPVHMALTAKGWAPVEEGDVVLIVEHPIGGVFGTAAAPLNGKATSPST
FT                   LSETGESNFDSVQAPYVEQKRFEEVLRCRGNVSFLKSNGSWRTAGCPAFNEHGHLVGLQ
FT                   SQSRADGEGVVNRILSLISIVKHLFANVQLPHLPQEDITFEDVWDTWYVTNDITRIIAI
FT                   LANFKGKSMAQQVTWRLCELTAKPQLVKSIASNGGIEVILQNLSLFCSDEKLSEIGLRA
FT                   LWNVSIGEEAHLAAIIKREGVHTILNVVESFPANETVLEFGAVLLHNIAGCRAAPNFSE
FT                   AHGARALKALYPGFQQFRESVVLQKFALSFFATLARLNEEFACNLVQQDVIDHIIHLIE
FT                   EKPKQIFLMEIVVGFVAELAQYPQTVELMCGKAPQYAAASMTYLIDLLIHIILEYKDLD
FT                   SLLVSGNRALWGLGIVPTCRGIILENPRGIDALRISLPALIASTHR"
FT   CDS_pept        complement(498496..501858)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25982"
FT                   /db_xref="GeneDB:LMXM.36.1390"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASQ8"
FT                   /protein_id="CBZ25982.1"
FT                   /translation="MRFSVVGGPLASTISLEAKHSDSFESIFQKVQEAAGKATPLDAYD
FT                   LYTTRRSSLTGELVAAAGPLRPTDTPSDLQLEVEQSDAHILMLMQRDADTPRATTQNQL
FT                   LCSNAASGDASRLDSTAIASTSTSLTTTPRVADEYRRRMRAMYLKYDPGQIHKVEVALD
FT                   RYRGYEEDVLQQLVKRYGPEPAPGEVHLSPTPPVVPSSCLDARESTPSHSASTNEANPD
FT                   RKPSYYDRLVAIYSTYEPGKLSKVNGTLRRYAGREEEVIQQLVKKYGPEPSTERVAAAK
FT                   VSEATNEQLAPTSDVARQQLTSSATNVEASAHASATVPAVEKQVAAVPEAREAAPLSLT
FT                   ATAKLVAATASDAPPVASAYGDSTVGMQPSNIEGRPLATVTSPLDSSVPRHTAPFTAVA
FT                   PPNKACTAESMTIGGNYRERLVSFYNAYNPAKLHTVEGTLKKFSGKEEVAIQQLVRRYG
FT                   AEPPPLRPEEAYRLLTAASAGGVSSTPPSASLATTNAPGTAATPTLGFEPASLAERADS
FT                   KLEMYKSGEEEVMAKSEVRYAAQCAKNIAGEPTTSGAGSSAESGRFDAVVATAQVSAAP
FT                   PSIAVGVPPSHRSSPSGTASAATPSTVESIKTASPASPVVAVVATPHTTRVGTVVSAGD
FT                   AMPHAQESKASQGSPPQRRALPLGALRVAAAHVEGAAHMSLRERYWAIWRAYRAQKRAA
FT                   GLLQQELWVETSAGAASGYRLNDSVEPAYTVANLSVVVAQEERGGCSTQGRALSSELQI
FT                   AMRALLSSLRHCVESRVIQAESTEEHQQANALLTHWAAPENLCPVTDSPELACALHQAA
FT                   HLIGKLEGLVTVIRTQAGQLHQLKSLHRDVVERMEHAHTNTQALGKLQAQLSAANSDRR
FT                   ALEQELKRISAGGAESHARQAPLCRVYPTAEERKDAQIAKLQQELAKTRNLLFLSKEAE
FT                   DKLKVQLHQSHTREARRKHEEWHRQGRSSRYSISDRAHAQPRSRSARAGNGVHSSPSNS
FT                   PYRRYTPVSTPRGAFSHAIAHDTPRGPSTLQVHVNGRPVSSIRRPDAVTAEQDRASTSV
FT                   NSSTPWPSSRYVMTPTEVERGPCPNCLTPLTSCCREESGAVSEKAAFCFSCRRYFTFGE
FT                   LWTGNARDVMRQL"
FT   CDS_pept        complement(join(502398..502700,502712..503263))
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1395"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /db_xref="PSEUDO:CBZ25983.1"
FT   CDS_pept        complement(508611..509942)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25984"
FT                   /db_xref="GeneDB:LMXM.36.1400"
FT                   /db_xref="InterPro:IPR023379"
FT                   /db_xref="InterPro:IPR038888"
FT                   /db_xref="InterPro:IPR042541"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR0"
FT                   /protein_id="CBZ25984.1"
FT                   /translation="MAESRWITEALVQFSASPIWLTPIDNFVDDNCCIFSNESEMQLEY
FT                   TVVHNKFKKLIDSLLTCFLMELGVSMETAVEALQSSLAVDEQTSEDRPEQKAAKELLKQ
FT                   ILNADNFSHFHEMMVKRNLELDILANAALSSDGVRVDGGAQTSAEVLKKETQATARVQR
FT                   AIDVNGDVNEDDALRRAIEVSLQDGTAQQQVQAYNEACIQEETDLQLAALEHKANREKG
FT                   QLQAALQAQSAQSHSEDVHGRQEHIERINKQKELQFQQIRDHAIPAKGQNGCDEAEPQN
FT                   ADFNSPESSCPVPAPQVAAAPSAPVAAPVSVPALPSIGQRQAALPAIPSTLTASVSKSA
FT                   PSAPAHQAHGAAVSATSAPTPAPTKEELEKRAQYMREQREKLLACNRASRQEQLNTFLQ
FT                   NNSPSTTTSSSAALAATGTAQSVTVEIARRLRGDLIGEARKSSG"
FT   CDS_pept        complement(511507..514122)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25985"
FT                   /db_xref="GeneDB:LMXM.36.1410"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR1"
FT                   /protein_id="CBZ25985.1"
FT                   /translation="MRTAQSVCQHAALLRATLRAAPAIPPLLRRHRLQTLPVRSRWNRD
FT                   YTSRPSSESVHQSPAQEDMLVRMLIQDAFHPASTSSLAKSCDDVAGSDEQAHSTAAGTE
FT                   SRSCHPSQCETPATEGGAGGTLAMEVQALGSWRPQTAPVVAPRSEMSTHIQEGLGGREA
FT                   SGLPVRVDAAAASVTDSRAQNAAAEPFATIRQRARGDDMLCVLEWLCSACHTYNPLISS
FT                   LATCRKCEASAVTSYRSAFPPLRHVAVVPTAWVCQNCSHTNCQTGASAQPNKDRAGGAR
FT                   AQREKFICVQCRTPFGGVQDWVCPACDCFCPRAASQCPSCFADRPLMWICHCCEPGLQN
FT                   SVFAVKCRGCGHERRQKYSNSVVRCTACHGWNDVRWELCATCMAPMESLLLAREKSPDA
FT                   EEGTMPTPPLSESALGNTMNVALVPDSAGMLRSKTVVQATELLEAARTSGTATAARRLR
FT                   HDTEEPAELSPSLSSSPMREDEERPRVAAKLPDNAWWCFTCNVAHRRNVMFCDICLESH
FT                   DAMRLRSKKELAAMRASATSPSTEVTSPAFSGDPAALKDAGGVMIMPVTAEGDWQCPYC
FT                   RKLLCVTQHECCGHRREVPYGYWLCDHCCSTNRNDRSVCLGCNEQRESVCPWRCHECEW
FT                   RNEAADAVCLQCGLPRTPCTTADRGTSVSDNSEPNTSIECGVCSAPNHFEKTACYRCRA
FT                   RLRDVEWMCDACGHGHRTRNALRCEECHVIRQFDLRGEVWLCDVCTTPVFSGGEIPVRT
FT                   HCPKCNTQRAPTATHYPSRWKCECGLFNRSRVTECHECGARRRLESLCTTATCPRCFRD
FT                   TPIDVQERCTHCSASLADCFSRWESNITVLADTPELADVCDESEADAVSDDGDDDVVTA
FT                   "
FT   CDS_pept        complement(515551..517236)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25986"
FT                   /db_xref="GOA:E9ASR2"
FT                   /db_xref="GeneDB:LMXM.36.1420"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR2"
FT                   /protein_id="CBZ25986.1"
FT                   /translation="MRSAVCTMPHRVVLVAAFCHPWTPLRRVSLVASWCSSHFSRGCGA
FT                   GSALADSARPYTTLTLPLRQSWKSRSLRPWMCAKESCRAVNQGARKECESCGTEKPQLL
FT                   GWKCVGCSTINYAGVRKCKKCADASDKSKEFWMCAVCHENNRIDEIEDNSCCGFCGYDM
FT                   APHSVAEEEILRRATEKAVLLQQQQEHFDSVSYTEADQQFANPLEGAEALDPSLRAIHP
FT                   GSEAPITGRALKLPAVAPFVAGGVPETRHSPLHQRRKLNPALRIVLEGAAAPEGPPGFD
FT                   WMCRNSSCGHINPGDEESCLKCGTHITPAEWECPLCASLNHLARSRCFYCKNRIPVCWT
FT                   CRACQGTTSIYDKTCRGCGIDRPVAEPKTLREVERGGGDHVGGYVPQGNRTRGEWYCST
FT                   CNALNFSRRTECFQCTSPRPAVSDEGFADPVSAAGWGGPDSSGAAAVAAPVQDNNWMCA
FT                   YCQTSNFRTRHDCWKCGRASERAQEWSSQAGTPQYEREGFQEGANTNPAEGTGNPSWKS
FT                   TGEWLCAKCYSKNFRNRLECYRCGARKHALSASRGSSVRKPVKL"
FT   CDS_pept        complement(519611..520237)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1430"
FT                   /product="putative translation elongation factor 1-beta"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25987"
FT                   /db_xref="GOA:E9ASR3"
FT                   /db_xref="GeneDB:LMXM.36.1430"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR3"
FT                   /protein_id="CBZ25987.1"
FT                   /translation="MSTLKEVNGRLNAQPFVAGFSPSSEDARIFSEMFGNHPNVIQWVA
FT                   RMASYYQAERDEMLNAGSEKKATEPAKATAPAPAAAAEDDDDIDLFGETTEEEKAALEA
FT                   KKAKDAEKKKAKKEVIAKSSILFDVKAWDDTIDLGALAKKLHAIQRDGLIWGDHKLVPV
FT                   AFGVKKLQQLIVIEDDKVSGDDLEEMIMGFEEEVQSMDIVAWNKI"
FT   CDS_pept        complement(521166..537986)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25988"
FT                   /db_xref="GeneDB:LMXM.36.1440"
FT                   /db_xref="InterPro:IPR026847"
FT                   /db_xref="InterPro:IPR026854"
FT                   /db_xref="InterPro:IPR031645"
FT                   /db_xref="InterPro:IPR031646"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR4"
FT                   /protein_id="CBZ25988.1"
FT                   /translation="MLEGHVAELLAAHLSRFIKNVNASQLQISLWSGNVVLNNVELRSD
FT                   ALERIAALFHGEHSEMETKEAGASASAATGTPSGASESHEGGASSPTLSMRMLLAPFTA
FT                   VKGVIRQLAITVPWASLESEPVRVDVAGVELVLGPLRARPFNAREEQEREQAIKQQQLE
FT                   RYEKERHRLSREVAEDAVSETSSKMTASTESGHAKCGGEAAIAGTSRTSGTSWFSWLWD
FT                   FDRMSQIAVRNVRVNLRDVSMRCEFDYEGLHPSCASAFCVFVKQVQLTTTDETFKDVFN
FT                   KDLLAPLCKRIALSEVVVSTHAIRQSFRDASGNAREGGDGPAPSAAGEPALCAAAYDTY
FT                   ASRWALSTAILRVQTLRLQAKLVPPGCVSKNAIVEEMPILSASSTELRVTTVDSIEVDV
FT                   CFGVVQVFESMWRSYQQSLPCARYRKRLHLLRPTGGHATHNRVLRQTSEPNCATLSQND
FT                   ATAWQPSAQQRWRFALRCVLDDVRQHRQIFGLNEWKRCEVVEAMVQFGQLRRAYTEYWK
FT                   RAKGVIWAPPLSSLEEKRLKSMERQLSLWQVIFLRCLSHAQLIVEQESYARQQDYIEEA
FT                   RQRIKSGLLSSSGTGGGGTPTSFLWDWLRGSSTRKNDATTLSRKVLASIASRDGMGVIS
FT                   VPTYRGACFRDLVALEWDLGRRYTSPHFARLARPRAPQNRLPELAAENKLYFTLCALFP
FT                   KLIVRLDPIYWPLTHDSSVPATPSATPLQRVEQRLIVRLRAVELFYTTIPDDRPDKASL
FT                   SFFLGSASLTFEGALRSALLQSKEEFREDYVVVKRNAQRTHTRVLVAPQLVICQPTHEW
FT                   AWWYTEVSAFVRWFRAVQRAFYVNGATEASTGAMPVLAESAQSDLHGSASVGSRTPASS
FT                   SGTPVPGGQCSHTATEATAPRASPAPRVLSVTIQSLDVCVPLFTRDIESSDLEIFSRQP
FT                   SAFSSAALPRSLPGTMHCDSTLKCGECQRQLPTEIASGDGHAGDERLHDEAILQSGDAA
FT                   PGAVWLRTTHSIQSFAVEGDTDEEEYTDSLSSSPSASPGMFARVAPERCFLRNEACLVL
FT                   SVSTTRLWTTAPPTKRYKGTENEYYLCIGDQSKAVRVFCQNGCTAPTLTSSRQLELLSF
FT                   VAGEVRLNPKEFTVLLNKGIDAVANPYVFALVNDALLQPTVLAAADANGQAVRTLTAEL
FT                   QQAESRWSGTRGAAVPWRLATSTCVELRADSESPPMLREVPVDCARHIVSALSAPLSIA
FT                   PISATTVAHAISRGELATGVFGGRVCTVGVGVARLLIRSEANVDLGELVLVAPEQLPPA
FT                   TAPYREALCALGAEEPRAIELICNFADIQWHAGEWSSYDPLPLCPMRENVCPRLLLSIP
FT                   DITMTTTAGRKLLTIEHLTLLQTCTEPRRPGAALTIQTVSAFCDVVLVELLQVLIGTVC
FT                   TMRSIKLPPAAAPYDLTGASRSETADSEMPQSRFFGVRPISVRVHTARFQIPLGTDDVV
FT                   DAPYVEVTTTIEDVLCTLDSLTGDTDRGGKHVHLRFSVSEVMQLADYIGGDPEVRSLIS
FT                   AYPWATCIGDGTAHALQCVVDVTLPDSCVGDTDTSTLTGPGVPPSTTCRVALVGGAIHV
FT                   YCPFLYFYAAAMKTDERIVRLGELARSPLLRRGYTHTPWVADSTRRSRVGGGARASWEA
FT                   AAPLSLSVEATISNLDVVLATDAAVPIDMTKPSTFSVVHVEQIVCGLQRTTPGAPAAST
FT                   TLETRTHAFVDTNRMQLLDLLCTPSRDVCLPDVKLRANRGVLLVPKEDLTGYAYQRGAP
FT                   DDWAFLVGVHPASIPYPERTASVHEAACSTASRPSDVTIHMSAEQCRSLVRFFLYNVAQ
FT                   LPIPSTRRTPSVGGSHLQHASRAPPTVTFPMGGPHPLWSSHQGAEAPSHEQAALSPSVT
FT                   LLLTIPAVSIVIDTDDYAALDRSARQSTMPRSTEQDESESIAPAAPPPRLPSTRRVSYE
FT                   VGLRSGGQLYSAAGGCWSTSPVKNGQLSGLELLAREEVLENLTGDTDVTGTTSTHVLLT
FT                   IDLVGLALLERRAGRASSGVDDVARNDAAVVKVAAAVRHSHLRVSHIKWWLLLCSMFAG
FT                   VCSTQGGPQSTAARTSGKSGRAGTIARFGEAAQNKNEGASGLGSSAFGDHRGTSGGEYM
FT                   DEDKAALSTRQEHLALRQRRWRRLHGTVEITHTQVSFSTVGCANGDRQPLCRLTVPEAR
FT                   LTASPLPAVQEGGREPLNNAERICDEFVLEVPHCPELLLLCVSAEADGATGLESHLSPE
FT                   SSYASVLRRQPDEASSAASAAPDVKSSFPRQAAAATVTPASKPPLLSAHSSETCISLGL
FT                   VCFSDAGSLRSLRYGRRYQVTDLTLHRTSVVQVRLQRMLLEVPAVPLFSLAREVVRQVM
FT                   EAQATEGMKSYARAVPRDGRDAESPTLTYIDMEAKLTDVEVRVSAEATPLGEPAASCDA
FT                   GSDLTSWSVAVSSARLTTSVQLQSVLTSTRMPASLIGDGLSRGWRVQIWHMISQLVVQG
FT                   VVFSTNSDTRACWTLPDVRIKVSLPLTRRIICVRGMGATGTDDELELSSSADELPLRWL
FT                   HGSTANVFQMEPTSVTALSGLHYHVLASLHIDVGAESDGVVGTAPGHKEASVQVHLSTI
FT                   FTLASAAARLAALWRQTRQACESSVAAAVDAGTTSRHAGWWRPGAQQRHGLFTWYEFGL
FT                   GLSGRHVELIMDTTAAMVGDRAASALKNNCAMCVSVEGAITVQVDKEAGEEAVEQTTVL
FT                   DIARLNSGYDEKTTECHGRVDDESAVVETTHTLMRLRTAPVHIHDGAGNLLLYISAVAQ
FT                   GGMADAMVADYAPAEARLDVNVGRVVMHASSLTAASMVCWWKAYRHLRRRWESAVTCIA
FT                   QSSACPQEAKRKSELAMESEGGCKRRWLQRINAEVRHTELVLAPAARVCAKRTHITFSP
FT                   MDGEVDLEAATALELRCDEVCMHSMLPQPGAAYGKTPIVLARTVSPVLVVTRAQQQRLL
FT                   VQYRTPFVSIMNSDGHRWALCAFRIAKVMKGTVTALAAHAEVTPPHASESDPPAGGAAP
FT                   SWVAWIPRAEVDIDKAELLCFAPHSKRTCSAAPAVCLAARQVALRCVESTSRIDSSCVG
FT                   TVVGIRLESSAVLSATYNCGPSTDGKAHPLLDDVRTTFVLSSSSQSASDPVEVTLSAAA
FT                   ATKQNAVCLHVLTGDALERTVAALWLLARQKVPRRYAQARGAKDNAASGDRVLRRAGTL
FT                   WHLRADVPRVLLHCVVAEAAVSSSEQTLRYLCSISVEDVHVELLTRRGGNEGSNRRPHA
FT                   EVWVASVVGETVVTDAAEALDERVMEIPSTFLELRPLVEPSGDRAPHSAPVTGGATSTR
FT                   NSNRSGFSVVQRSLSLSTGGEVQGTAAEDIAADDATALVIRLDALRAHPSMTLLKVLME
FT                   RVLRPCVAGISVASADASLTHILDDLEDTALRAGSATAVLPASGALNRHAGRVRVVEVA
FT                   TDWCVYEDLRLGGEGGFQLHFCGTAGRSVITVRGGGAGGTGGDKVQGGAATIFMSFPVG
FT                   ANGEVCPAIRVDPDLTVRFENVRVVVGEGAHAVRHDACVLEAYVELGERSLCLLPPPLV
FT                   DVSASPLTVATGAQVEGRAASVPQANFGATANATAVPQLPTTSVWAVSMIFSVDVAVGF
FT                   EVSLTAGARRLAATGAVKGRYRFEEKRSPERTLRAEHESECTISLHACVCESGPLTDTP
FT                   VAATAQMCLTAAENKHRVVLNCGSTLWRLPLGHAHVLIELGRLAQQALCPTPLPLPPQR
FT                   PWQPPVAGDALAHGPTRRATTLDVRVDVPSWALTLTSDGGSALTVLLVEHAHLQCSTDM
FT                   DVADVSLTAEATVSLRDTIELYDESGEHLGATVRYAVERSSVASVPAPMAARVLFSAQP
FT                   HLSLSFTRFSPGCRSLSVSVHVDSVVATLPLVTAARLLRTSAREMDAGKRVFWNGSGVE
FT                   MEVAESAPHAAASCRSVSRWRLRAAPGRLLHTSIPASCAVLMLTPVTTSAGDDCSNVGR
FT                   KDDEGSGGVAVNVEALGDGAVGRVSLPGYPSALGALDLVVRKSVRDRLEVMHLTSSVVL
FT                   ANVFYAGPAEGSAAAPVTTGIVSVTAQSARLTVPPRSARYVPLPLLRECLTLELDGCAY
FT                   APVAKMLTWAMMADAMTLLADQAAGGGGETSGGSGNGGSASQKSGAAAGLMLYGNLDAH
FT                   RTGSAENDNGHGGTLRAPAFCKRVRALDAFTLSFPMLLSPLTPTPVKRLCGEGDGDSDR
FT                   DATLASAPAPRSEVDGSHTEKAARTGRVVQLTWRRRCSRMVTPLFSGKLSPSEYTVAVG
FT                   PVWTLWNWTGCRLRLRLRTSRDGMVSSPVKTPQGTPSPPLSLLTSTSSDGVAIAEVENG
FT                   ACFQWTPPTLDVLQRTVFAFFQLMVPSLADGSTTLPNSPSSMQWWSVAAPISLQEPPPL
FT                   YIRLQQGNGTTRGAVRIEQHGPSSVVVRCAALLRSALARPVYLRDAEQPQPLLGAGAHG
FT                   CVLPQQQVPLFYSEYVTTLAPHADRVGFTVATNPVTNTVSRNRSVHGSDAYYLKTPFVA
FT                   TLLSAQEKAYGTRFYTVSAVPDAQFERSAATLHGKDEKDLGEQCVPAEALSCLWTPEPP
FT                   AVVQLRSLCRIRNTHVHRALLAMPLDALVPSNAEEATPAPLMVTLIPPGEEREVTEFCR
FT                   HAKEPEMQFCYSTSGGKAPAHAWSPPVRLLSLATSTQPLVLKHTCVPHDRQGVGSDAEA
FT                   EEPRFMSPVHCRVGEKVALTVEHFRCLTVQSSMTSVSLCVSVGLQAAPPLKIVNRLNTS
FT                   LQFVQCAVTAGSNLASSPAQRGAVTTALCSCAPRPRSYVVAAETISYGCWEVPVLELPG
FT                   LRVTLYSNVRKGFTVSQDVDLLRCAASPSSGARVGNTDAYVYVSLDHRLRQYTVTVAPS
FT                   RQLEGRMLFQPRRLTQLEVYVHSCTVYVAAMTLPTAGPFARKSLIAQGARGRLRLRRGV
FT                   RSGESANRDTVPLSATDEDVLTFLEEQELDVVLVRLLGFYGSATLTERHLMGSASLALL
FT                   EVVDCSTVEAAYPVILRVGPRAGSGSTAPMAESTTAEPSAEADQGRVKSPILPDVFGGA
FT                   ATLTSSTSVPHFKDPSWFALEVQLTRPGQTAAADGVVMLPVPQLRVTVPPIVVRADDDL
FT                   LFTLRATAERVGEEWASAAPGERGGCAAERRDSLVSTRRDAVADSTRHSSHRAYNVFVY
FT                   TLQVSPIVAEVTYTRSGHWRYNPFKGLAQIPEHLIPSVEDMSISLREVRLQEVELRWSH
FT                   SLFGIANSFLWPLYRTQLLLQSYKVLGSLDVLGNPRALLGSWSRGVWDLVTNSSGQSRW
FT                   TGTREFLRTTTSSTLHSVGVLARSIGNLGGTSPIKVAPRLSSGSSSDFSGHAVLATPQR
FT                   RGVLGEVLHEVGGGISDAVTKPIRGAREGGVSGFLIGIAAGVAGLAGRPVFGFFRGVSV
FT                   TSEFYARLLGGLGELTEHEARHLGLGRNYLIVSTSAKGAPVSEATGCVEGEVSGTSAAT
FT                   HVNTVARASLPRSQYIITHAMYDRVFSDVPRWRRGDETNVRLAVDRVGIYNTALHTPYA
FT                   VLCTFLSPSEFRDALPCALTALLAGNIISLLARNCTTGAFRGTADVGKVPDQSDTDEGQ
FT                   ATRARLAHECERASYIKASLGVRALHTYVTDEVFVRVCSLEEIEASLKATEAQQTYSRA
FT                   LAKAMGAAGEHLLAP"
FT   CDS_pept        complement(539909..540373)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25989"
FT                   /db_xref="GeneDB:LMXM.36.1450"
FT                   /db_xref="InterPro:IPR039879"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR5"
FT                   /protein_id="CBZ25989.1"
FT                   /translation="MSAVASDESTGHVADPVQLTHRYVQNHKLNELFGHLLQLVLYHRP
FT                   DDPRAFLAEEVRKIREEKVSSLFTERDLETMFEMIDVTAQRWITVAQLRNTCRNLATTS
FT                   SADNVSTSGGGLTAEQEAAIAGAGDAAGRVSMDSFKEVLSSLLLTKNKWS"
FT   CDS_pept        complement(541533..543494)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25990"
FT                   /db_xref="GeneDB:LMXM.36.1460"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR6"
FT                   /protein_id="CBZ25990.1"
FT                   /translation="MSSSRTADKTIGCNGSAPAPTPNRGQGTFSEPARESAKAADTLAP
FT                   TLGGDRRRSSAGSIRVIGFHAPDATSDSEHVCAVTTSSGHATPLSLEARLAALRSRRLA
FT                   REARAVGVAGSAVSASTAPARPPVALSEPACSGVEGPCQGQTLPTFPPSPGPLAPTFTS
FT                   TTPTRASAPAAQSAAAPFTLAPSTANEVHKVAAAVDVTTLEGARSTSYATTFRAKTPKS
FT                   ASCSSASVRSATTEQPAQVGRMASRRRFPSTTSSVMTTAFSESPVSNHASRPFSMRSSP
FT                   PPGAVGAAPMNNDKSEPALRHRGLRSTTEMSSLRYHPNNDTQAARRLFPNDTESSIYAS
FT                   PLDTAADAIRVTSPEHAEAQHPSPLRAVQLPRMSTVEQDGGCLSSTTSTPERTGLPSSV
FT                   EMQTCLPAAISSSAGRPTASRGMVRRYGVHASLRRTTGDVPSSAAAAPIRPFAPFARLI
FT                   TPPRESCSSPQPLPDDRSSPNWRDLIVPSVCLHRNSPHTRCTQSTSRECSYPRRMTSAE
FT                   TTSSTEALSAGLRSSSGERDTSLSSAFSAKMPIFSSFRHRVTPALTNRVASSPSHSHTS
FT                   ARHSLLSSAFYTAFLATTVRSKYKLLDDTTTASTTAFAERDTIAEELAMQRRLSRLKSE
FT                   LTRQRIEQQRRGGHISTL"
FT   CDS_pept        complement(544347..547649)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25991"
FT                   /db_xref="GeneDB:LMXM.36.1470"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR7"
FT                   /protein_id="CBZ25991.1"
FT                   /translation="MASPALTMLPTLSMDNTPKRSRNDQIRRRDGSVVVVSENNTASSH
FT                   RRSLIGVRGSVLPEKKGGLPKAGHVGVCYHQNVYVFGGVNSKGQFNNHVFCYEKRTLQW
FT                   REIRGAGVVPRGRANHAAVLIGNKIYIHGGHRHLAVFDDLFAYEIDTNRWEKIGCERSQ
FT                   GPGPVFLHSMVYIPPLDSFLVIGGIHQREQNSCLGHLFDVRNRIWTGVPPPSSVDAQHL
FT                   QLVTAAYNAPSAVVVVLGLMDADVMEDGAVSTPHVHVFQPTTFVWRRVDTSAAPMSPLP
FT                   FRMEAMWESLLHFIVPGGGGVYDALLESWMFPLPSTEVDSTGDDGAVGQSPSTPGFGLP
FT                   PLPLNKYGFLVLDLRSMSWSLVSCNLSRKLVAELNAVNRVTREKMERLVMRNNAAASAI
FT                   ALSGNSPQSRSSVQQPVDSGAVLGLSNASLTHGSTGIASRHSSVFRHQPSQWPRNDSSS
FT                   TNVLWPRASGSRSAVASGSHDTKMAALLSSSRYRHLFFFDDAPEFMRKYTLVVVRDEPT
FT                   KSGKLRPLQYVVLHGGLTEPMDYAMLMFAPILSRSNSTEATPAGGAGLMTRSNPLRGNG
FT                   VANVGSRRASAYIQSHSAEDDGYGDESCDDVTSLVSSGTFIAAYSTQRNYRRTAPHSPP
FT                   RDAQALVHARGGRDSDDDEYDTDAGERLSNGGAVHNEYLLPTLPSGRTRHNYYRFALQF
FT                   APGNSIQKESLLPYANIPVAVLQTPKDVQKWSRNYYADQRRWLSERIKDSMIEDRKLRR
FT                   LRQLKKAQVSTASGAQGIATLAGSAGGDDSSNSESEFLMDNFYLAETFSGDPRMHGGAK
FT                   LSMLAYKDHLALDAADAALTQAGAPKRRLRDFFEQHGLDAFEEADIQEQHERMQLCMAL
FT                   GGEGAKQDRRRKDPRLKERAAVAEGANAKAAKRSETSPLVKKSPASDGAMPLATEAQMT
FT                   DSGFERLRMKGWQDGGRDRMVASVFHGSLINGLTGCTTDGELDFRKLAAYTLLRRAIAR
FT                   LRADGNPYEMRRHRAQLRWRYLRALVCTGEAAYLLYLASQADFRMKGIMVTGTQGLMLA
FT                   PELHFLSPLQAYRVPCKPVPYSIAAASAPPPASSSRFAQVTASGMVVYHSLT"
FT   CDS_pept        complement(548396..549631)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25992"
FT                   /db_xref="GeneDB:LMXM.36.1480"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR8"
FT                   /protein_id="CBZ25992.1"
FT                   /translation="MELLSRVFQRHPPALRLHRELTIALSDGDSARAADLASVLATTVQ
FT                   RVVAAQEAESSNAATSPEGPANTGHFSQSDIPVAGLEDVEEAVEKTRQALLHAATVRVS
FT                   SGVARDTEGAAASSAAAAGERSLPFWRDPERLCITVLESTFETEVLGGESQDTLTPAGN
FT                   WAAEHEAEQVRILDAYLDKEDARWKAQKAAIAKIVLDATRSLGLTPEDLQAFEGISASA
FT                   GAGAAAAVGERKLNVLRHSNLVIRGEMPSAPFSNAASERVDEGVEAELRALEERMSSLG
FT                   QPLTPSEVRMARYELQMSKSKMRYVVGVHKELQLVLDHSPALRASLREKSTSEVTFSTG
FT                   TEVFMAEVIRALNEGADAYSANATAAGTQLTVSNVKAREAVESPVIPFTFMLKLSLWFT
FT                   TAPPPPPSSSSD"
FT   CDS_pept        complement(551615..555214)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25993"
FT                   /db_xref="GeneDB:LMXM.36.1490"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASR9"
FT                   /protein_id="CBZ25993.1"
FT                   /translation="MENEEGLSRVVPVLGSGVSSPRAALEHSERAAKSSAQEASTSAGT
FT                   PAAPFSRSTTPSPFHRAPSGARGSDEQDHVSIPTPSLRRMKPSVARKADGSTAAHTQRL
FT                   SGCSVTSSSSIVFSGADSNTGTSILFASDGASSDHVMSGETSPPRRSSSAVKNGKSDNV
FT                   AAQKPQTKFDETTHHAAAVVDLRSDSSFDIRVEEDEQTEELPVVAAAADEAPQPERKPS
FT                   KVSKKTTPGSPSLASSRSTTEATSKRVKKVGASTSRATPAVSSADPAPRDVRACRGAKV
FT                   AVPSQHASPAPASRGQPGTSSASEQKASTLQAEQRLASSSGDHELVVAPSPSSRSSSGG
FT                   SLSHHESRRSVNIVREESAERFPNRDRGVPPTLTRDMEQDDERRSISTPERVLGCGVSR
FT                   CHKGVTADTGERCRGSYTHRGEEEEQSWRTHSGYSRTGRYRGRELSRDGYRYLSSRSPV
FT                   RRNGSRHLTVGSLHGDALAHERLMELRQHSREGNFGWPRSHHRRCSGEVPPHHRCHCHS
FT                   GSSAKAPPPLCTGGVPLHRISDDYTGNDVYATAAVTSLERFGALSERCSSCYSREVQDD
FT                   WCGGAAVQSARSAASSSVFTGDDVEGKEELLTSSHFNDRRRSTSGRRVDAGLSPRSRAR
FT                   YGGRKPEQTICRQELLRYDYGDHTVSDHRGGGSVHHCGGTAARGHGRRGAEWEPDYYYL
FT                   NAPWRGHLLDSGGCGCSWCSQSTHTPRLAASPPRQSPLRSRRGIYRPSSPAAVQSGEVR
FT                   YQSLAPLASSPVRRHRAGSAASGKQVTPLRRASQSPASSVASVPLSEKELLGEVEWKLD
FT                   ALEKQIADEDAERERAMMRSPFERLYHLNNRRDRDERRNKVFQLNLLERIRDRIVSGSL
FT                   KEDIARKEERLRKQEEMLTSPNGVFVRLYQKSSPHRSSHVAAATAAEGSDCKSAGEGNR
FT                   DGRASVNTTGVSSQRASTARSRMKAESQELCNRLYETAAIVKEKKEEMRKQSVEKRQQQ
FT                   EAEELLIARLAGQIQLERSRTRASSKRRPKTPAQLEDEARAELEKLREQDPEGYEKKVL
FT                   RGRVLSPAERDLQAVRLWKHGYISKANLEAQKEVLELKKCTFQPTINEFSGSAGVTGRD
FT                   HTRGNGGGGTDDDKRLSASTDSAQRHRKGDRFKELYRKGMQAKVRGETLRDERDRQTRL
FT                   SILRSRMMSDHHFRRRVELDPSLAERFMKSLVV"
FT   CDS_pept        complement(556952..559693)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25994"
FT                   /db_xref="GeneDB:LMXM.36.1500"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS0"
FT                   /protein_id="CBZ25994.1"
FT                   /translation="MGIPDFVKFIARSSPSALCRVPKGSSRHEPLIFDFILIDATNVAQ
FT                   TLGLDTLRTFLDPDHLVARSAVIFALDSQRDRSGTARAHRHALVGIGDLDVHVQKLCGQ
FT                   LADAYRARQRSNNRLGAGSGANPYVLTSGRGVAGEADYKLLDLHRSLVTCAIASGATVL
FT                   PSFLFISEDSDVLCGVLCGPGPQQVSIATKLQDVLFEPSILRLDRVLAFVATCTDAFYA
FT                   ENEKEAAAAAAAKTKAITERNAAKRNRANSLATTPVTKHPQEQHSDEEVELSVKDTAAA
FT                   TVTATTVRDDGVVRRRKQDGPMVATGVRIELADSSDDDQSEHVETKETKVPTATAGATA
FT                   EAPVSEVEEVPIDDGKCVEGAIAAPREGELLISSITHTSCVDMVFLFMIVMGNGVNVPS
FT                   LVRGATKVDSGSCWQAYCKHKYKNLSAADAETGRALLITSINTHSTNRGSLALNCHFLH
FT                   SILDAVHYADAEPRPPVEEERNSAIIYLSNAVYATLRYIVGCNLDKTPALKQTFLDSRP
FT                   LSETPIMLPSLSAVMWVLGQEATRTFSFPLHGLAKKELLVAASGGASASNDAANASSRL
FT                   AANHATFARDASSSTSYLDVGDHLVAPAASNAWAVRGARTSNVSLATLMQNFTSGVDGA
FT                   TSAARSGHCTDAGMRPAQLPSVTEMLKKALQMVSPASLAKANLLVYLTAVWTYSLGLGV
FT                   RRMATLTKAAASVAKTEVGVSASSSVPPPSSAGVAKASRAASGTSPAGGHYVYSFELRR
FT                   MAPVLQPAASQPPSSITVASGRPAISGRVDSTASSLSEKSAAQQAILAALGVSYDYSKT
FT                   PRDSANIVNLPRCAMDEEDVAELQRLRKVARKERTLSALVVDAVPGKKRSANADDEDGD
FT                   IGRTRSTKKAEETKNGASKAKKRLGKRERLKQQKTTAKRAVA"
FT   CDS_pept        complement(560616..561140)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25995"
FT                   /db_xref="GeneDB:LMXM.36.1510"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS1"
FT                   /protein_id="CBZ25995.1"
FT                   /translation="MLSRNVSRCCEAHRRCRAFAVLAFGALQVESPMAACLRRCTASLR
FT                   ATATVASLSSDHAVLSVCKRCEHTSAIATPPGRELTTKEQIDELMDAFAEACELITDAK
FT                   ESVGTTYFEDDMEDAEKQTHDVLKRWESLQAALERKGTAEELQKVRNMYDLKIKQLKAE
FT                   LETVREAGGAG"
FT   CDS_pept        complement(566353..567882)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1520"
FT                   /product="putative hypothetical protein,
FT                   conserved,nima-related protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25996"
FT                   /db_xref="GOA:E9ASS2"
FT                   /db_xref="GeneDB:LMXM.36.1520"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS2"
FT                   /protein_id="CBZ25996.1"
FT                   /translation="MSGGNAGDAMIGRVCRNFPDTFAKDEATAREQDKKYWISRVLGSG
FT                   ATGTVLCAKRVSDGEGFAVKCVDMEGMSEADKNRAQAEVDCLLNCDFFSIVKCHEDLAK
FT                   RDANNPEMVQMIALVLDYANAGDLRQEIKSRARTGRTFREHEAGLLFLQVLLAVHHVHS
FT                   KHMIHRDIKSANILLCSNGLVKLGDFGFSKMYANTVSDDVGRTFCGTPYYVAPEIWRRC
FT                   PYSKKADMFSLGVLLYELLTLKRPFDGANMHEVMHKTLAGRFDPLPSNISPEMRDIVTA
FT                   LLSGDPGRRPSSSRLLNMPICKLFLSGLLEIVQTQPAFQGGLRDSISNQIQETKRLLVT
FT                   EKRHIQRMMEESSGSSVAASTTILEGATPLTTTLGGLTIHEGTVKKQSSDMVWKKRYLC
FT                   IRAELADGQTVLDMNPKFKTLDMVLAISKETMEQQCISTPFTELEDAFPVPAKYTGCNA
FT                   SFVFAVAFKTGKRLSFQTKSEVERDLWMEKIQDVLGIGDSDDDMSPLPAKE"
FT   gap             568259..568358
FT                   /estimated_length=unknown
FT   CDS_pept        complement(572051..573556)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1530"
FT                   /product="putative protein kinase,
FT                   putative,serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1530"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25997"
FT                   /db_xref="GOA:E9ASS3"
FT                   /db_xref="GeneDB:LMXM.36.1530"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS3"
FT                   /protein_id="CBZ25997.1"
FT                   /translation="MAAPSDALIKKVCNVFPATFGVDTEEELTPAEGRLSRPFRYYLDT
FT                   VLGSGTSGTVLYARRVRDDHPFAVKVMDVEGYTPQEIMRASGEVCCLLSCDYFSIVKCH
FT                   EDFVYSDEKYPESVSMMAMVLDYANAGDLRQEIKSRSKTNRPFAEHEAGLIFIQVLLAV
FT                   HHLHSKRMIHRDIKSANILLCSNGLAKLGDFGFSKHYAATVSEDVGRTFCGTPYYVAPE
FT                   IWQRRPYSKKADMFSLGVLLYELLTLKRPFDGGDIEEVMHKTLAGRFDPLPDSISKEVQ
FT                   TIVSALLQSEPKKRPSSKTLLNTPTCKLYISVVREIVQSGETGGFSAEQETTITRQLKQ
FT                   TKEELQVDRRRPPLSMEDVLRTTVRVSLSESTDRIGFILYGGKVMKQSSDLSWKRRYVC
FT                   VYGEVEKGCPLTGDVASCLVSLELVQAVSRETLEQQCISTPFSDLEDVFPVISKYTGSD
FT                   AAHAFAVAFKNGRRILFDADDDNDRDGWMRSIQSFLGIGDEDD"
FT   CDS_pept        complement(575836..578640)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25998"
FT                   /db_xref="GOA:E9ASS4"
FT                   /db_xref="GeneDB:LMXM.36.1540"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR030731"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS4"
FT                   /protein_id="CBZ25998.1"
FT                   /translation="MSLLQKNSVLKKYRREYREQDAARSSSKEGGQTEEGGDDDTAVYP
FT                   DVDAFQVLGSAAGGVLPSPSSSSRLMRSEENAQMPAIGAASVKGWYSGVSSGFDSTTAA
FT                   FESMHRNATATATAGPLTVSTIRSPFPNEDDGDEANHAAPTRPSWPRSHTVRAGAEAEG
FT                   KYGDLDSFKTPLGPLSLPLPSASGGPQAIMSLRRRGADSTSPRCWPSRSDLSGEEDRSI
FT                   ADTHSQSPPTDPSVSPTTVKIVGEPFMSVTDMPEAARSNYVTRATATSGLAHSAGESCG
FT                   LASSVGGFSSFALAAGRPRTPTGGGAHVNSSPQVLTAVQRPIEVLTLVHKDPSEEVSSS
FT                   SSSPSSSFTVIAQKGDCGDGDGKPTMLREEAVRQLDLAYARATSESQPVDASKKNAAYA
FT                   AMRLDISDTLLQPPTSIVSEPSTVTVQTKDKSAVSYRNSGGAAVNGSVEGRRVAYAADG
FT                   ADPSEEGAFSPLSVMDDNERASDAGMVDSQNTLYADNRGAVFIHQVLSFSGTTHSLPRI
FT                   WDDEDVDVDPLTTESMRLPARVLPITFYEAYLDLTKELRSSAAKAACQAEEIPTDRACS
FT                   SSMVSPQAPSPVWAVPTLRKAARTAIFWCCGGKASRMSTAAKQQPPSTATCDGSTRDER
FT                   SGVAPTDETPSASGGPEEHLHVIRVLKSRSVSLQLTTHRRMLLTVFNTLTGKIPWPSKN
FT                   VNSSTSTPAASSPPSSSTAVKWESIGFQGSNPATDVRATGVLGVLQLLYLINYYPAFAQ
FT                   RLWQLCCDPAGEGATYSPSHNHRIGEPPVAANRGRVSNELPFVLVCFNFTAIVLDAAGQ
FT                   HILDEEVQKTANGKRPSSTLHGAAAKTAGTAGHPSSYAGMYVCCECYVGALALFVEAWR
FT                   ARPKGGVAGDGSVTTSTVPANRPSIADFGDIKARLRGKLLRKGAAKIMLEAACQVRGAV
FT                   EQHE"
FT   CDS_pept        complement(582334..584880)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ25999"
FT                   /db_xref="GOA:E9ASS5"
FT                   /db_xref="GeneDB:LMXM.36.1550"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS5"
FT                   /protein_id="CBZ25999.1"
FT                   /translation="MAKRTVSKLAVGVDHSGKTTVPDASVCSSTVADEDASQNRPATAL
FT                   ALCEEMTSTKAAAEGAPNAPLSWQFLCPLCSAVDLVDPVDLHEPVKGTMSPSSLHSTFV
FT                   DESFHCLACRACVEQWLSAVRAFSENQSETIDHTGGTTGAATFSPLSASARDCAPLLAC
FT                   PLCNTMCDATILSPSDPIGGVARVLDASAVRNSYTGSQPLSCTTKTGSCVGPPSAPAAS
FT                   ASPFCSICEEAKVMCVCLQCDFGMCDACHRATHAKGGFRQHAVLSCEQARRRGHQRCAQ
FT                   HAGMALDLFCDTCSTCVCVTCCFGGAHRGHEVFPLADVAARAAAALTDHSMKLVTLQRD
FT                   ADATGMQLESLWPAYEAKVNDVRTEIQQCFSSLRHVLQEREDALLSRLGEVSAVVGRRS
FT                   SRLRSAMHAISSLLGSTGERLRRLPGSVSPSTLMRIFGTVQEQQQWVSRVSARVIEEAT
FT                   AVAEGWSYHVCSDGANGCRMASFVVLNSDTPNADGLRQYKRVLADLGHLDASADAQLPL
FT                   AEQGSAGSVETAKGHGNREEESAAQHLWGGMVEEYTEPTDGLTNSAPVALCGDSDSNSG
FT                   AVAKGGEGEETLLVRPSHIDPATPLLPGQTAASKSREVSMAYRGRDCGESRQSSRSVST
FT                   LQWQPRRPHLFSIGASSQSTHGPLLAYELNVDSSVKGAGPGTGSAVDATTACGTASLDG
FT                   VASMWGGVKQDLWEVGDCGSSAAERGALGCHKPGCAAAARGVRDTMPFRVSLPPRRIES
FT                   HDRADDDDCSVREADDQLPWRALKLHHSSSVQDGVRSTATSLPRHGSTARLQYLTELDL
FT                   RKPSEVAHEAQDSRLFASKQGRAESQRRTTGLQLEL"
FT   CDS_pept        complement(587065..588576)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26000"
FT                   /db_xref="GeneDB:LMXM.36.1560"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS6"
FT                   /protein_id="CBZ26000.1"
FT                   /translation="MPAAVNVCASIALPWRGDGVAVPTPSSQPGEMHDLTVEELKGSLS
FT                   DLGYNPYGELVYTRSHLASKHLRALPGLQRYVHLQRLCVDDNGLTELDAVRYMPQLVHL
FT                   HARHNRLTSDVFVSLAAAAAGCLEQLHLDDNGITSLDGLEKLPFLLDFTCCSNRVQHLP
FT                   ARCLTAAERLRRFSLSNNALETVDINAFAVTRPLRVLDLSNNLLSNTDFLYSVALQIEK
FT                   VNIANNRVRHLSAALKQLPCLTVLDVGGNELSGLKELRVLRCLKGLRTLMFAGNKALEH
FT                   LSHHAAGEGGRLGDPLATTAQGTEYDAEVVMSDGEDNGGPLCSGGAGGGLNAAISTTAA
FT                   TTGAASAERVAAEGDGAPDTSSTLLPSASAISKVTTNANDAAGDSRACTKTITGWKFSD
FT                   SLAARAAVPTTAAYADLCASETYTFIHAVGSARCDGGLDVHVNLQKEVLALPQQEQVYL
FT                   WTLSVLPQLTEMNGRLTRPEEVAKAAFLFRANAAKQDPKEGESTE"
FT   CDS_pept        complement(589724..591154)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26001"
FT                   /db_xref="GeneDB:LMXM.36.1570"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS7"
FT                   /protein_id="CBZ26001.1"
FT                   /translation="MSATHSTAGSGVSSLQRSGLSITVGDTKSIVLALQALQSKIRSLE
FT                   QDRDFHQDQYEVALQAHERYKLDMERQMEQERAAHRKREADLLELLRKAREERAQLEDA
FT                   LSGKKEDLGGFRRELEQMIASEKELASQRESKISMDVARLRAEIKEEQTHRAALLVTVE
FT                   KLKEEREAALKTNEQLRIAMDGLLSRYEQLQRRRPAPQAAPRRYPTSGVSCETHSRAAP
FT                   ATGVHPRRSVSSRTRSPGYAPPRELQRPGLPARQRKVSPSLRHNYEDPTCNSILRDVRI
FT                   VPEEAPPCAYPSANSSMHHSQQEAAETTGKATTACSGQGLRTQATTAPSRSGRPSPARR
FT                   PPETGVAGPSAHRTTAIDEVEAQLRQELEDLQHRYDDTIERGSSEEVPREVLAAALHRI
FT                   SALLEQKKEQLKLLKEARMELEEAVPLSASRSTNTNWSMNGGGGGSPSTLAMQDKHAHR
FT                   ALLVNELRSLLAEAARGS"
FT   CDS_pept        complement(592822..598308)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26002"
FT                   /db_xref="GeneDB:LMXM.36.1580"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS8"
FT                   /protein_id="CBZ26002.1"
FT                   /translation="MAGHVSQTPFPATRLAPPPSPLGASAAHCSISLRRQALRPVSAEE
FT                   DVRLFDDVALACLSASQRHTMSPTKHDARKAGLDISGAVFTDASLQMSPGTATNSSVRV
FT                   SSVRTGSAGLGESLHVPPLSAFEHPDAWLREYAFLRAKLKRPADSVSVYHDYAAPLNSR
FT                   ATMRRACVVHPLPDLEKVQEALRRRFQAHVPSTSYDVCEQQCAADSCAPTEWDDETVSM
FT                   TATRETADAVRGAHREQRNDIFLPPPTLWCVGGSSYENEIVVRNTVTGQRLLRILDPKM
FT                   RVAVTALQHAPFRGFMKAHQLHVLPVREPHDVLRLKASQLAFTDYVWCGLQDGSVRLVP
FT                   ADHHHIRACGPSSPFSKAPSAALVYELPRYQGGAIVSIVCSPCHDTARAFGDSPKWGLP
FT                   NRVSNAIQCMTAVLSAGADSATAAEQAGGEPADPASRQHLSLVCIAATDASVVIWDARQ
FT                   VYEAVATAQLQRQEQKEGTQSNGASMFRHGAAGSLAVGGTAASGTSFCCDASAALSGAT
FT                   GVSSDVITFDCSSPVPGLQNMQVRSSCTLVQVKPLAKLSGGFAGLTSLRWVSSLIVAGG
FT                   CDAPVSRDAKMVRRDPCTTPCRGEEIPRIELTQTKTRFDKREEQRGELELTEEEMEGVE
FT                   RELEHMMPPLAAEPAQSLRVNLLVASDCMGTLHLWNLDEELHRCSEVTESALGSPASFS
FT                   AFYYSSLRSMSSRSDGCLAVNHRSGASRPTSGTSNASPRRTSASKGNGGTRRSDRVPKS
FT                   RRACRGLGLAEARENRARLSELPSNRPPSGLKSDGEASTVRKNLQRPSIGRSSTEEHDL
FT                   SQAAQGRSPQVTAEREGGWLSDGHSTVPALPASRKSLAAPSATVHQHPPLHNALPPHHP
FT                   SSTKNTVPVSGPAKAKKVKKSRNSVHETSVSMRRSPLQSTSPSRGSAHRPSTSPGRLSE
FT                   SRHPAQLQTGMHSRASVQRGTSVTARNGCGTVSAGQDLLMPTQAAKCQIRFGQGAAAAI
FT                   ADVAVDLPPHIRTTLRRIPKPSSRLASWQHRPTEEEVDTRILENEFEELTEEKALFFAF
FT                   QRLEMYVAVDGAMWTVRCVPQWLLPDEDEQELFRQRNGDDAREEGGDLAMEESTGAVIR
FT                   KWMAEVAMLDRVSMGAFDLQLRKRLLDVHAQPITQLFLDPWQGRLWVAREDGFASIFST
FT                   RDKSVVSRMPHPSADALLAPPSVQEWVKLQEQALTRSHLNDARVTNGFGLECHKECRDL
FT                   PPAHLTQVLPIAVRSQRALLLCCSAAAGWHEGASDCLAAATVTESPRRQCQRTLSLADP
FT                   VVARDSLKPLALKLQPSFSCGSDSTTSNSGVSSAPRSCGVVTLVCVDGRSDMKNLAKSR
FT                   EVQQWRWLRQLQLCRAESAAMCQTQRHRYYALCEDIGMNAVHVIQELGHYTFQSHRRTY
FT                   FHLWKDHLGLFHHTHLMRRQRTARLERERVLARRLEGALMAQLRGAYYARWQRLLAAGR
FT                   CRRQEEALARFARAAVAVPHGRRLSRGTCCRGPLPTAAMMGHFHRMSALRTYWRTWQAW
FT                   ADAQRLQQHRHKGLSALQQYPPPISRTRSLTSSATSMATPPRRVVSGHRAGADGFAAEG
FT                   TMTPYHPIHSGGVYLRAASLSSPLESAYRKTASGRGAVAPQSARTQGLTEAVPTAPPPA
FT                   LELLLADLLRARVFVFHFSDARSSATSVLDESWSVILENAESGAETDDDDDRRFSVFRF
FT                   ALLPLLQGLISTAEEVLPNLFNDSVAEEVLSMLVGIVLAMDYVTANAEGTWWTLREATV
FT                   LTGYSAFIEGTEPMRSNFDASLLVLRAYALRAFASDSEAAEVLRGLAKGKRVLAQFLDF
FT                   AMERAVARRMEHL"
FT   CDS_pept        complement(600802..604431)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1590"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26003"
FT                   /db_xref="GeneDB:LMXM.36.1590"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="InterPro:IPR039662"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASS9"
FT                   /protein_id="CBZ26003.1"
FT                   /translation="MSAKKSTRARGKPSPRTSQHSDEADAVSEAYDVASLPMDDAAATP
FT                   HQRSGPLPKKASKKESPQDSNATAAVDGAIIATPQPTLGEAETASLAESTLQFLVDGTS
FT                   VVSGVTEAILSVYRGGDKERALCAVLNVLAKASGVAEVELDASALVDGVEIRPLLEELY
FT                   AQVPEDSEAYLLVNKDAKYKRFRRTFPEWCASLMQDGFASDVLLDGTFLPILSQWIIAM
FT                   SESKSRSFRHTATVVLLAFVQALSSVAANLQSQLSLLRTKKTIIAVQRKRNKVVEWRDH
FT                   VFSQAIHQRLRDIAPDIRLAGFQALRRWILEFPEEYMTNKYLRYLGMPLHDKRPELRAE
FT                   ALDTILQALAHVPDAYSRLHLFLQYFTSRLVELSNDVDVRCTELAIRVVAMMVRSDSDV
FT                   PEGSELLSNERVDQVLLTLFDERPSIRAAAGILLKVFIHCRTAAEDSEAAQVSVATELL
FT                   CSFAATLRSQYREAMPEKYLIDALWTPERPPLLLTDFQPILAAAQSDKPLDAVVGLQLM
FT                   AALLLKVQGRLTLGPLPKDDRRGGTVTAGKKIPPATKAEAEALLHRLSEDAAHALSTIL
FT                   EVHCGSEDVLQAAAEMCAALDVSTFTSQRHQAALSALLIELRKATLNTSCTALEMRESL
FT                   AKAWHQLAFTEHPLRNEAHAHLQELLKSVMAQFSQAVRASSRSSRGSSPADAADLLHAW
FT                   ARMNLASALVPMGAHWPQIQTALMGILAAQPATNASLVMLVVGTAVQCLLWQVHSSADE
FT                   ANPALSLSQLKAHVRDFVAGVLQYQAEAEEETQATGSPGAAGDGAAVLARAEVFVYLCD
FT                   LLALPYYDLAQVQQEMLVRLLRGLYERVSAELRSAQDYLKMHVLEHRAQQQQRPSQAAN
FT                   WVTAGLTELVAARRVCSRMEALQLRLVTGVARLFLFKRLDAILAAPFLSLWTYTSSKAV
FT                   SDAFKSLFHSLRDRAGDDGFTLERDILLAAYHHCVEVGATPFSVEALYQIGLKLSSVHF
FT                   VGTDRLYSCCPAMVRFGADFAASTDPLLLQAVSSYAGKLRPADALHVLRDHLSRSSLFT
FT                   EATNSYVLAFVTALRKAAKLDDSTASSLMAGGKRQRALAGTTQVAEEEGMLNAITQGLS
FT                   ERSSAATGAASSSALPDGPGQRISVASRVVTADGWHVRATGASQGNAEDAVEVEVSQGQ
FT                   RTSAAARSRRSVVNVPTTQETALSSLADGLDSDEVFVATEEYE"
FT   CDS_pept        complement(605809..606180)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1595"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26004"
FT                   /db_xref="GeneDB:LMXM.36.1595"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST0"
FT                   /protein_id="CBZ26004.1"
FT                   /translation="MPRKAVAAAKKERSPSEKSVSSVDSISSLPAIKEARIEDGTVAAA
FT                   QVPPRSLSPPGSSAAMPAAAEEVVPLAALVAVNVDRNEEASFGLLKEPGPPSADVRRVT
FT                   KEGEGAPAIPTDLLQLLSG"
FT   CDS_pept        complement(607253..608047)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1600"
FT                   /product="putative proteasome alpha 1 subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26005"
FT                   /db_xref="GOA:E9AST1"
FT                   /db_xref="GeneDB:LMXM.36.1600"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST1"
FT                   /protein_id="CBZ26005.1"
FT                   /translation="MFKNEYDSDITTWSPTGRLFQIEYANEAVNNGSATVGVKGRDYVV
FT                   LTALKRSPVAELSSYQEKVFEIDEHVGMSISGLVADGRVLARFLRTECMNYRYMYSDGM
FT                   PMNQMADMVGEKHQRHIQFGGKRPFGVGLLLAGYDRQGPHLYQTVPSGDVYDYKATAMG
FT                   VRSQASRTYLEKHFVHFTDCTLDELVVHALKALASATSEGVELNVKNTTIAIVGKDTPF
FT                   TIFEEESARRYLDEFKMRPEDRVAAADDEEEVLHEQPLDVEE"
FT   CDS_pept        complement(613992..614339)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1610"
FT                   /product="universal minicircle sequence binding
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26006"
FT                   /db_xref="GOA:E9AST2"
FT                   /db_xref="GeneDB:LMXM.36.1610"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST2"
FT                   /protein_id="CBZ26006.1"
FT                   /translation="MSAITCYKCGEAGHMSRSCPRAAATRSCYNCGETGHLSRDCPSER
FT                   KPKSCYNCGSTEHLSRECTNEAKAGADTRSCYNCGGTGHMSRDCPNERKPKSCYNCGST
FT                   EHLSRECPDRH"
FT   CDS_pept        complement(617615..618163)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1620"
FT                   /product="universal minicircle sequence binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26007"
FT                   /db_xref="GOA:E9AST3"
FT                   /db_xref="GeneDB:LMXM.36.1620"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST3"
FT                   /protein_id="CBZ26007.1"
FT                   /translation="MCILFSAAQHHPLPHMCPTPFSLFLRILLSFTLYPPLDTRAHWRR
FT                   FPLSQVFPRALSHSFRSPPSIIMSAITCYKCGEAGHMSRSCPRAAATRSCYNCGETGHM
FT                   SRDCPSERKPKSCYNCGSTEHLSRECTNEAKAGADTRSCYNCGGTGHMSRDCPNERKPK
FT                   SCYNCGSTEHLSRECPDRH"
FT   CDS_pept        complement(620761..625842)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1630"
FT                   /product="putative clathrin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26008"
FT                   /db_xref="GOA:E9AST4"
FT                   /db_xref="GeneDB:LMXM.36.1630"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST4"
FT                   /protein_id="CBZ26008.1"
FT                   /translation="MDSPSISAEIFQLNSVSGGLTPGCVSFKNVTLESEKYVCVRDVQG
FT                   DGTTSLVIVDLEKHESIRNNVKDAESCIMNPKTKILALRSGRNLQVFDVDASRRLKATL
FT                   FHEDVVCWRWIDDRTLGIVTARAVYHWSLDTAADDAPQHIFDRSADYDSSVQVLSYRSD
FT                   EQKKWLVVTGVARDPAGTMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMC
FT                   LAWNSPQQGGQVMIMELPTGSKTDLSVLRRVYSVTIQPGDFPVSMNVSDRHKLLTVVTS
FT                   RGSFVLMDIFTGTILTEQQFSSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNDNGIISF
FT                   VKNRMHNAELALRIASTANLGGVDDLFKLQLDNFLRIGNVEEAVRMCLRAPGNSLRTRE
FT                   VLMRFMQMPQQPGQPPAISTYFKIALAETNLNECESVELARAVVPKGGIGYVKQQFDEG
FT                   KLTASEELGDLVQQADSNMALKIFHQGNAHTKVLNLLLQRNETQKAVEYCKRANFSPDW
FT                   RVIMNNFIRVAPQDAVNLGLMLYREMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILR
FT                   EHNDESTMELQTKLLEMNLKYSHPSVADKIFVRKICQCYDGMKLAPLCERAGLHQHAID
FT                   CYIMAQKEDSDLNNLASIRRCLQQVQNFNPEWLVDFFGKLNKQDSLKCLEDLCVNSRQN
FT                   FKVIVQVATKYSDALGTADLIDLFLEHSLYDVLYYYLGAVVPYTRDPEVHFRYIEAAAE
FT                   MGQMQELERMTRESPCYDAERTKNYLKNKKLTDMWPFINVCDQHNMLNEMVHYLVETGN
FT                   ESCIEQYLTRRSPGKTPQVVQALIECNVSEEFTKNMLATVGTMCPIEELVDCVEEVGRL
FT                   HLIKQWLEDRRSEKKTDKALYNALAKIYVDIGQSPEQFLAENEYYDAEVVGKYCETRDP
FT                   NLAYIAYCRGHCSDEMIGLCHRNGMYKQLARYLVKEQNLDLWASVLGQNSAQRQQLVES
FT                   VQQIALPESESSEEVSATVRAFMNANLTEELTALLGQIVVHGRFRKNRFLENLLIMSAV
FT                   RARKDKVMEYVTTLEDYDAKDIAHVASGAGMHEIAFVVYTRHDMQKEAITVLLQDMNDV
FT                   SRGRGFAQKTDTPVVWSVLGEYLVKQDEVHEGIECLIRAKNPDLVVEVASAAERTNQFG
FT                   DLIKYLTMARQYSRAKDNKIDTALVITYAKTGRLEELEEFLKETHNVKIGAIADKCFQD
FT                   KLYESARVLYTVANNYARVASTEVMLGNLSAAVEAAKKAKSIHTYKEVNLACIDAGDLK
FT                   LAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVLRNASGHQGAHMSIFTEMGVLLAK
FT                   YRPEKLMEHVNMYAKKINTHKMITVCEQYHHWVVLRVLHINNEDWLAATNSMMQHHADA
FT                   FDHEIFKDAVSHLGASDLLYTAIGFYLKTHPEQLNDFLFSIFKRVDPERVMAETKKVAP
FT                   IHVIRTYLEAAQERNAKKVNETLNNLYIEEEDFKALRHSVETYNNFDSEELSSRLEKME
FT                   LFEFRKIALLLHRKNKRYSHAIAVAKENELFEEAIDTAAESGDSELVSSLLDYFVKDYP
FT                   ECFAACLYRCYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQDYSSKIEKMEKSMMDAQT
FT                   AAKDAARRAGPVQGPGSVPLMIEQGGGMPMNGMPMGAPQPMNFGMPPQFGSGRPF"
FT   CDS_pept        complement(632877..633284)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1635"
FT                   /product="putative poly-zinc finger protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1635"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26009"
FT                   /db_xref="GOA:E9AST5"
FT                   /db_xref="GeneDB:LMXM.36.1635"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST5"
FT                   /protein_id="CBZ26009.1"
FT                   /translation="MVCYRCGGVGHQSRECTSAADSAPCFRCGKPGHVAKECVSTITAE
FT                   EAPCFYCQKPGHRARDCPDAPPKSETVMCYNCSQKGHIASECPNPAHCYLCNEDGHIGR
FT                   SCPTAPKRSVAEKSCRKCGKKGHLRKDCPEA"
FT   CDS_pept        complement(637960..638856)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1640"
FT                   /product="putative universal minicircle sequence binding
FT                   protein (UMSBP)"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26010"
FT                   /db_xref="GOA:E9AST6"
FT                   /db_xref="GeneDB:LMXM.36.1640"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST6"
FT                   /protein_id="CBZ26010.1"
FT                   /translation="MSETEDVKRPRTESSTGCRNCGKEGHYARECPEADSKGDERSSTC
FT                   FRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKQGAAKGFECYKCGQ
FT                   EGHLSRDCPSSQGGSRGGYGQKRGRNGAQGGYGGDRACYKCGDAGHISRDCPNGQGGYS
FT                   GAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHISRECPSAGSTGSGDR
FT                   TCYKCGKPGHISRECPEAGGSYGGSRGGGSDRTCYKCGEAGHMSRECPSAGGTGSGDRA
FT                   CYKCGEAGHISRDCPSS"
FT   CDS_pept        complement(639907..640815)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1650"
FT                   /product="putative proteasome beta 5 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26011"
FT                   /db_xref="GOA:E9AST7"
FT                   /db_xref="GeneDB:LMXM.36.1650"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST7"
FT                   /protein_id="CBZ26011.1"
FT                   /translation="MFADFESVMSSNFALDDCPRVGPFTYHNMDEDTLEEPLSLCSYRR
FT                   APQQTTERSPASCDAVTADPLDSSRYLHGENRCWTLTASCPVPRAIPKIDMKKGTTTLA
FT                   FRFNGGIIVAVDSRASTGQYIASQTVLKVLEINDYLLGTLAGGAADCQYWERVLGMECR
FT                   LWELRNGSRITVAAASKILANITYAYRNHGLSMGTMLAGWDRFGPSLYYVDDKGSRVKQ
FT                   DLFSVGSGSIYAYGVLDTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHVHEK
FT                   GWTKISRDDQTKLYDRYFPSQ"
FT   CDS_pept        complement(641776..643860)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1660"
FT                   /product="putative tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26012"
FT                   /db_xref="GOA:E9AST8"
FT                   /db_xref="GeneDB:LMXM.36.1660"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST8"
FT                   /protein_id="CBZ26012.1"
FT                   /translation="MVDVEKYFPRAVAHLKAVPASREAAEESRARHWHDTTHEVNADGI
FT                   VTPRKRAERERRESGLGSFFDEGGLDVRGGMADKLKSGAYGSAHDAVERDSPDILKLTG
FT                   GNARRHGGLHLATESNAAPADQTIEGDRGDAGAYREFGDTPVQLTDMLRERLMELKAGK
FT                   LREERSETFLPQRLRHRPAGELLMLAQQGEAAGVGGGGRAAISPPAPAALQRKVTQLRS
FT                   GPAATTLADMVPKEEEEEETAALLGDAARDGARRGAFDRAILQDGVSPARAVNAMQALR
FT                   GTDDSVPGASPHDPLRRLAAIAANTGRRASVLGAGDDASVSAEGVERAGFVHLLRTLPR
FT                   AGFCSRREAAAIIASGQVRVNNVTERNPFRLVQAQDDVHVAGHRSRLRFAPPRLWMYHK
FT                   PAHVIVSRNDAAGRTLITKHARILGMDHLVPVGSLPMRAHGILLLTNDGELSRFLENPK
FT                   SMVQRTYLLRVRPAFDPVLVHKLNTEGIQINGRLYRNAEFFVNPATKSRYSVKVKVRGE
FT                   SMPIAQLMQHLGRKVERGGRISFGPFALSNLAVGSVREVTIPPFYSQHLGAVWQPFVER
FT                   DWPYFRRQRVSRLRRLCQHRELTPKELEELDNYTYEEVKDALNFESSELQALVEKRAQQ
FT                   LRRASHLGDDMFPLPDDFPKESCRRSVGDVAVDDATAPFADADEEEDEDAIVEDITSLH
FT                   "
FT   CDS_pept        complement(645135..646772)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26013"
FT                   /db_xref="GeneDB:LMXM.36.1670"
FT                   /db_xref="InterPro:IPR019438"
FT                   /db_xref="UniProtKB/TrEMBL:E9AST9"
FT                   /protein_id="CBZ26013.1"
FT                   /translation="MAHSVPSSYTGESVRSAICRLYGQRSDVPLTVLHATVPPVTASLV
FT                   QQCSSVLDAILDCIHDQLYPKHSAVGENADTRSFAITNHWLLSVPESLRFDEAAVVNYL
FT                   GMMVAIDFCHWAEVPCKAGRTTTASVGEEVTGFAGFYVAVDPPSGESALRNGGTTDSAA
FT                   VAELFTELSSAVPKELGTLPTAPAAAPTVLRGSAAMMYLLRRAVEVYHVPWFRPDFLQR
FT                   FRGDTAAAMSALRLCFLGCEQDGITPLWMPCTRERVELLLSLADAFVAHQTSYYELLRA
FT                   CGGFLFAPDAAAAATAPCGFVPSLVRLHPRYGDFACVPVEGTGCLGGNTGEAAPDVCIV
FT                   PVLKLSQLTALAIEQALPELWRYQAASSASSKPLLSIPPPSAPANSWLTDRAARIARSG
FT                   TESRTMEPESSLFGVFADGAKLSICCDYQIPKALRAAGLLVYDDHLAGIVDRHVLLLPG
FT                   SAEEVSIRVATLIAAERLLQFLNTPPKQQSSLARELGATAAEEPGAPAQLPGKRLCSVI
FT                   HLDYALWYVGRYMLPSEARHHLCRTIMY"
FT   CDS_pept        complement(647476..649824)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1680"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26014"
FT                   /db_xref="GeneDB:LMXM.36.1680"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU0"
FT                   /protein_id="CBZ26014.1"
FT                   /translation="MHRYLQRSVPVTPVSLSMSGNLSAEDVHADAAPLLESRFLRRVRA
FT                   EVDRKERAEQLRKGTAARLIQQALRRWAQTRQLQQRHLSIYSSVRPSYEFDPIRAAELD
FT                   AALCCIQASLRMCASSRLVEARRVKLLQQTTASILDLACQTTLHCAASIRHINDRQLRE
FT                   VLCRQEAVERRDLLRRHFVFLVCCHQTFFNDSRMWDAGVSIRRIPLYTHHGLLSGETLP
FT                   VIWGTATSSSPLTSATADGAAVRGDAVASPLPPQSSPCSATATVDRHIKGWGSPAQPGP
FT                   RLLEAVGSGWLDGTEEDGGHFDIDAALRLGEYRFLFSPEEWRLLKELKASSLHPASPLF
FT                   DSGTDGRRVGYDAAGVLGAEAGALAAPPGQLQMVPTETAPKDACSLSYAKAFASALTFL
FT                   RQPRIVDPSVRCTVQHLHDIRSSTLEMEQELRVHGFLFAAQVAPLLNLGFHYQGLARGD
FT                   ADLSCFTTTSAMKTCRPLVAGRVACAATELRRCLIGAVHDSGCAAESVLPVALGEQKCS
FT                   LMAAARTPSQRPSPAGVSRSMLSLPRATPTAGLMRDGFANPATEALCHAPAKTAPCTGG
FT                   ADPTCGSTHTASWYGSAIGTALAAEWSRRLASSADEVGPYWCEFISSTGIDALVTAAGR
FT                   KGGTSGDADAAYQTGPLLPSPLLPMRVRRGLESHLAPGGPSYLLQDFLPSPMRRHADSS
FT                   AGPQPLAAATGSVFVAVARAGASPSTSVSTTTCRMVHPREWWDAVERLLLREYTNRTEL
FT                   LTNETVQRSSIDVLRSTTHPSADESVAEA"
FT   CDS_pept        complement(650917..651843)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1690"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26015"
FT                   /db_xref="GOA:E9ASU1"
FT                   /db_xref="GeneDB:LMXM.36.1690"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU1"
FT                   /protein_id="CBZ26015.1"
FT                   /translation="MGSLSSSSSSSVATDAGPAAAQTDAQKVTRVDSLYSPHDVCEAAV
FT                   DYVLRHVNTVQYMIQSIEEITGKPFLRDRIKCLPVVPRGEASCNPAIGLTPDRVFAGYM
FT                   WRSARSDCQAKDVVLLEDHITRLFNTKHAAAFLRKDKGVNERAASSATTSDATAAAASS
FT                   PSATTTPSQLQRLLAGSQLPVLEQVERNIRHELVHAFDDARGVIESSDCVHQACSEIRA
FT                   ARLSGDCFVGQEMRKGRFNFFEGGQKCVRRRAVMAVDRNPVCRGFSERAVDTVFQKCYS
FT                   DYEPFAAPIYALGSYGDSQFANGTLKL"
FT   CDS_pept        complement(654508..656148)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1700"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26016"
FT                   /db_xref="GeneDB:LMXM.36.1700"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU2"
FT                   /protein_id="CBZ26016.1"
FT                   /translation="MLSDNDLTFHIPSAGLRSMDACTTPNPSAFSHLHLVGNPDWMSSF
FT                   SASPHVAAARPTLAPPAPVAIEPSAPRPLAAPAAIDAPAPAARKSFLSMFYRGSSSTVS
FT                   STAMPPKASSATSTPMSAPPKALDAFDTPTQRALPVDAQLSVEHLSKLDAVDATISAAP
FT                   LREPPRPMALGSDTWNALSSVPLPARTRTGSTRLLAPPASIDAVFSRESKPLWSDLSFT
FT                   SRFRSTAPTLEAFRNAPPAPILSTPPRSPQHQATSSTATVSTAFIPVPPKPVTASPLRD
FT                   AAVSSVEAAAPEAMPVTRREPRTMTHPLVPVGEDAPAVVTPLLRPVQEIPMVSSKSASL
FT                   APSTVNATSPVWGPEPLSLASGEPAHSASPLATEFAKSISRPTMQQAQKDEARAAANVR
FT                   NFISTLFSGGGSAETDTPTAGNRKADEFNALEFVTNRRGAQAKASQPVDYSTFFNTSLF
FT                   EDDHDEDSEEGLEKLRRVVLMVMQSAKNNEGNSVSQPTSQSCRRGGGVDGAGVAGMTAF
FT                   PSKYTEFSASYQTANNNSTDDSEWMQFAR"
FT   CDS_pept        complement(658019..659179)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1710"
FT                   /product="putative
FT                   phosphatidylinositolN-acetylglucosaminyltransfe ra
FT                   sesubunit c"
FT                   /EC_number="2.4.1.198"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1710"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26017"
FT                   /db_xref="GOA:E9ASU3"
FT                   /db_xref="GeneDB:LMXM.36.1710"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU3"
FT                   /protein_id="CBZ26017.1"
FT                   /translation="MSQQSSSETFESSQQCFEAARYAASTEEESSFPESEDYDRRSPET
FT                   RRYSSYPDHLQRLRSKQITSVSPSWRRVLYERQPFEDNYVDPQQFLEELSHNKDIKNYE
FT                   YATVVINTLAITQEISIVVLFCHAFMGVFTNSIDKYSLLWIDVLSVLAALVCYVFYHCH
FT                   QDACKDTAERPASLSTRCSPPSRQPLRWLFHAWNFGRQVVSLVTMLALLSPIFSTLTIT
FT                   YSDDTIVTLSILTMSLHVLLTDYSYLNAYTQRFDPNLSVNMAIYCVTLMASRISSPLAS
FT                   GALICFGIMCFSLSPIVRHLVKHYSFTAHVATTFGLVGLAIGCLTQIPILAILYTVTVL
FT                   MISFGIPWLFVRMHSSVKTQINGPWDEAKPTNSTAAAEWANSGFLA"
FT   CDS_pept        complement(660215..673258)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1720"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26018"
FT                   /db_xref="GeneDB:LMXM.36.1720"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR023362"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036372"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU4"
FT                   /protein_id="CBZ26018.1"
FT                   /translation="MYHYMVDALKGKHGKADGLVARSDPAVMDSEAARNARLREEEQAQ
FT                   RVLHERRRAYSDFMTCTPLGRVLADQMPTVESMATAPATTSAVSQTSTSLDTRATGTSV
FT                   SLAAGGERSSPTETGLAHTKLELIMYAVLAPLLSRRTAMMTRRVLELVPQSAPVAPEAA
FT                   RDEQVSTTFTLPPPPSPCQRPFITLEEAREALLPFLLVLVQLRRWQACLTSLSATLSSE
FT                   AAARSESTTSASAQLVKALQQLSHVLVAITCATELQAAAMRSHLDLLGGEATACVATTL
FT                   QCLRCLTRVCGTEEFSLRSVRTPAASASTAESMPREGEDAIGGGDRRDATSTRHPVSAE
FT                   VVEIQACRLLSLLLYWLHVVHDISTPSLAIEELFLTSSTARFNAYAATVATAKGATTGT
FT                   AEAEAEEVRRCTGLSNAALLRQTDPAPSCVPLAMLSLSASDASGGSGGDKSSSEGSSPP
FT                   LASSSDVAGSLTALLVFASKGVFEHAQPSSEAHTVMIEGLAVEEDSDLGLIFVLTSRLL
FT                   RDMFVAGASPHPAQVTKATDPLQSALSLLLARFIAGDRNPSTQRALAKKTEASQSTSLR
FT                   SCGAQQHLDATADVSFPKRSSLASTSRPPSPARSRCSSRASTLSEQSGRLTRQLRLLGQ
FT                   LSCGLVLLTALFKQNATTVLDIMDHSFFFDALVTALQVVGFRFTEPSPQGAMAVRALDA
FT                   AGRRDSDAWADWVRSVDTVAAQGTAAEGMSVLLNHALGCSSQFSLTLLSSNPYVDEFLH
FT                   AYLGLLAACRVVRSTPSAFIAPTLRGMLLGSNGAITASVREIRALDTLDQLELTLVKTF
FT                   LTAYPTSTEDAAPAATAPDAAMELSITLPPSPEQHSTNSESIDAFHHSGDMSGNGSLTF
FT                   PFASCIYNLLLKHALWCLGEQERRRGQPLPPPPPSLTPPQAPAPPQQHHLAPPLLQSSV
FT                   PSAVLRLSPDTPASTATNTPRLVAQPPPTHPPVSPTLSSSIITPASLQQSAAAPLPGHS
FT                   SLAAITGTGSSDDDPFVLFLVRHGLLRILLQDEHFASAFALVESTAAVDAADSRQGRSC
FT                   DEGAADRATTSWQRSYLVLYLLSHFLQLRPCDADSSDGEQLAPPAGAQGGGASVDPNAS
FT                   RLRACSRNSSNRALSADEQQLAQETTEALMMVLRVSSASVSPPCCAVAHCRRRRWCNCL
FT                   LALLSAATAAPGAASAKTTPAAAAAVCEALVRAGGVEYFLRTAAVAADADAAGQPANTV
FT                   SYAWAIQAARSLVNDSTASVHMATNCAESLLLPLLWHPLLRSDGQRLLEGLLCQPLVGS
FT                   SATVGINVDMRKLSLSMVSSSGRVGIDSAAADVHAVPWHCRKLCESVWRTLCDCVNGSG
FT                   VGSSGVEMPDTITSGPRAVSATNADEGARQAVLRTVLGALETAFRRLSGQRFSDAGEHS
FT                   GELLPLRTLQRALFEASKDGGPHIYELLLHQLAQSWKPVNNLGTPPRPPPLNKADLEEV
FT                   ALSLPFPDPILIAASDAPSAPDTSPAEATEASADAVAACRAAREMVRLIVIALVGMTLA
FT                   NPSQREVLYRATVDEEVLVNCIANAWGTTGGIGVLPFSRSMSKGDACGMVRVCSYLIYE
FT                   SVDAVDAFFDDDDESGCSHDASWAWSLQNPMLLAAVLRCFTRLASLTEDQQAALHRLLV
FT                   SLTRTVESCYASLYLAASSAVHDVLAQLLPVVALLPEPAALRFSSSIKTEAVIPRLDAV
FT                   LVRLLAALTHCHIDARQLKQLLLLVIHSRHQRDRRALVPLVLQLLSEAVQPPLNMTLFH
FT                   AVRRDPQHFVSLHRGRGPAGFCAALPDFPLEGYSVSLNLRWEGNVTSRDVAGQTAGGGA
FT                   TLRQYDGCACIFSLRTADRTTLLAFMVERGTGRLFVQYRNLQHQELRVYLAASLLPREW
FT                   THLCVSHRAAAFLTATAGGQLTLFVNGAEAAVIPQVAYPLMSRGYLYVGCLGHEVDRAS
FT                   VAHAFYGQVSTAYFFPYVLPEREREVMQTAVGVTDTAAWMLSSSTVTIPPLRPVSFAPG
FT                   RRPGSSAPESAADVDGAEQWLAGRAVVCVDTRLSDRGHLYNLSAVLRGRTGRESRLFTL
FT                   EGSLVCSTQRLVDSMGVLGALPSVLMPLCVLLVNPNLPISSRSLAAAAPIGSLNQREPG
FT                   LPPFSSLGAADVSASKASDKINATVLRVLDLVPPLASAEAIRNEMAEARFFVFLGQVLQ
FT                   LLGPSLQVVVPAAFVQLLEALAPFPRLFEDALTNLFLSADVIRAAPRAVQLTWVKVQRF
FT                   FLSAHPDALPCLRTLGTSMFVAAELLRVTAEEASAEELTQEDTLVPAQTQDVVTQPLRS
FT                   PSLTTSRPISAVPSDVSGAHSSATISPFSPSSTRPPPPPPSPPLCSLQDLENQWMAYFE
FT                   ALTVAPVTLGDAEALQYFVGNLHLTCPKASVQLRLLRRVRQLLVTSNTPYLVQLLGRRN
FT                   YVVSLMPYLTSTSSEAVRLEALLQVLFMVFRSKRTQELMNPVLLASKDTVVHVVEEVSL
FT                   SWLKDVLQQFPVNLPVYLALRCGLVERFDVLTLPTQYAPLDESHTIRFAAVLLPLLMLM
FT                   KRSTDTKLKGYVLTDMAVLLKSDAQAWRRVITVRGWYVSVVGLFGPSCASSPVSAPSSL
FT                   PEGRAYQESSVPGPVSSPTIPADSAVGERVQPEGSELAFTTISMILSYTIYQVLLHEAY
FT                   GVTELELVVAYLREQRLHRLLHQLLCRVADRYRSRLMTPWRGERRGGTGDSDGPGASRP
FT                   SNGCAFLGLGSATAVVNLCHFLRVVEVVLFYAGLAPRRKEAIMAPVKPAVSPFTPAGAA
FT                   SGGEEFGTYLPVRVGYTEWEQLTLVRSADDPPGGVAESDVYYAGEVDDPHGNVRRAVLR
FT                   SPDDRWLHLPLAVKCAELLCSHSALLHLGSNGNTTSLSVGGAGSVVGSGSAGSSGPGDL
FT                   LWSVVLGASAGTGVDNSPTSPKAGGVGGVGFGAGGGSPTPVVFRGGMLRLFGRLFKVLC
FT                   QMTLRSGTALSSVVELTDAFVRHVDRGQRGSGFLLLKRAVNAEDAREHSPIATTMTLIY
FT                   CVHNLLLRRLHAAEYGNTSTHFNANAALVDRLKSLVVMFRYSFEQLSAFASSPSRRGVH
FT                   SSVFRQSSLLAAAAWFTRGGHEDSDGDRNSGRNSTASCARSNLTYLDDLTGETLTAGVP
FT                   TLQWLCDHRANPRRTVEAFAEVASRVDYNAFAERCLLAAEREQSTDKALAARLWSEQRG
FT                   SLRRLQELFAENSMSRRLVHDKIRTLMTAFNSQKTTGAAGDTDSDAGAADLEGQSSAHT
FT                   DGFATESFTSLFLPSAARRATAAARANAWARFTVALRGTVWCADAAGLHNTLKYVKLSS
FT                   QEQQFLVHRKLVFDRDGTNYCGKAMSFYSAPTSPLCDDVSSAHVTSFGAMSAFLGDEGD
FT                   SAGGHTFGGSMNASTSRASYLRLRGGEGVLLQAIDDDDAGFEEEMMNLSLDDRGDVSTA
FT                   AAASVSECPLLWEEAAPLSKGVDPAPTSKVDDFSAAPSLLSVPCEVPYMMHCWSGSFTV
FT                   RGSEVIVLIDDDNKAYNQVVAEEARAYVLRPHPFSFHLSHITQIAPARRFRMRRTALEI
FT                   WTRDRRSCFVNFADTATMNAALQAVRCGERSSYMLTAPSFLRDAPGAATAALPTLFRES
FT                   TGGGVLRHSAYVLQENPRREPLRLRATALWRNRLLSNFDYLLVLNLLAGRTLNDMTQYP
FT                   VFPWILSDYTSETLDLTNPETFRDLSLPMGACGNGDRRELVRQRYMEMRSLGDVPSHYF
FT                   THYSSPAITLYFLVRLPPFTTLSILLQGGHFDHADRMFHSMQATFRAVMTSTQDVRELI
FT                   PELYYLPELCINENHVDFGRRQDRTTMDDLQLPPWAHNDPFTFVYRMREALESAHVSAH
FT                   LHEWIDLIFGYKQRGKDAIDALNVFNWHSYEDLDLNREAGPGDQQLLVDSLDNIGQTPI
FT                   QLFRRPHQPRLPLEWTDPLQLSIRVKVMTLRWGCARVARTTVVSTDRVLVVAGSGAAAL
FT                   LRIHLTPIRQSLVLQRAAATPPAASPPHAAASTAAASQLQRASVGDGFAASAPSQAEMT
FT                   ATHASSHVNVTAAAVPGHPAPPVAVTPLMNDPAPPAMDSGSFDVSEEYERRLAPIPAGV
FT                   IPNNSAYADGSCTEASTALLCYDSEVFLVLGGLFDNSVVIRSLSGAGGDVRLHVHRGRV
FT                   VFVARSEDSRYLVTGAEDTTFAVWSCQLQPARQRLGATLLFTIHGHEGMPSAVDVSSML
FT                   DVVATASVNGTLMLHSLSTGGLDRVIRHPYGAPIHRVLLQTMCYVPNIVFLSHQDEKVY
FT                   QYSLNGAALRTFSPPGRVTTWAATGSQCLLIACQPLACVHGGSSASAPGGGPHDGDQTS
FT                   CILYLHSFFLDVLKTVPVRAKDVVSSVSVHPSNPQVVVAGTESGRLLLLRSVLV"
FT   CDS_pept        complement(675399..678284)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1730"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26019"
FT                   /db_xref="GOA:E9ASU5"
FT                   /db_xref="GeneDB:LMXM.36.1730"
FT                   /db_xref="InterPro:IPR007265"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU5"
FT                   /protein_id="CBZ26019.1"
FT                   /translation="MAAKPTTCDASEEAALMRQLELLLVPLHHRFRYPLPVPAHFTAGE
FT                   GDGASIAASLTRAPGSPALAGAGATGSSYADSAGAAASNFAGDSAQLSAPQQDERLHRS
FT                   ALRVVEKHVPDLLMWQARVQRGATQAGNCYQVLERVRSSVSAMQRVTESVQKQSEHLSH
FT                   NASAMMVRKAKLELVRDALEQNLAHFTHIDDLCREAGNPFLKAGSARFSTLLQDIAKEM
FT                   DFLCTNAQYKSAKPYAMKLAVAQQTVSAALKDAVRTSFRTMEAETLASPAFRAATQVLE
FT                   EDSAIPSDSTIIRASTWTSAVSMSTAAAPPPSASTASTLQLRPHDVAGSFEEFLAAVND
FT                   VFVKSGDGFTSLRRMAELRQGGFGYSGAEAFGEEMLTAGGRLEVDPGMREVMDSYCEAR
FT                   VGVVVPLLRYWLTLWYYLDAQQSSRADAKTTGSVAAAAAAAAVGAKSPTDTGAARQQLS
FT                   GVAEAHTLPQLAEHICGLLQRSLTAELDVLTRLWLRDDIVSHLLPRLVPSIAEEVYYMF
FT                   RSRLLCVDDVGELSRTVESIQRVSLLHNTGVQDSQVVSDLWVRMIQDTQERLVFRTSVY
FT                   LRQTVSCCTPTREIASVYLRCGTDAYTAEPAASTGDAAQTQMFYIPGVVHALKLLDWLY
FT                   PTLEFSVFSVFAEEAVHHSLDLIRQLMRLMRQMDSSDTLRDSKAFLCQLAHLQHLQLTL
FT                   SHVDANITVVEKHISLAALRNRRLELEQSSRESKKEVEMDLLRCSEHLTTAMFALVTQP
FT                   VSGAAKKSEAERIQLASEMKGRAAGMERMIAFYVEHEETQQDLMHLLRERVAELAAEMS
FT                   VDVHAVAAAPVKTAKLETGSAAQNTPQLSVTEATVAPLPPASVPQPERTAAGGSADSYH
FT                   ATPQPFATPAGAAQPTASAPVTFAGATDPFAALPAHVPSASSGFPSLPTERVTYASAPP
FT                   PTTVYHQPPLQDCAAPAARARPSTHDDTDII"
FT   CDS_pept        complement(679148..684658)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1740"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26020"
FT                   /db_xref="GeneDB:LMXM.36.1740"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU6"
FT                   /protein_id="CBZ26020.1"
FT                   /translation="MNRTSVRLFGNYSRTSGAQQHSQATHTSSSSTTRSSSVLGSLVRM
FT                   RNQFHRLRHTQQQQAIAAVLARYQLQPALKAPAASTSRAAGQIDGDDSLGQEGSSDAVG
FT                   SAASSVLQTAIILCTEALRLLKSEVRCHDNLSDVPKSSPMYGSEIGKLLNIAAAFGAST
FT                   TFPRVQHALHWIKLNKESLHTPRQVMSLCMPLLSLADGRTAGVAFVLEELYEPLLFALQ
FT                   DVASSSPESAAESADNAPSDTTAAVQQHLVAITSAMGMVAKWSSPRLGSRSKDLLTSSP
FT                   LEVHTAAKSDATVEELDKMLRIAEACAAALRRQIGRCHGTGSDEVFVAMAHLSPSDVLQ
FT                   WIQCLHGLEKMYALVAPTLGISRAEAEAASRRLLLCYRALLPLMQRTLELAGGGGGATV
FT                   AAASNATLATGATATSVRVTDVVELIQVGLQASIEASHVDLALSYGLQALPGALASAMV
FT                   KDLSDAAQVVNKVRQKRPSALPAPLLLSIQAAFRPALFLLRETHALQLRASDCGVLLSS
FT                   LSRWEEVPGVTVSADIVELLSQRFGEQMHVVGASQLVPFVASLARFEERKRSPQRSGAA
FT                   GQAVENAAVLGEGLAGDGARLASSGVAWKTSEGPADSLTSSPVRGARTRGAEGVRYRFC
FT                   TTSRIVSQCVQRAIVLAGDNETPGDPAVPSRLSPADAAQLLTYFVQLSAPQCAGFFNKA
FT                   EPLLASAMQGSADTPSTASAAIRLRVVAGDAVQRFVRYAAQQREQTWAQCRNPTTQEIR
FT                   EEACVVEAQRATALLRGMSRGLAKLIREAASPKDLVLACSLLRRRLLNKGAAAGVIVDG
FT                   GEAALKKLKGTKPSTTAARARTRTRAWTRKELELAAVFAAQAVKMAPECKGVELGALAS
FT                   ATSSFCTAGVLPRPVAQQFMRAVWARCAAGLAVASMGEAAGPEAAAALTLSLENCKTIM
FT                   DASRSAHLSRTAPPVIFLEAFAAQCSELLEGDSGAVGGEESPSTVRGTARAYAEAVTKL
FT                   RRTADLGRSLVSYFGSLRPCRRAAEGDVAMQSTTWREAQVRALESYLEVAHSVVETYAT
FT                   EATLSETWWAELDDGSPPPMPLELLSTTANVMAQVYRLMHRGVGSTTRVSGVPETAPTV
FT                   LDGVPDTEDNVLDGSLAAVDGAGVAVLSELACKTLEDDVEPSPLLDDSPANLSTATLDQ
FT                   AVRDTLGLLGDTIVALVRQQQQQLSSSVSADVSDETATEDYSGRLTTAPVRAFVQNPKH
FT                   LLMLLRAFETVEHPHPEMLYSVLPELRGCADRLDPLELSLLIRALTQLGAWNSRLLSAL
FT                   ATAVASKINQCELRQCYTLLHGLCRSGCTSPDTYVELRSTPRRDWNSGCGGASNKAAAQ
FT                   EPLQRLVEITLLRLDAFVRTKDSFMSLARTAAVGDLVGVAKALRFFYAPPPATYDAFVV
FT                   LAVRRLASQAQRLSLGTVVQHTMALLYAVSELRRPEQQRVSAQALWTVLRRAFASSTEA
FT                   SEPGALTETAGDAFGGVLHLPACWELTRFAAVHSLQYGREATRDFFAPIVASTTEQRVV
FT                   SCARLTQTRLARFIETHASDVAADTHSPSPPLTAADRAALRRYALHASPCLVRGDRELE
FT                   DHMCAPLKLARLITDGDPTTLVHAATTAAPAAQARQCIRLLACLLRTDLWAPSISAATA
FT                   DTQMLVAALRRLWTVAELHGLLRDSPGAFSTEELLVLAAAADRVHQYSIDAGNLQQEFA
FT                   VAVRQLCAATTVWRLPAAVDAWMLFAMPFMASSSIPAAALPDCSDELFLMLVASGDVLV
FT                   TRFAHAQRSWATSGARMLPELVRLFRGPGQLDVAMLQPRAVGDDTLSFALPHTAPDAST
FT                   ARVRFVVMYEELLRCFTLCLA"
FT   CDS_pept        complement(686203..687837)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1750"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26021"
FT                   /db_xref="GOA:E9ASU7"
FT                   /db_xref="GeneDB:LMXM.36.1750"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU7"
FT                   /protein_id="CBZ26021.1"
FT                   /translation="MSPRTSRSLVTLGAGLLLVMFACSHSCHALCPSNGNTHTIYVTSN
FT                   MGDNIWSFDTLGNYLGPVLNKASFPPGVRVEKLRSMRFGPEGHLYVSSARGSYSRVFAV
FT                   SGNGLLNGTMEENCTRDYLFTVIEQDKANPFLDHPYDITFHPATEDMYVSNQNSVTVTR
FT                   YTRDRKADVTPEVGAGGSQHAFYPAWKPAKNVEAAVEANEKTISGEEMVVAPKDIPDSS
FT                   GLFASSWSSSYSMSSVRGLTISPLLPRALVEGGAPSGIFAVTNESTMYYLLVCDVSSNT
FT                   VHVFDPESGERLFGLNVPSPIQVMFPSRYYIGDSSSLPVSAAGVPTQRFDVPYIYVTSK
FT                   EDGMAYMVRFSSHQGNANTNGMQGGAMGEDFIRAHRLYTINHPTPLHAASGIYENSARD
FT                   VLLIADRNGRRISSYASPFLTDYTSGYGPSPFLGFFVKHLPDQPEFIMSTLLEHQENIP
FT                   FCYELNKDGKFRYAALCTAAWIWSVALALVLILVPSFIVYHQIQHCMYGQRLQQRQRYV
FT                   DDDASGLYGSGSNSPLLGRRAPDYGSA"
FT   CDS_pept        complement(689153..690682)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1760"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1760"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26022"
FT                   /db_xref="GOA:E9ASU8"
FT                   /db_xref="GeneDB:LMXM.36.1760"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU8"
FT                   /protein_id="CBZ26022.1"
FT                   /translation="MSKLFRTVGAKGFQPFDWANAAQYASGTTPMMRVPACYINGAWVA
FT                   SALSDKTVTVEDPCTNQVIGAIPCMGFAETTAAIEAARAVFESWRQVMPRQRAAAVRRW
FT                   GELMLKHCDVVANILSRESGKVIAEGKGEVLYAQGYADWYAGEAERIYGDIIPGPRPGV
FT                   QTTVFREPVGVVGIITPWNFPAAMIMRAACGAIAAGCTVVLKPAELTPFTAMALAQLAD
FT                   EAGIPPGVFNVVAGDAPKIGDALVDSFDVRKISFTGSTRVGQHLYRRCSETMKKVSMEL
FT                   GGNAPCIVFEDADLPRAADQLIAAKFRNAGQTCICVNRALVQASVYEEFKSLVADRVRA
FT                   LKVGNSFDPAVKVGAVIGSATLERMTHVVEDAVEKGATVMVGGKAVGGRGYFFEPTLLT
FT                   NVPHDTALCCHDELFGPVLPLLPFDTEEAAVKMANNTRAGLASYFFTSDYRRQHRVARA
FT                   LRYGMVGVNDSALSSPAAPFGGVKESGIGRDGSKYGIESFVDIKYVLFSTV"
FT   CDS_pept        complement(692914..693234)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1770"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26023"
FT                   /db_xref="GOA:E9ASU9"
FT                   /db_xref="GeneDB:LMXM.36.1770"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASU9"
FT                   /protein_id="CBZ26023.1"
FT                   /translation="MFRRALGASAGRSLSSISAAVSRRSYTELSHMKFPVHYGAVGAVL
FT                   GYFVVMWIVFVRMGSKHTARSEFKNDYLRVWRRKLGTGYQWADAWGPQMDTFFKDLPEE
FT                   VE"
FT   CDS_pept        complement(694260..696491)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1780"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26024"
FT                   /db_xref="GeneDB:LMXM.36.1780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV0"
FT                   /protein_id="CBZ26024.1"
FT                   /translation="MPRMPLSSPLTGGAWRGPTSSITAFKVREKHEAGMRLLQGGLVYE
FT                   AIQLFQEASFFDAENVRPVVALAECYVFLCDLRSAIRCYRRALLSLHKKDLDDYCRRAN
FT                   ETPTNTVDEVSATNSCRVDTSNSPEGTWRNSGGKTRSYGVADDTNMAWESRLETAQDPA
FT                   LASQPVGSSSPSELSIQGFADCLQSAEMPARFSEHQPSLAKSVNSAASEVPATTLSPPA
FT                   ADATPTVKDIRARLAGVLDALGLSLYQLGNVEQALRCTTEALELLDAAARASEGGDEDV
FT                   LSSKSPQFLADPTIALHRGVYLMTLQRDEEAEGLLEDHFAIFPHWRPQTAALLVQLYCN
FT                   RQAFRKARVLLEAQEEETYDMDSSKTPAEVHGNPDEVLCDGQRRTLAPSLPSSTDALGS
FT                   LAVAKYLFTELYARYRTAALASNDGASITRCLSIYSNDFDLLFRRAQLSVAAGKHKQSV
FT                   KDLFRCVRETNGEHKEAIEMMTTVLSTIGSSLNGEAEVQDAVTYYSESLKWRPDNVLVL
FT                   LARGDCYTKMECFEEALADYEAVLVLEPDQRDARQRIASLHDLWGCKLFAQNQPKQAEA
FT                   EFTNAIKTDGRNPQFYYHRALCRLKLDQGRYALRDVLSCKELHPTAPHLRAFIARYLEP
FT                   VKLPEASQRRNTSQAAKRQVAASSVCAAHTPPPLADCDEPPAFQQRRDRDTGDTSLHLA
FT                   NGVVSTATGVLPRIHRRVSLQKRSAVMGWVQGCQTTLHRRETGAHGPVK"
FT   CDS_pept        complement(697580..700261)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1790"
FT                   /product="putative exoribonuclease 2"
FT                   /EC_number="3.1.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1790"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26025"
FT                   /db_xref="GOA:E9ASV1"
FT                   /db_xref="GeneDB:LMXM.36.1790"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="InterPro:IPR041412"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV1"
FT                   /protein_id="CBZ26025.1"
FT                   /translation="MGIAGFFLWLQRWYGDCIDNIPQDVVDAAFKGQALPHSHASAYSY
FT                   DNFYVDMNGLIHPCCHDTAPLPEPENEEEMFERMFDQLDLLVRVVRPKKCLVLCVDGVA
FT                   PRSKMNQQRSRRFRAADERLESDAISNACADRIVSEYHLPRPRVRERWDHNVITPSTAF
FT                   MERVALALEWYIMKKLNEDAGWRHLTVVFSDAHVPGEGEHKIMQYIRGLRSQPGYDYNT
FT                   SHVIHGMDADLICLGLSTHEKHVCILRNQLTETFQPDHNRFCYFNLSTYREKLMQDFAN
FT                   IEGMQFERVVDDFIFLCFFVGNDFLPHVPLVSIKTRGIEMLLDHYVRDFALHGYLTQLG
FT                   EVDYAHLHIFLMNFTSKCMVKLTKEYYGVVRAKERAKQHVEERVTKTEAQVSEVLATLL
FT                   PDRSNAQEVSDALLGLMSSARKERTRLVVDKQPLGFSYLDKTYRDAYYQHKFGWDPSTN
FT                   RAAFERQIRLCCAEYLRGMQWVMRYYTKGCPSWEWYFPYHYAPLLQDLAAFTATVNVEM
FT                   RMSAPLHPVEQLLAVLPRLSVHALPEELHEAVNDPKSVLGKFYPAIVNVDFSEANFSYQ
FT                   GVLRIPFINCEALSKACRQLVELEEDFGSTFLYCHESTSLAKQLDALTGPSNSALPLAT
FT                   SLAPPVVPIPASLASTMPIAGRVGRYEAEWPRHEELQCPDPGMAKSTRYGGPIKSNQVN
FT                   QYRYELSTQADYRPVLMGEKTTFKNGAAAASMTSKRLGIEESPLRHRKRGRDADHITNS
FT                   NDGKRKRGSSRHDDDRDGRERPRSNGEREKNGESRRRRKDGDTCEASSSPLHTSSSKHR
FT                   SGHDDDARRSSESRHRSKEGKKKHSQHETRSRESKSKAHAAPSSSSARRAKKSREAKKE
FT                   PRPSEKVASTTPSRHGHRQRRV"
FT   CDS_pept        complement(701466..702617)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1800"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26026"
FT                   /db_xref="GeneDB:LMXM.36.1800"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV2"
FT                   /protein_id="CBZ26026.1"
FT                   /translation="MCAALSSFHTSLPRRTSLPMTGEPRSLGSSPVSGRCPPGHRTTAS
FT                   TIRTHADEHLPLCVIQAADSPSSSAEASSLPLKAFFVNPACAVSATAIVSGNVAAAQGR
FT                   WHADMHEVEAYLNALDLARADSAKAGLYHRAQQCMQRMEKVIRLLAKRIAREANVMAER
FT                   ARQALTEQQRLLKRSFRKRWKTKMLVYEENASAMLAAAEQHHYAERVREDVRAQEELRS
FT                   ARAAGSMARSCSSMMQHLQSELQLYLRQHRYCEAERVQGQLSRLEKQEQQAHQRNITHL
FT                   QEQRLQAMRVKQDEQLAKMKAAHQEERQEITRTCRAELDAMTRQHEAALQGVEERRLFL
FT                   HERVQAVLKAYSNADALDPRATGLKLIRISQLLWTYHEAQQSS"
FT   CDS_pept        complement(703768..706584)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1810"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26027"
FT                   /db_xref="GeneDB:LMXM.36.1810"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV3"
FT                   /protein_id="CBZ26027.1"
FT                   /translation="MTTTTVRPATSSLRSRLMNMSTPLGSQPTKVDPSSPFPVDGKVGA
FT                   QHPVSYFTVALTQPALVVIRMKEGNTASRCALFLSCFYPKPDANNAAWRLISPEPVKQI
FT                   VLHPADPAYRVDMLHIAVHYLEQSGKSNFQLQVRVQSEFFAMWLRTGEGTRAATGAAVA
FT                   DHMTAVKTLPSLGAPASGKWAAADEVGMPAVPTLHAMLAAAAARLSGSAANLAGAPFTS
FT                   LYVGDWRGDQRDGLGFQYYAAPEEMLSQTTLTKSDAKNFEHSVAGRTDSSDWDAICTST
FT                   SPQAAPRSGLDAAQPLMLLRAFSERYNLPWSAWSIPDTLTPEDLARLDFGFCFHSTSRT
FT                   RGGAAETGSTSDQATVPGKGAAPPSPTGDSSLAGTVAVPPTPPVAPCTTAAEGMAALGG
FT                   AIGAFLVGEIRSNEADAWKVLPVQPGVEVYAGEWVANQEEGRGVYQWLDRSYVGEWVCG
FT                   RREGYGFLRRQDGGWYRGQWERHVPHGRGEARLTPEGLLYKGEWRDGRRHGSGALTYPN
FT                   GMTVHGMWIGDALQPRVRVVYEDGSTYDGLWDPEEACRHGQGTWTDTQGCKHTHEWLHG
FT                   IRVGVGQEVYPNGVVLDGVWRAGELVDGTYVFPNGDRHVGSLDAVLHVREGAGTTVSAD
FT                   GASVYTGAWHQDRRSGYGVQTVQRPPVACKSGERAARPSVERYEGEWLEDLRSGQGRLT
FT                   DCDGIYEGEFALDYRDGNGVQRNTRTGSFYEGSWKANRRCGAGIYYSATRGITYEGIFM
FT                   HDRLTSIGTATNTSLAEQYTGSWLDGLRQGHGSLRLANGDVLRGVWHRGAPDATATVEY
FT                   IDADTSADDPRRAVAAVSRYVGGWQGGAREGTGTQVFRDGSVYEGTWHANKQCGCGRLT
FT                   TASGESVECEWRDGCIVDGCIGDAHFADGSVYHGHVNVAGVPHGVGVLTYPDGTVFDGQ
FT                   FLNGIYQL"
FT   CDS_pept        complement(709319..711937)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1820"
FT                   /product="putative ras-like small GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1820"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26028"
FT                   /db_xref="GOA:E9ASV4"
FT                   /db_xref="GeneDB:LMXM.36.1820"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV4"
FT                   /protein_id="CBZ26028.1"
FT                   /translation="MTGDISMPCSTDEGAFMPEIRVVVLGDPRVGKTALLRQYLHHEKP
FT                   SRSVGYESTLLDSYTRVDYCGAQPYRLIFTDCSSASSFREHRAAYLAKCDVVILVYSVR
FT                   HRKTLLNLRHWMEEVLEARGLTGSARGASTTDLGEVPIFVVGTHYGENDSSEATNPTST
FT                   DEAESITKECIHSAGYFVHRDDTDTEEALRLNSERSQKAQQRHQRQGRKERRSPRTFHD
FT                   LLLKLFHSNADGEGRDAVTSKMTLSDEVTASQKQQQQPASPVSNNGCFSSASSTPMLPQ
FT                   VKYGMANSKTKPGNRTATLRIPRGASTRLPLFQLSNLDGKAVDMAVRASLSLHLWLQRH
FT                   EGDSAALSAAQTPHSNGATASKPEDAAVQSAPPLESSTGADGGAGAATESTIKPLTVLP
FT                   ATLQAHAISSALHTSDVSERSGASFIPPMVALYNVGASVSACGESAASPTLRHSRDASN
FT                   VKQTAGSVPSEAQQPPQANSSTEPSRETAFSCGNGSSEVTVGAKNEVKPSDQKAFGEVG
FT                   SQALARHGKKTEYRTLLNSSNVDSAVHKEKKKDDAAHSGHLQTPMTKRAELVSSSELGG
FT                   TAVLGASIQAGEPTKGKTPSCLSPRNTSSAAAPNTGSSEANGVTGKMGGGHSTISGPRM
FT                   QDGALPLSTAPSVATKPRGDAVTDGGTGGVSQQPTLRVEKEMNVVKEGDSAGTNSGGDR
FT                   LTRTAEPVTKLPLVRESESGPSSPPVLRRPRENGSPGVFTVRAVPREAPASSAPTTNGH
FT                   DNAPFAATLSSGDECVLRSPYSTPTTGAGAVKNEVAGNKSAHEREPVMLSRPPRSRSTA
FT                   REPKVSQSEPRRPQKSRRTQSKRRRDRKHGKRSASSTRIIIGQQEKQKTTQCLAGGCVG
FT                   M"
FT   CDS_pept        complement(715436..718069)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1830"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26029"
FT                   /db_xref="GeneDB:LMXM.36.1830"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV5"
FT                   /protein_id="CBZ26029.1"
FT                   /translation="MQTEDAAQSPPRKKRGVAVAGLADRDKMTAAAVVSAPPLPSSFMP
FT                   VPPSSHELHTGRKPQPGSKRGRVAKRQSCVDGDRPRGSHSHTETTLDGTAAPASPTFYR
FT                   PTGTNRTLIYDVESPLLLRPPRRSLQDAAASPPPLVGSIATPARRHAVVLTSTPLVIRE
FT                   ERERVADDDAATHGPSALLRTPLRLVRAARGLLSPASATLRRRLTHLRQSAAGATRSER
FT                   GLQRQQPTAASSASPPSPSPWGRLSAIVPATDSLPSWAEEEGISGSASARAASRRRGPA
FT                   LSSEPLPDAAALSSIPASQRTSVSESDMWRRSGRGAELPELLRPTIHSDSVVLSDSSEG
FT                   DITASLSRQSSPIVTAVDEVRGGSRLQRRRRVDEELMGAGGVGVSAALRGPCDVRFAQV
FT                   SSLSESLADIVSSSRSTAHSSLTSAAAAAASSTAAQNQISSAGHGSTGDAGEACIPRRS
FT                   ATVMDPNFSSILPDEEELAIRRRLQRGRNRQAPHIRRDSDIRGAGVAALGQARQNPVGT
FT                   RAGAGNVMELFVSRAPQPAPLDWLQPLQPEVRRCTSSRYASGVSVSAAGGVAAAASVRE
FT                   SLASRAHAADVWPPQPQRQSASSTLPSPPWLTVACVSRLTVALLSALVCVWCVVAVASP
FT                   LIVLQPRYALSAVTRTDAVAAEAQFVQTHANSVAELQALYKIAPASLGADAVVRLHHRT
FT                   LSEGVERLERATQHVVPDDNAPPSRRLFYLRAMIRAYLALSRNCELYARSRDSSYWRRY
FT                   VVYPLADMRLYGVRRFGSIASRSLITTSAAVAWRDRVWTTVMCSAQSEVLLCPSVLYVE
FT                   EAMARDAAQFVYTDVNEAHESPQRKRKLQEWRVRLHRDWTSEVYLETLLRYVRSGVQEL
FT                   TRNYNR"
FT   CDS_pept        complement(719908..721884)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1840"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1840"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26030"
FT                   /db_xref="GOA:E9ASV6"
FT                   /db_xref="GeneDB:LMXM.36.1840"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV6"
FT                   /protein_id="CBZ26030.1"
FT                   /translation="MSARTPTSSPLGDHSDEAAAAAAEQSTKKRRRLRHHRCKSARETA
FT                   SNTAGEPYDELAETVENNDDANSVEGAQAAASNVVSTKRSEKRRREDDSDDGDGADADA
FT                   TGWSARQCHPQKPGAAEGGKTSFPSASVSLAASSAPDGPTAVSMMQRSKELAKSIPAVT
FT                   DYKSLQLNPHIVSALEQEFKFRELTPIQSRCIPAALQGRDLLAEAKTGAGKTLAFLIPI
FT                   VEIVCRSGFRPSNGTAAIIIGPTRELCLQIEGVLLKLLKHFNGSLTFLCCIGGQSRNQE
FT                   GFKLANGVMIVVASPGRLLDHLKLTTDWHTKNLLLLAVDEADRVLDNGFEEDMREIVAL
FT                   LPKNRQTFLFSATQTTRVEQLARISFHKTPIFISMKSKKDKATVDTLEQGYVVCASEQR
FT                   LLVLYHFVKKNLKKKVIVFFSSRNSVSFHCELFNYIDVPCIAFHGKQKQHQRSATYMQF
FT                   CNAPSGVLFTTDVAARGLDIPEVDWIVQFDPPDDPVKYVHRVGRTARAGRCGNALMFLL
FT                   PQEELFLKYLYDDAKVKVNEYTFDMTKIKGNVQGQLEQLVGTNYYLRTSARQAYEGYLL
FT                   SYSSCQLKNVFNIQNLDLAAVARGFALSEPPPIKMDLSQSAAHMSKKSRHEFSAMRHTK
FT                   NAKRRDVNAKSMSQRHQNISGEW"
FT   CDS_pept        complement(723060..724643)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1850"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1850"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26031"
FT                   /db_xref="GOA:E9ASV7"
FT                   /db_xref="GeneDB:LMXM.36.1850"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV7"
FT                   /protein_id="CBZ26031.1"
FT                   /translation="MSSARRKLPKALREDGDGGNSESRTSMLARSTSSVRHQSLGSELL
FT                   DDEEFKAKTFQDLGLCEELCSACAEAGWQHPTRIQASAITVFAEGRDLIGVAQTGSGKT
FT                   GAYALPLVNWLLTQRKTPYLSVLVMVPTRELAQQVTAQFVLLGRSVGLRVATLVGGADM
FT                   VEQACELSKRPHVIVGTPGRVKDHLSNTKGFKLVKLHALVLDEADKMLDMDYEKEIDAI
FT                   LEQLPQDRRTMLFSATLSTKIDRLQKASLLDPVLLQVHRKNTTVDTLKQYYIFAPFAQM
FT                   LSYLHLFLTKETGNHILIFCRSAALVHKITLALRILGHRALPLMGRMDQSNRNIALTKF
FT                   KEGKVRMLICTDVAQRGLDIPHTDVVVNFSLPDHVEDYIHRVGRTARAGAEGKAVNLIS
FT                   QYDIVLLQKIEQQTGVKCVEYPSLAESEVQLVLQRVEDAEQEAIREIREDAEERSLEKE
FT                   SRQLTTARKGKRDRGDADMGYDDAKHGTSDFATLRMRREHESIFEMTKKEQHKSLWAKR
FT                   REAKQQAKSR"
FT   CDS_pept        complement(725462..726757)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1860"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26032"
FT                   /db_xref="GOA:E9ASV8"
FT                   /db_xref="GeneDB:LMXM.36.1860"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV8"
FT                   /protein_id="CBZ26032.1"
FT                   /translation="MLRPTCAAAKNLTSFATKGTMRGGIPRIYYTWMKPGSATRRRFEK
FT                   MRNPFVNLETGTSLYFRDTRDSAEAVAHAADSKGLKGMDNGVDLYNEYRIVPDLYPEGF
FT                   QWKHKLNTEYNQWRSNTWLTPELIPQEHRGRFLCNFQLNIVAYDMRVVKFSPKDHRQWI
FT                   YCVLYVGTGKGIAGFGRAVAPSTQEARNEAIREAFSNIIAVDLEQEGPMYPVRINADGA
FT                   RVLLYPARRIIANFRVADILCAFGFQNAGCKINLKASNNPKAPTHTVEGVFEAVRALRS
FT                   VSEIAASRGKVPHSLVYNIYPYLEEMRRRKGMMAMHPPGKDGIFMPNRVVDNRMPDHLK
FT                   KGYYDDVYWKDFFAGSKEQLNESKMGLRGDELREQLEESQGRTAKRSNRRTLDDVLRRL
FT                   GKTSRDLGALQVVNPRLDAKLPTHVKRNYLLH"
FT   CDS_pept        complement(728393..731023)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1870"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26033"
FT                   /db_xref="GeneDB:LMXM.36.1870"
FT                   /db_xref="InterPro:IPR002499"
FT                   /db_xref="InterPro:IPR021870"
FT                   /db_xref="InterPro:IPR039059"
FT                   /db_xref="InterPro:IPR040989"
FT                   /db_xref="InterPro:IPR041134"
FT                   /db_xref="InterPro:IPR041136"
FT                   /db_xref="InterPro:IPR041139"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASV9"
FT                   /protein_id="CBZ26033.1"
FT                   /translation="MTETVVRLGPQEYAHLTNLNTNTTELILGPLNRPVASHESVALPP
FT                   TKFVVVPPTQYCLVANPHRTAVDPATGIAQPVRDAYGQVQVRSGEEEYRWHVPPFPLYP
FT                   EEAVVKIEDLKVLSARTALQIQVLTAYNVPVCSASNSSPSPVRREAGERYLFCGPGTYY
FT                   PRVEERIEDEVTAYTVERGSALWCTTSETFTDSVTGLKHYAGDKYMYVAEGMHFLQPFE
FT                   SLQRFAEGIVFGTEEGLHVQPTKTYADPRTPFREKGITRKANEPFLVTGDMCPCFVLHP
FT                   YDKLLKTVRRTHVTASQYAVILNSVGDDGNAGGGARRIVTDASFFLMPGETLEKDYPRS
FT                   AYLLCEQEAVLVTALGNFTDSSCTPPVQRYDGDRWLVQGPCSFIPSDLMRVVPNAKTGA
FT                   EVRRPYLLSEGDGLYVRNSVTGVVRCIPGPCSYLLTAEEEVWEKPLSAQVERHLAQLVS
FT                   HAAYIELERDKERKVLQGQTERAVSYHIPYRSVTQLYNYKTQMTRIVFGPDRVLLEPDE
FT                   AFTVVSLSGSPWDPAKPTKCMPKQTHYITALHLFLGPSNMTDVVHVETRDHAQLALQLC
FT                   YDWYFDVTPGDTEAAKECFSVNDFVGDACSYIASRIRAAVASMPFEEFHKNSARCLRRA
FT                   VFDVNPATGQPNGFLRFPANHLVVTSVDTQEMEVLDERTRQGLQKSVKMAIEITTHAQE
FT                   AEAQQVAMAREQEARGRLERQRMHDKVANEEQRRVLLDAESNGLAIVSSGKSKAIAEAL
FT                   SSASRIESEASVEAATVRAAKELLLYNTMNEMQNRKRLLLADQEEKVAAITLTYEKALE
FT                   EVRHTLMGRVVAALGPETIAEIARAAPELQAKLLASLGLEGYLVTDGSSPINLFKAASG
FT                   LVGHA"
FT   CDS_pept        complement(732558..734462)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1880"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26034"
FT                   /db_xref="GeneDB:LMXM.36.1880"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW0"
FT                   /protein_id="CBZ26034.1"
FT                   /translation="MQRYLMNTSYLQGQLKSLYALHNKTVADYGELVQNLNEECTILCD
FT                   VIPSYRISSTLESEDGGGQRKQKEVYNVQKLEHEILTQYTHFLQLLRKLSRKLHPEQQA
FT                   LGSRLCARLVKSSAPEFNHADALLSLAIDFANSKSVRVAQPCQTALSELLDGQKVSDTT
FT                   EHIVGALLRIVRKRSYAMNPKLLNLLLHVRVAMVDVHRDDLTEEKAKNKRLKKEDKELA
FT                   RQLQKSKARRDRAEIAAKQTRILHRIFVIYLRVIEASKTCSPVHQTKILAPTLEGLVKF
FT                   APLVNLELYQQLMEALKDLVKGGGASRTRLRVGGTEGGSDGDNVDDKYEEEAATSVTTR
FT                   LHALVAVATLAQRDATSTASEWRVDLSYFHEVLFRCLGEALELPSAESSSSAKMTREEE
FT                   QEASNGDMDEVASQGSTSSAGSLSSQAFSIAQSMTQGVFVHQNASREWTFHVGLVLRAV
FT                   DLLVLTQKHLPVARVTAILRRLMQAAPSCPPHIAMSILALCHRVVLRYPLAGGVIVGGS
FT                   DNVIAGRGAYNPEALQTASANADSSFTWELSLLSHSYHPTLRQVAETMCKHYHKVSKHQ
FT                   HGQAPVVTKQLDALGPYEVMEEYDPSLGNLKPTAPLPTALKAEVRKRQREEAQAYEVA"
FT   CDS_pept        complement(735652..736191)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1890"
FT                   /product="putative endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1890"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26035"
FT                   /db_xref="GOA:E9ASW1"
FT                   /db_xref="GeneDB:LMXM.36.1890"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW1"
FT                   /protein_id="CBZ26035.1"
FT                   /translation="MAVCAGWRLGVVRALLAVAIVCSLRAAAVTTAESSLSSPIVCTCR
FT                   CCYQGGCSPLTNVSWTVSSCNECSTKMCNDYISSQQVRADTARLFEGIQGERPLSDTVV
FT                   VQECEVIAVLEAATCTMKSCKRTSTIKAECYDRNAPLIKYSIISFVLLTIFAVILGIIK
FT                   NYIPAFQSLNEKYFNY"
FT   CDS_pept        complement(737731..742698)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1900"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26036"
FT                   /db_xref="GOA:E9ASW2"
FT                   /db_xref="GeneDB:LMXM.36.1900"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW2"
FT                   /protein_id="CBZ26036.1"
FT                   /translation="MVLNLFSGAALNGHGSTHRRGRASSSLNSTDTGRRPQQQRRQASR
FT                   STTYGASMQTDGAEQSGSGLRAEAAEDRVLFNNCVAQVQRHLKTHADSPSTLHTLASYY
FT                   TKTEPFIEGRPFCVTLSYATFLFHMQMARISVTDVELYVQLLTSILSQITEDDQLHHPF
FT                   VQQVLRDHVFGLPSPTCRGAAHSVVLLSPQQYRAFATMTTALISLAVVPLSIVYQFHDR
FT                   LETYCECASPLVANRALALLVQTVGEVRMDEQVTALQYVLKTKPVKMNVDFLLACYERL
FT                   KRAVMDPAHGPSFGRALSIHCSELFLRFRSPVRRDYVERFLYPSLCHSDMASFLEIPAT
FT                   RKHLLRELLSQCTPGMGTMNPFYMCLCAVLQSCFDNETDGALETVALINCHMPHAAYFM
FT                   STLAVDSHMSVPMFAKVMISLARGAGMAMTGRDTPDEVAASINENRTSVYNVLFLLREV
FT                   VRSCSTTASRRATDMLKALRVAVAPKTIEALGKLSSEAFEAVSDITLDPQLLCAELAMV
FT                   LHQDHIAEAMDSAVEYFRDVRSKCPYCAAARSSSLLCPVNGTVHVAGQSSVSRVLSTLS
FT                   ECAGAKAVEEKLISYLRDPALQMESAVHYLIYHIVANGGQHRNTLFVAVEPYVRSTLLA
FT                   LVSADRSGVRGLVDSTLKANVLMLHVKLVTLLASSIDPSYLESILKVFSELRLRNNHDA
FT                   LALWYMGNVLLRSCRGNLELLPTDPQENNYCVAFPGCAPASATTADNAQLVLKLLHRAH
FT                   SFSPEMHKLVGCCVCKLIQDFNMQAPNICSTLLSPFGFFPVGLESLNAFALPAGAGSTF
FT                   WSFFLQQMRSSAPARTAFMATLAKSLSRRFRIASPMDALAPYGVEPTGHLFVIMVYEAM
FT                   KRNPPLARVLLYMVSHWMKQAGHPPGKLACLVYVCVQLITVVVDRAEGPAAAEVEAETP
FT                   QDRQQFDDAVKKAARVLKSQQARLDRLAPTARRENVEFFHLLRRLQRRVRRTVATASGE
FT                   IVVGDEAAEEYDDHDDAVDDSSAGGHVRQDSITDAVCAMQELQNAADNSVFDDYADDVD
FT                   QEDDGAYGNDEGACDAASPGLRRSAQTEGSGHRAEGPPAPMQIRHLPQGITSILRSPAQ
FT                   RSPNKSDRGAAGVEKGSTTSVNMYREANRRTDVEGVPHGADGDDAEMRSRDGEAAHSCA
FT                   LGVEPRTRSTSRGVQTDVPLASPALPGNAPQRSVGTSPIQPAGTSSQISVTRRDGTQLP
FT                   CRTPADVGSAHTPSSSLYQPQRSHTRPPEADGMLSEGTRTPAQRGSTWREPDLADYVDG
FT                   DTTPIDDFTGVPRLQATTTSDGIVLPSGMVLEYLRTHQGMDSLQHELKQFDQQWMVQQV
FT                   AEYVSQNGGMVGAAGPSSTIRGGVSSVQSVTVEGRANNYSRPHADPTELAPTRTVCTEV
FT                   HMIGPATSYSRPPRQEEHGRVVAAAPGLPEEEEVNVVDGEHPIRAVSGPPDDSDLAGRA
FT                   GDDEATKRRRVEATGGNATTPLPPPVSPVSAFRGRNFFLNQHTQQEVGSTLQDIHYLQR
FT                   RQQANMSALAKAQSAAETAESAGDDEAPRKTPHQGQSSTGVAGEGVPPTTPYGQVILPT
FT                   WIVEQRNDTAIRELRQVMGAHNPNDSRLSTSAGKRSRIRGSGTGDGSGNSAAWWAEMSS
FT                   APMPNYAADPQYSMELF"
FT   CDS_pept        complement(744067..745311)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1905"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1905"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26037"
FT                   /db_xref="GeneDB:LMXM.36.1905"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW3"
FT                   /protein_id="CBZ26037.1"
FT                   /translation="MKRRDVSVPPHRSYTASTGASPTTMSSASPPAISTVCVDVRELLR
FT                   HTAAASKDAPSGAQAAVSGRQQYIAVSPSAAPSQPPRQPQATPPPCHKASTFWAPSYPP
FT                   WGGFAVNSRPPPLSPTDATILHSILGQPAVQKTVVSGFDQVIGRKSSPLTREPQTRRPS
FT                   VASTSPPPIDSSFTSGTSAYADDGVQAFKVGAATPLSSLSEKDMSPPTPLRDVMENYLD
FT                   EEGSNSAGAAVSMDFSPAAQRTMKSILGQLNSCASGLAAAHTRAVTEMPTSSYPGGVAV
FT                   WPVAFRQAAMRASAAGPSAASPLPFSGASGHRRKGGAAATRPTVAQLWRQCPALAASTF
FT                   SRVDTSPQRFQHTVKGVVAPPQGLAYDRPHVAAHRSTVLLRKAVQSPPRTVPPAFRRQL
FT                   QFAEEAPTTRRPKRR"
FT   CDS_pept        complement(746318..747697)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1910"
FT                   /product="putative T-lymphocyte triggering factor"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1910"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26038"
FT                   /db_xref="GOA:E9ASW4"
FT                   /db_xref="GeneDB:LMXM.36.1910"
FT                   /db_xref="InterPro:IPR025593"
FT                   /db_xref="InterPro:IPR039308"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW4"
FT                   /protein_id="CBZ26038.1"
FT                   /translation="MPPKAAAAAAGSRQREKGKKGGAAPVDPIKELRNMEDIHEVLAKA
FT                   QQLRNYFQAERDKVNGMWDITKKDLENEQFGLQNAESELEELEREHQVEMKVYQQKVRH
FT                   LLYDQKIAVKQLREESDAALRQAEAAHTQRMHQLEVERQQRMTGMQSAREAQESRIVDQ
FT                   RDGHQYMLTVTKRRNHEKELARLQASYEAKLSTLREDLELRRRAEVQDAEERYHLHINH
FT                   LIQQHEDKFNEMKTYYNHITHNNLEIIHSLKDEIATMKKNDEHNEGLMFEIEKENENLV
FT                   APLEQLEKEVAELQVKKQQHILDKQSLRSFRTRYKLLQQQLCALRQEKEMLEGQYKNVY
FT                   DEREDLRAKFEFALREAMDVVADRNNSLQQNLIEAHARLEQRDAQLEGVLRAMGLEPAA
FT                   MELISNEIDAEVQKKNQVIKDLHFEMRRLEKKVNAMVEEYERRCRAVGVPPLDRASVMQ
FT                   V"
FT   CDS_pept        complement(748776..750266)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1920"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26039"
FT                   /db_xref="GeneDB:LMXM.36.1920"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW5"
FT                   /protein_id="CBZ26039.1"
FT                   /translation="MQPTSVGYGAFDSLAQLRDDLRKSYDAAKEIEERDTTLTKSETAN
FT                   ALKETSDLFALGMEKLFSPEGSIVEVKSAIARAEDAEREVAALRAEKARLQSTEDGHRS
FT                   KLSATSSDAEVEAFVAYAKELSELHDHLSLARTVFKAVLTKKLEDIRDDRLSRQDKRFT
FT                   DPKSWDVKKGVLERMLQSLRTKTTQLQLSAKTYLDEDEALFLEVMNLATEAGDHIRRGD
FT                   AMREARDEKLKVFYAECAKLTVWCRQQLTNLEAMQAPDHVQEYCATLADNYPTMSNNFA
FT                   VLFNSVQEYVQANLIPVQKALLEAEEVWLYLQVSTLERLSKTLFEIHPKSPLDVEVEKY
FT                   SSYPEHAAKFLQDLERYLAAQRSQQDEVVELDSAHKECQAVLHTLSGEFAELPSEVHAF
FT                   AQRAKSLRLGYQCFREALLQRLTYVSPAASTVVESKRRQEEFEDCVRELKSWATEASHG
FT                   ESWRDIYSKIVEIKQMIKSEQASLEGKRERAMVSGQSR"
FT   CDS_pept        complement(751730..752008)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1925"
FT                   /product="60S ribosomal protein L37a"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1925"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26040"
FT                   /db_xref="GOA:E9ASW6"
FT                   /db_xref="GeneDB:LMXM.36.1925"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW6"
FT                   /protein_id="CBZ26040.1"
FT                   /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGKF
FT                   AFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
FT   CDS_pept        complement(754491..755390)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1930"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26041"
FT                   /db_xref="GOA:E9ASW7"
FT                   /db_xref="GeneDB:LMXM.36.1930"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW7"
FT                   /protein_id="CBZ26041.1"
FT                   /translation="MTSTSAPAVDFSCAICFDTATEPVVTRCGHLFCWECLDHWLHSAA
FT                   GAPECPVCKGRADERMAGDIIPLYGKGRQPATKEGSGQSTVSASATTTAAATTATESAA
FT                   TVSDPAQEAFFSRPSAYSFAPARDTRRAAPASSQEQQPEQQHHPRPNADRAPPRPRQQQ
FT                   RHQFQNVHINRGGMPLTMGSGIFFFGGGTGVLFSILVVAIWTLYHYAPWREWVQVLGRW
FT                   YNRLRGYPEPANTSQEEHEAATDRSTRARTPPAAAHPASAASSMEDPNNDVSPPTVVRH
FT                   LILSLFLVFILIQLLAYV"
FT   CDS_pept        complement(759425..760924)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1940"
FT                   /product="putative nucleoside transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1940"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26042"
FT                   /db_xref="GOA:E9ASW8"
FT                   /db_xref="GeneDB:LMXM.36.1940"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW8"
FT                   /protein_id="CBZ26042.1"
FT                   /translation="MTGQSAAVEGGKSGLPWYRFGFHTLAEFNTFVTFVLLGMSIMMVT
FT                   SAVTSAPDFVTKYFIFATGDPDAAAETPLFWTHANTFYNAGTYAMQVVTEIVSLTPFMR
FT                   SIPLGIRLFLGLGIPFVELVIIIAVPAATIPTQNGAIAVIMMVAVMGGFSKALCDSCTN
FT                   ALVGPFPTKFMNGAQWGLTVVALFMSIIQIILQVSMGSTFQDVLTISRIYFGIGIGIQM
FT                   MAIVALFFLRYNPFALKYIAEFRAAALRRGGHVEMEESQDSKEPATGDVAETHKTGDKE
FT                   VTLDEMEETDEVRAVNAEVLAAKSGAVLQATGDADRMVDLDQTKNITSTEQMLRASVWS
FT                   VFKRIYPMLLCAFTIFFMTLLLFPGVFFLVPARSGWYMTIIVLLFNAGDFVARVLLMIR
FT                   VLRPSPKAVIGGTFGRLAVVPLLVLCVRGIIPGVALPYILIFVFGLTNGYFGTMSCIHC
FT                   PRTPTLHYAGERSVAAMLSGIALMLGLCFGSNMSLAITLTY"
FT   CDS_pept        complement(761975..765019)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1950"
FT                   /product="putative mismatch repair protein MSH8"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1950"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26043"
FT                   /db_xref="GOA:E9ASW9"
FT                   /db_xref="GeneDB:LMXM.36.1950"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASW9"
FT                   /protein_id="CBZ26043.1"
FT                   /translation="MVFVDSQVDVNSVSFTYPFLEGIDPTAPPSTISIPHKYLDAMANM
FT                   ERQYWDIKSKHYNVVVFFKKGKFYELYDYDAVIANREFGLKMVLDTSNRGKMRLAGVPE
FT                   QSYNEWARLFVFRGYKVGRVEQMKESESEVQTAKMKVVPRELVEVLTPGTLKDPSMLSD
FT                   HREVFVLSLAPVFRDGELVIDAFAVDLSRRVAYRCPCGSRKREAKTGCDTISSSLSIKR
FT                   ENGVYGSLKNSTLRALSALLQQLSPKEVIISSSDWVSNDAERRQTFKHTCDEITKWTES
FT                   EGFSVEHISSRALPSLSMTTMVTAEQVMTSYFTFLCLASDIAIFSTATEYTTHLSGVIG
FT                   TDSETAASDATLDGAASGKSSIMDYEHRFDKGLVLDATTVSNLEVLTNLHDGSEKHSLN
FT                   ECLNRCSTNGGRRLFRSWLLRPSASSRVIAARQDAVQFLTRYNLLHSLTDMEVSEQVGE
FT                   KRSRSSEGLSLFSSVVSVDFERFLSRLSDIRQNDSQKIAYVDPMVQYKKNLGIILSSVR
FT                   ALSAMVGWGKQFFARCREVACEQGTGIPALLGELLEEVTAAEASNKRIEGLFDRQAAEE
FT                   SGLLIPSPGTSSVFDAATTKLRHVESKLHDVRRQLQQDVFRGAQAHFTDLGKDLFLIEV
FT                   AVADAPKMTPAGMVERARSAKSVKYVVSSIEALVESHKEATAMKAGALLTVLCSVSSRI
FT                   CDEFPRLFSASRALSYIDCLLSLAQLHHAFPTVCYPRLCTAHERDVAVVRGWDMIHPLL
FT                   TGKNPVANNVSLDDAEGRVLLLTGPNMAGKSTLMRTVALNVLLAQLGGPVLATRMELSP
FT                   VDRVFTRIGARDASHKGQSTLYVELSETADILHSASARSLCLVDELGRGTSTHDGMAIA
FT                   YATLHALTTAKPAAPLTIFSTHYHALAMEQARTATPTPTGAHTRVVQLGYMDFVLKSET
FT                   ATAFADEDANDTSRSCAPASCVSNLVFLYRLVRGICARSYGVEVAVMAGIPHTLVQLAK
FT                   AKSEALSRETAFHEDVRGIEKFIRA"
FT   CDS_pept        complement(766597..767706)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1955"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1955"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26044"
FT                   /db_xref="GOA:E9ASX0"
FT                   /db_xref="GeneDB:LMXM.36.1955"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX0"
FT                   /protein_id="CBZ26044.1"
FT                   /translation="MQSMGSYQVIYIYIYIYICTYMYICMLIYAFLLLEQLLLRLFLHA
FT                   GILSMGQSFNTPPPSSDGNECDDCSAKEEGKIYHRPPDLPSPEIVGVDDADKRILALTP
FT                   KLAVRLADALPPSCRCGDFSGATRWYLLYSSFLHGKSFQRLVQHITSRGPTIIVIKVKD
FT                   SPRVLGAFCESDWLTVAQREKNAKSAAAASARATREGQKQRVTTAPQNQSNAFFGSLNC
FT                   FVFRAHADSTDDVSAEGEIYHSHSSMNSNFMYLFDTHPLEEKIGIGMGGQPGYYGWFID
FT                   RWLENGASHGARCTTFQNPRLSSTETWAVESVEVYAVKKDIVEQLLRTGSDRTSGVSCV
FT                   NDNPDSKADQMLLELNGTHEFNRRDRTKC"
FT   CDS_pept        768785..769528
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1960"
FT                   /product="putative phosphomannomutase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1960"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26045"
FT                   /db_xref="GOA:E9ASX1"
FT                   /db_xref="GeneDB:LMXM.36.1960"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX1"
FT                   /protein_id="CBZ26045.1"
FT                   /translation="MGSKAILLFDVDGTLTPPRNPETHDMKEALLKARAAGFKLGVVGG
FT                   SDFAKQKEQLGESILEDFDYVFSENGLLAYKDGKEFHRNSLLRALGNEKVVAFVKKCLH
FT                   LIADLDIPVQRGTFVEFRNGMFNVSPIGRNCSQQERDEFENLDKERHIREKLIRELKEA
FT                   FPDYQLAYSVGGQISFDVFPKGWDKTYCLQFVENDFETIHFFGDKTSEGGNDYEIFTDS
FT                   RTIGHSVKTYKDTIAILEALLEDSR"
FT   CDS_pept        770142..771035
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1970"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26046"
FT                   /db_xref="GOA:E9ASX2"
FT                   /db_xref="GeneDB:LMXM.36.1970"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR032857"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX2"
FT                   /protein_id="CBZ26046.1"
FT                   /translation="MDEHSSACSCAGIRFCAKCCDSSRVQQLFSGSVPLSSASSVIEKQ
FT                   HHEERLSSCSFATIGKSSLSFCIECMSVFKSEVPIKSCADHHGAMATSITISGLAVFQD
FT                   ALPEEDETAVIRFLDDSHPFPPWKESQSGRRKQDYGPRRNFKKKKVKVADIPAMPLVFE
FT                   PIFSVISSMTETFTGKAYRIAEVSALEYMEGKMSNFDPHVDDTWLWGDRIAGLNLNEAC
FT                   AVTFVNSEGVCCDVYLPRRTFFLMSGDCRYKWMHGIRPEHVRGRRISLTFRELSDEILA
FT                   DTEASEMVLSAASNFV"
FT   CDS_pept        771421..772644
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1980"
FT                   /product="putative serine/threonine protein phosphatase 2B
FT                   catalytic subunit A2"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1980"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26047"
FT                   /db_xref="GOA:E9ASX3"
FT                   /db_xref="GeneDB:LMXM.36.1980"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX3"
FT                   /protein_id="CBZ26047.1"
FT                   /translation="MSQPNMKCSAVGGRNLNGTPVERNTLLRDDKLSLESIMLQFLCGE
FT                   QLRLEYAIEIVQQAALVLRTEPNALSINDAVVVVGDVQGQYYDLVKILAACGSLSTTTY
FT                   LFLGNYIGNGGFNLECILFLLAAKVAHPQSIFLIRGSNESKFMADILELGKECQLKYSS
FT                   TLLPQILSAFNCLPLAAIIRKKFFCVHSGLSPDVSHVDDIGLIHRFRHIPTRGAMCDMV
FT                   WSEPDWDTNNQLYNNVEEPSGETYVPRLGSFETRPLFITNKQRGLSYVFNFACAKRFVS
FT                   ANNLLCIIRAHEVHELGFKLYRPHPNHLFPCIISLFSAPNYCSSFGNKGAVLVVSKETI
FT                   CFKQFEPSPHPCVLQGRNAFSWSLPFLESNLMSIFLTLLSGSDFDPTVADRSEKGSSNG
FT                   EGGATPLI"
FT   CDS_pept        773236..773535
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_1990"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_1990"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26048"
FT                   /db_xref="GeneDB:LMXM.36.1990"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX4"
FT                   /protein_id="CBZ26048.1"
FT                   /translation="MTESAEALQRRINHAIENQMVPPETNYISELLAASLALDNSNEQL
FT                   RLLDYRWQTYLDKQYVQSQRLDEFLEGLVQHLLKKKPDRPLEELLLYLESERRQ"
FT   CDS_pept        777874..781713
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2000"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26049"
FT                   /db_xref="GeneDB:LMXM.36.2000"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX5"
FT                   /protein_id="CBZ26049.1"
FT                   /translation="MSDTSLDFLLSEILSPDNGQRAAAEKELERRGLEVPGFCFSLARY
FT                   CRTLMSDQPSHAIALVALSVLKRSVTASDRAEELEQVVSSLLSNLTNIAALPGGAAAAM
FT                   RQWSSTVCTTVRRLAVLCASPTAAPAVGEATTDAITAQLLGAFGQYPNADASGLLSVFS
FT                   HVWLLRTMFEEPVPEVMHAWCAELLLNCAPPLFEILCAGAAATLSMASSDSSAFAADSP
FT                   EVYAHCSLLTLIAQTLAALYEWQFVSSGRKRFPAELKRHFLSAYPLLQSFMCTPCVRWL
FT                   SMCAGVDSSSTSALPFVQARAANFAAASLAALEYVSSVLQLGGWYKQCVSAQLFQALLQ
FT                   SLEADASCYGVALCVDGEEEAEGLTASAGWTRWPHTESGGGERGDGASSHSWPTVVRRR
FT                   ATQCWSLFRDAALLPFLKVGLVDVVGHQCGLQYYKLLLAYAVPSPVDVGAWLHDPNTFL
FT                   REEEEREDGVRWTTRNTVAQLYADSIAALGPLFLHASLEDLHERLLAPIPESDCRTCGD
FT                   GQTFLAYDGTVMLTASQQQREAALFFMEMVLKHRARQLRECGAVDFTPLATHLWNNDVA
FT                   SASAHPGLTARALMLITAIVQFTHAALAATAPAAFIDAAAATNTDAASEDFMATVVAYS
FT                   THALSLFTGTSKETIAGPSSSCTPLVAVLLCRVLQSTLPYWSDVLLAQHSVAWQVSLLA
FT                   LLSSEAGLTDDALYNTVEQLADLLKVARAVRKKGTQFHHSRVSTAAAAPLMLDALPRTV
FT                   MSCWRRHLSDPDLADAVLGLLRHVVRDGESGASLLLLELPWVKSVLSGYAESAAELCAV
FT                   PYFLRLLKYLFEHAPDEVANCAAAMMLDSLCQLLLCTEESAILGASSSCLAVLLRRCLA
FT                   VQSVQVRVVAATMEAAMAGGAAADEGGLSGAVNATARVADAPRTVYPFATVIVAFVLRT
FT                   LDCRRDEVSLMDVGDALVRIMQKYTSFSEAELIRIIHATVRRLSVVRTDTVAQQLLAPL
FT                   ATLMALHPAALLRTLAQGGFLVETMSRWLPQVEHFSYLRFTYVSCAGLLKMLSCLSHPS
FT                   SSPMLTAEEAQQLAQQPVTCRWLLPAELTESKNGSRKASRKDSEGGSAAATRRVILSSL
FT                   TSGASVETSLPLYAGVLVGVGRGLLTLLAAPLAALCRASQAAGDTATPGTGIGARGFPS
FT                   DEDDDDINGLFREDSVDGSDHEAEDTGEEDVDSFSDDETRGDAGQSKAPDINAYSPETT
FT                   DRQRLLRQMGVQMLPWMQTHGGEVESFFTRQEAQTLTSFFTSCAASGGCGPSAA"
FT   CDS_pept        782795..783907
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26050"
FT                   /db_xref="GeneDB:LMXM.36.2010"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX6"
FT                   /protein_id="CBZ26050.1"
FT                   /translation="MRLHAGNRSHVIRPGARTGAHDGVTASACAEVHLAAASPLSSAPF
FT                   QPAHGSDRQGLVRGRTVPAVVDAPHDSRSRLSLEIEGVQMGEEVVVDVTPVRQRSGTSS
FT                   ISNGSNDAAQLQKLRRQLEKVTADLKAAANTNRRQKQEHQQQRAEWLVFSNESDARLFN
FT                   LQSNQASREQLLCSELGDAIAHLLAEFKAQALKERAADQAHASDKAEWDAKHAALLSEL
FT                   EAAKAALATQFTAANSADTHKEVADQLRAELEALRRSAEDQQRSLEEKLMHTQSTLQVN
FT                   QSELNRYLQERDQHNYLVGQCRLFIQQVCQPGFSVVKGLSLEPVETQRPEPTGFVLVPL
FT                   AVLLHGYALLPEGDRKALIEHYDGKAKSLK"
FT   CDS_pept        784512..786212
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2020"
FT                   /product="chaperonin HSP60, mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26051"
FT                   /db_xref="GOA:E9ASX7"
FT                   /db_xref="GeneDB:LMXM.36.2020"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX7"
FT                   /protein_id="CBZ26051.1"
FT                   /translation="MLRSAVRLAGKDVRFGEEARRSMQKGVTRAVAAVATTLGPKGRNV
FT                   IIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNQTNDLAGDGTTTSAVLVD
FT                   SIFGEGLKCIAQGTNPIDMKRGMDRAVEVILKSVAKQSRPIKGSEDIVQVATISANGDE
FT                   EIGKMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMKIERGFLSPYFVTDAKAQKAEL
FT                   EDLYVLVSKKKISTIQTLLPALNHVAQQGRPLLIIADDVESEALTTLIFNKLQGKLKVC
FT                   CVKAPGFGDTKEGMLEDIAVFTGAKVVGDENTGVELDARNFDPSILGSAKKVTVAKDDT
FT                   VMLNGGGDAAAVQECQQLLRDRIEQEAVEYNREKLQERLAKLSGGVAVIKVGGGSEVEV
FT                   NEKKDRVVDAVCSTRAAVQEGIVAGGGTALLRASKELEALANDSSLTRDQRTGVTIVRN
FT                   AIRLPAMKIAANAGKEGAVIVEKVLEASEEGMGYDAQNDKYVNMFEAGIIDPTRVVRVA
FT                   ISDATSVASLMMTAEAAIVEAPLESEKDKNGKRPAAAEAEDDEELFGSY"
FT   CDS_pept        788692..790389
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2030"
FT                   /product="chaperonin HSP60, mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26052"
FT                   /db_xref="GOA:E9ASX8"
FT                   /db_xref="GeneDB:LMXM.36.2030"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX8"
FT                   /protein_id="CBZ26052.1"
FT                   /translation="MLRSAVRLAGKDVRFSDKARRSMQKGVTRAVAAVATTLGPKGRNV
FT                   IIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNKTNDLAGDGTTTSAVLVD
FT                   SIFGEGLKCIAQGTNPIDMKRGMDRAVEVILKSVAKQSRPIKGSEDIVQVATISANGDE
FT                   EIGKMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMSVDRGYVSPYFVTDAKAQKAEL
FT                   EDALVLMSAKKIQSIHSLLPALNHVVRSGRPLLIIADDVESEALTTLIFNKLQGKLKVC
FT                   CVKAPGFGDNKTAMLQDMSVFTGAQLVGDEGTGLELDGENFDPSILGSVKKVTVTKDDT
FT                   VMLNGGGDAAAVKERVELLRELIKNETSDYNRDKLKERLAKLSGGVAVIKVGGGSEVEV
FT                   NEKKDRIEDALCSTRAAVQEGIVAGGGTALLRASKELEALANDSSLTRDQRTGVTIVRN
FT                   AIRLPAMKIAANAGKEGAVIVEKVLEASEEGMGYDAQNDKYVNMFEAGIIDPTRVVRVA
FT                   ISDATSVASLMMTAEAAIVELPKDDPAGAPMGDMGGMGGMGGMGGMGF"
FT   CDS_pept        794503..796560
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2035"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26053"
FT                   /db_xref="GOA:E9ASX9"
FT                   /db_xref="GeneDB:LMXM.36.2035"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASX9"
FT                   /protein_id="CBZ26053.1"
FT                   /translation="MRNPADIGTAVASQSPTDVLRPPTSVETMMSLTVPDASSRPSTSS
FT                   WLPTRLTSSYCVLSAAGLQEDFYTSCLSWGTNQMALALQEDLVLFHPSHPRQASSTARI
FT                   STPPASEEAGRNIGTGPSAALSGPRRATAVAMTRFQETSCFLGMSNGAVELYEGRGDGT
FT                   LQRTIAFAMPPPPTGYLSSLVLGSDDCDGAASPTSSTSRAARALCLLSSSVSSISCVGT
FT                   SSRHPWLGSAATAACGLITLDARQVQPAIRFGTDAELSLDEGAPRSSSVNASVSSAVSG
FT                   RLSKLQRAASFLRKHDRLCSVSWNATGSLVATGSGSGIVKVWSLSAPQRPLHTFLVDQD
FT                   CSVKALCFHPGSPYALLVGASAGAAGLRTYDLSGAEPVLSFTGATAAPVTQALYDPEGN
FT                   YAVTGAGVSLSPVSSSLSPPPYPALAAHAELGAAGGGGGSGFHEHSTGWHRSSSTRPSA
FT                   TGSSSAIGASGGGTLLHDSWDEMEMPTSPLSATLDTAAGFAGAFTSESSSSSAAAHSAP
FT                   PNALVVWRCGTRRRENYLREALLQRSDRRRDSTAGRDDFARHSDGASDDDSDDATQVDC
FT                   PARGGLRDSTVAADDSHSSDIGYPRSEWMPMYALPGHRARPLLICAPFSQSPFAGCYAS
FT                   IAGGEDGTIRFWRFFEATSDATHWQHRRQAQQQSATTQEDMDLLATPVLR"
FT   CDS_pept        798776..800119
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2040"
FT                   /product="putative alpha-1,3-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26054"
FT                   /db_xref="GOA:E9ASY0"
FT                   /db_xref="GeneDB:LMXM.36.2040"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY0"
FT                   /protein_id="CBZ26054.1"
FT                   /translation="MKFMYVALAAEAVVIITVILTVPYTEIDWKAYMEEVEGFLAGELN
FT                   YRNLKGGTGPLVYPGGFVWVYSVLYYLTKKGEAIELAQWIYAGVYLVTLTMILRLYTRS
FT                   GHTWRTMIPLFVSKRIRSLYVLRLFNDCWAMLFLFAAVSFIAGRPGGAAKRSRQWFIGC
FT                   LCYSIAVSIKMNVLLFAPGMLYVMLRTLPFWRVAWYLLVCATWQLAAGLPFLAYDHRAY
FT                   LSKSFELDRVFLQRWSVNYQFLDAELFVKPEFGQALLAMTVATWVLLWRTRWAARTYLT
FT                   DAEAHVLHPVISDTCRQTTLLRRGTGEGDETMDDEAQEQAVYASTLLTFFEANLVGVIF
FT                   ARSIHYQFYTWFFYTVPFVLAYTTLPRVLRLVSFALIRQGFESFPPTPKRSMMLQGGFV
FT                   LTLFALLFLGRDARPAASRDEAHPTRDNEPKLPQTQVEDGAAGGKRIR"
FT   CDS_pept        803093..805834
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2050"
FT                   /product="putative serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26055"
FT                   /db_xref="GOA:E9ASY1"
FT                   /db_xref="GeneDB:LMXM.36.2050"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY1"
FT                   /protein_id="CBZ26055.1"
FT                   /translation="MPSFFLFGKKKDKKKKTHDDTRDGGDAATPSLTAREGSTDSKGSA
FT                   TKQVKGSTTSHNAASRSMPPGLDTLPANASGPATETSPPLPPSRKQQSYSESALQELPP
FT                   PPLSSPPVTNSLGLSGSAVHLTLHHSTLDDVAVSTPRSVDLFPRKMSEVTIPQLTEVFQ
FT                   VFRMFLDNCASTEVKQESVSQLRKILPEIAAVDTTVSAETIQAQNFHPTFAIEPVLRHL
FT                   LAQPAPLRARLCLAIYRFCGELCEELEGDVFCQETGFFSDLQCMNPNLRPAADGDYDSS
FT                   EDPHQTSPCGGNFAENRAAKIERCPDIDLPKIYNSLLHKEDYLPTAEELNEIFLRVQEL
FT                   LRAEPNVAMVMMPAVLVGDLHGQIRDLLENVLTLGGPLVSNEALALASSKSHAATSKAP
FT                   SSQKRGSVSAAPPTSKKSSKAAGAAKTFSGAPKGDENRPTQPPRYLFLGDYVDRGPSSL
FT                   CVIALLFTAKLLSPNTVFLLRGNHECPNTNRFYGFLDECHRRYPIVDNKVTTLHMGTQL
FT                   SSEENPDDATANRICSGSSSPGVSSTCKGDSDDSNAINTNSSVEPTAAEGGGHLGKEGD
FT                   TSPDDMGWDMKDHPLWLVANDALCSLPLCAALYEEVEEEDEAPLPQATAAAASNTEDML
FT                   AADGAENPGAASKVKKPITAKAAKKSGRRSIGNASSAESSKSPNRAAGKSPTLTDGNAR
FT                   PTSSKTASTSSELSPLFPPSANASFAKPKKTRQIVRVCAMHGGLSPFIDDSFDGIIAIN
FT                   RFRNIAHGALADLTWSDPSSSAAAQGATASNSRANASQPPLRKFQSACTFDGAPIGFTG
FT                   NPRGTGHIFGEDATISFINTNHLYFIVRAHQCVQEGFQWNHKNRLLTVFSAPNYCGMRN
FT                   KGAVLLLDKNGAPTLKQYEHKEVEEKPHAMATGAPQPPRLFS"
FT   CDS_pept        806869..808389
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26056"
FT                   /db_xref="GeneDB:LMXM.36.2060"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY2"
FT                   /protein_id="CBZ26056.1"
FT                   /translation="MLGAQSAPSFLPASASRSSAPQCTQPQQLIERRPHDTLVQHSPYG
FT                   PSRNTIYGWGNLFQPPMTATVPGHPCIHIGISSLNGVPTVGQSDRSMRSLLTQYRKKFN
FT                   CLEHCYPYHKVGDPGTWRMWADMVRNSNVTDGGRAHSLKTASVLPPHTVEGAAAAGVSS
FT                   AGATPLRPLTVNANRFLYTIKANNFLTHVKQLQMDDADVLAHVQVFFQELCPLLEPFLG
FT                   PVLVQLPPSFGYSAANVQRLTRLYQLFSQEEVLLLETTSVPPKAFSSSGTPSTPAPCSS
FT                   APRRQRRLRVAVEFRSRSWYRDETFGLLRSFRWALVVAHHHDDPTYSQVVDTGAGFLYV
FT                   RLHGPLGRNVGDYGPLAMRLWAEKMVQYLHSERSSADGGATSAVPDDATREVFIFLNNS
FT                   DSNVGGTTSSAVDATCLAEQMQNLLQCTSSRPPPAKTAAASPPPRVSAEPQPVLGCVEA
FT                   GTPNALPEDDRRASFAQHVQGETDTPPLKRQRTTSRGSGTREDEVVID"
FT   CDS_pept        809786..810778
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26057"
FT                   /db_xref="GeneDB:LMXM.36.2070"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY3"
FT                   /protein_id="CBZ26057.1"
FT                   /translation="MTEKSAKEPSLPQDLKAQFDLLAGTRWDGVGDDADAAEHLSQLRH
FT                   DWKALGNACYGKGCFLAAIRCYSRLLEVPGGDTAQIRSNRSAAYLQSPMLVGPSLALKD
FT                   AEKAVELEPQWFKAHLRVGDAHWKRGHFAEAEAAYREALALQPECAAALAGLRALQVGP
FT                   AGFPAAAATFPRGHTERTPYHNASPSLRPLSSSTTNHTAAAAQAKEEELQLTPEQLIHK
FT                   WKADISTREGRTGCRPRRVSLSQADRQQGAAVKQALLDRFRAKLESNGEFSATLRDRCE
FT                   EAMLHGDGVNYRDAERLRITYSHATNGIGLGISSDAYKEYRGRVDHRTW"
FT   CDS_pept        814224..818120
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2080"
FT                   /product="streptococcal hemagglutinin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26058"
FT                   /db_xref="GeneDB:LMXM.36.2080"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY4"
FT                   /protein_id="CBZ26058.1"
FT                   /translation="MRITAATATVPVGARGAKMRKRKAKTIRAVAAAGALWRPQSQLIF
FT                   TSNATSVTATSNGELGTSTTAGAISTNGSINGYTVTSSALAIKAAGTGGGGSCGVASVL
FT                   PMPTAPSSGSAQVPPLSSSSRAAPENQILANETLGAVRRSGAEGFPPSWENGVVSCTMR
FT                   GAEKARRLADVATTNGLSIDDSSTFTPAEGPLWVAGCAPLDASKAADTGVGASAASFEG
FT                   VMDNSPFVSSSSLASSDTGCAQPATASHADQRSSATHRRDNGALAERPQLLLSLAQDNR
FT                   GFLNPGYSCDSSGWSSEDSGASGERAGSDGSAGERRCQGTPSAASFSRAAPSEERGKEG
FT                   GGAPPPMFTTPLNSGRNRTNLAVFPLTAAEEQSARQVYDTYREQQAKTGYRRSHTSATK
FT                   HLSHRSASVPPSALSPSTSVGKRELLRLLHGLYHRARATMTCSAAKTAAPTSAPSQRKA
FT                   VPSTMTVSAADVLHEFPSTKYLLNAAEACFGSRRFRTLIAAVEAGSNALVPIVVRNNDG
FT                   GAPAVATASRSRLSSSPSQGLTVEETLSFFRHLKCELASDVAKQRKRGPAEPSAKPEAA
FT                   LGDKGRNRPATGAPSQRLLDLQGSQKTRSISAPSFQAASQVCRLPSARAGRRSGRPPPT
FT                   PMARMAPRPATPASPPPSSPSPSSPSPSYPSPSYPSPSRPGIPGVMGLLGPRKPSGRRK
FT                   GPRRKTALPPPSPHPFNSNSCTPDATYRGDFIHTYVQRKAFAEIAEGQGCHDDATVALG
FT                   QLVKALQWFELALNPSVIERMCGLQVQPARESQDISIDFSTFVKIINSGLRCQRYSGGS
FT                   GSSSAPASASADNDDNPQSNAFVLVLPPEAPARASPVAPPISGLTAADGALLSTGSGGV
FT                   PCAKAAASITSVRDSEGSNQSLLVPAPASAAVHCRLSSLSSMSTSTASSPASGGSMHRS
FT                   FLDTDDAYPLVSHDSAMAALCRSIRQRLRRELRRSVSSGPNALLRPRDNQGSGNGGGDG
FT                   AAQKEGNDPRYSPSSRTVLAFSRSWRSLSLASSVASPMPRGSVRAAGLVGESECAPARR
FT                   DGEEFLVSPHLSKWLTDTKCSNPLLPQRLCEQPSPSPSPLVGHALPPPSHPYTLTPTPR
FT                   APPAEPAEGGEGPIASQWFPTAQPWRGHGHRLAAPPPAGPATAQRPSLSTAVARRCRRH
FT                   QGSMHLITSLSPYSNSVHGTRRSASHCWSRIATLSTLSRSRRSSLLHSYDSQPALYSLQ
FT                   LSEPELSAAFLSQSLPAQTTSRRPKWNRPASAYTRLTAAPTHDACIARVSHPPLSPAIR
FT                   SSPLPYRRRLFQAG"
FT   CDS_pept        822080..824944
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26059"
FT                   /db_xref="GOA:E9ASY5"
FT                   /db_xref="GeneDB:LMXM.36.2090"
FT                   /db_xref="InterPro:IPR024224"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY5"
FT                   /protein_id="CBZ26059.1"
FT                   /translation="MNSPLSLSSPWVDCLVSIRFDLDIGPKIEFVSPPDAITEEGKVKL
FT                   LRCAFPDCNPDCGYNFIFYFTMPDCTTAAAQSFSQTVAPPTTGNTVPELYGAAFYRQKY
FT                   DPNVPRCYVQQVLVLLSHLPYYNVHEIILRVVAPRFCQCCLLSPDTGKVPVSSLLIPIP
FT                   EAYFEFDPSYSAEHYTQEDVLRDAMVELAQWPSPHPQARYTVTLLQQALVFITPAHSQR
FT                   QSSRATRSSCASVRSAMSVDKRVEFMEMAGGCPRHRGSALGSDFLPLFRLLGEQLHHLT
FT                   HVWELLIRHEPLLILSNTPYMASAAAFSIASLVLPIEFSGTLRSYFTVQNEDFPRLSRM
FT                   GKVLSFPTNEGLIVAGTNPFLLRSFNGWPSLMAVMDGNTSMTVNGSIAPPPPSAGAGAI
FT                   SPSPQASPFHSKRSGACTTASLTTSLPPAALPGELSAETPPRPPLNGAHARTASGQEPL
FT                   SGAMCRISSTTSLGSGSTSAHHHNGPRVPVTVVVPSRLSSFNGNRDLLVDVASRKPILS
FT                   SASSDTADLPAIYNVESSTDTSPFTSIPSRDSARRVEAAQQTQRFDDGSSAGEHASMNA
FT                   RGASPVQPSIGFSSHAERLSHGREHARLDSSDAALEAAAHLASAPIRMPSPVDFSATLF
FT                   TTDHYKTTVESVRAAEHRRRGGANPDSSRKNLQQRLHNYFDSSVHFLLNHEEQTQMLLQ
FT                   RLQMVSLLDADSQRTSVSLSLTHWHGNPRTASSPTNSANGLPVASSTPPLSSANTSSAS
FT                   GHRVEPAAVTNGITSCSHFSVADDMVRKFFTSLTSEFLTPVTAWFQRVTTPYTAFHLCD
FT                   RALCDTLLTPSSFLDDFAQRHRETAPSMWTQRHSYKTYKVVYERFAHGCLFKAYVLQLV
FT                   DGSLRQQMEDFQVEDWVTRVPSDAERIDILINLVNTVQRELNETLDPDVLFVTSATSVL
FT                   ASMAVVLQQPHREQFMLKIGELKL"
FT   CDS_pept        825871..826983
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26060"
FT                   /db_xref="GOA:E9ASY6"
FT                   /db_xref="GeneDB:LMXM.36.2100"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY6"
FT                   /protein_id="CBZ26060.1"
FT                   /translation="MLSEEERATLLRYYSTVKLNETQLDQLAQAYWAAPREERGEIAKV
FT                   YAHTFVDPTFVQRLIFFHDYHMSLTAAGADLSSPGVAAGTGSSFAGQQSGSESGNSPLM
FT                   ASPTSSFMAGSSTTAANHAPRRTHAQRLLRSTIQEHFPKLTGPGPYPLQFGCVQSEKER
FT                   EEVIELYSSQFLHPDPPELHRIVTLPSNFSTRTRKRISGSYSWYLRCLATQELVCAVTV
FT                   TVHQQETIRFAEMPLFATGVGYKKNGFGRLLNAALLAWCAEVGLEFIMISADVQAIPFW
FT                   SHLGYRAMTRGEKNRIDFFYQHDCCKFKDAETMIGYCNANRGNGSLSGGARRPAPHNGG
FT                   SAEVLHKSVRQVLAKLPRFVLEGPAKLPTD"
FT   CDS_pept        828535..829395
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26061"
FT                   /db_xref="GOA:E9ASY7"
FT                   /db_xref="GeneDB:LMXM.36.2110"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY7"
FT                   /protein_id="CBZ26061.1"
FT                   /translation="MNAMTDTEVVQYVLQNKSNYYKVLMVGTDATEAQIKVAYKKMALK
FT                   CHPDKNKHKQAADAFKLVGTAHTTLSDATKRSIYDRHGAEGVQRHESGGVRRSANGAGV
FT                   YRHRPAGQRDFFEEFFFGNGYHTNGHGVHPGAGGARYQAEVNINPNALLFVPIVVFLLV
FT                   AMLLSSSYTDVDASNPLFGGGLRGAGMVGTSFSFTASQNEGFIVQRTTSLYGLRVPYYT
FT                   TPRMSEVMDRRKEVYMSMEQKVLETWRDSLGRRCEAESLKYRSRGRNEVPPVCGDYQHF
FT                   RRALG"
FT   CDS_pept        832773..835097
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2115"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26062"
FT                   /db_xref="GeneDB:LMXM.36.2115"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY8"
FT                   /protein_id="CBZ26062.1"
FT                   /translation="MPLAPLIRPMSPLQTQCAPSLPEPYSLDDVVLQPFSAAASSMPAG
FT                   AWDQDTSLVAVSGAVAPESRRSSPAAPLSGVGAASVPPTDMWTPALPPLLTPTLAPTFH
FT                   SMVEDALSVEMLRESYAAQLQKNCQHYSVVEGLRCTSDGAAARAGSCRGSDAGGPKVFS
FT                   AIDAVHFGHSRSAPLPSLALSSPIHPYLSAARARTSVAHKAPADELSSAATLSSLLHSS
FT                   ATTAMAAARPSYGAALLRKRPPGTQADHREGCRLHLPAQKRVQPSSSQSLSERRAHDRW
FT                   EAVPPMSPLSSCGCASTATASGKTGPSKSYTTVPFSASAKCHHGTGVSDCTGRPHAISI
FT                   AASSAVGKGGEAAATNKPAGGGATVSNAGVAPPRGQTKVEASVALPCYAPDSASSSGED
FT                   EDTFFDPPCGLSRKVLQTIQPEPATEPVRKPAAQKQGKTARNTAPTTRSSGSAACAPAT
FT                   GSAASPAAESHLPRYVYPALEECRRLLNEIRIVSPLMRRCLTPPRPLESSSGGGSGAAT
FT                   AASAPSTFSSARAPSRNIPAPPQGNAFPFLAAAATAAAPPKRATLAPRPEARRLYHWDA
FT                   ATAAEDLAFMRGPFQQSSERFTTSVAGQLQRLQALGIRLYGKDYDTSTSQAEVHAPARG
FT                   RWSLPSAAPLASPWDSAVLHFDDDQCDRADNNVAELPSERLRRLLRETEAALPSLLERE
FT                   AQPPLSATPATALLAPFSSSIRYARDSRNDYSHSAHDGAATGRAAGVFTPPMENLLPFS
FT                   SISGSLTPARPAMLSSLSYGE"
FT   CDS_pept        836483..841060
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26063"
FT                   /db_xref="GeneDB:LMXM.36.2120"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASY9"
FT                   /protein_id="CBZ26063.1"
FT                   /translation="MSSPLLHRGPMQHPLPSSPSGSRSRQEEVEEHHHQLTQRSSGGMP
FT                   LPEPFSFTGSTESTVADIKHGSSDDSRHDGKWPLGYGDDSTKSSPVLFDRHDYDGVQDE
FT                   DADDMSMVYEQGEVDCRLGSAPRPAEMRTEHWPQRKRGEAAEGHEKTWGVISARQCTSS
FT                   EPRRGTGIDSYSCISSNAEAIADFSSSGASPTLSSDGGRAALGHRELSNTQGHPAVYEE
FT                   EGEGDRYCATPHSSSRGQNDHCNSAAASQRFEHAAQQDVLLRTNRKLVYSNSATMLSPT
FT                   VVDDDVEGSDTAVTPVTARTKSGGVHDEQDGVAAAPIMKRLEGAAASHDTLSPPCLAAS
FT                   DVNGASPSAHWTSSALPCHNALPAPSAVEAATSPSSSSAAHAKTAPLRGPIAQGSGETA
FT                   DLQDAHRRLPPSASAPSEVERVDAEIESAMLEMEKRLQRHGHHSGAATTGANSDGCVAS
FT                   HSRTPSWRRSEGENPKRTESNRMENQRAHSSSSFSATHDAAVDAADADSVKSAHEEDWL
FT                   ARQRCKQARVCDAERFNTHRSGCALGRGAPARASAAYMFFSRQLRPQEDRRGRIYELAK
FT                   ALGGDGSYAAFRGPGGGLLASPLADEQSRDSVEGAAPLCIPCAAGDTLVSLGDAVASSA
FT                   DMAMFSPQSMPVSPVQGAVFAPHQNEFTAAGLQVYYSGCGLSSGAREPRRCPHLSSPTL
FT                   LDSLVVEGMSSAATAEGVSTAVAAAAVLTVNASETSSCTPFTAHRPRPPPRMLCPPTPS
FT                   PSPSPSRSIAMDPALAAAANAEEGKEPDAGVMEASFFSEVAPDAEPQLQSQARNANALP
FT                   GQSLLEPCTANLGVEAVNTMPLEATTAVANSATSSPRQMPLRPSSSALVVPADTVAPAA
FT                   ASAVATAAAADVDSDAGVSVIGSSSSFRKRVVEGNGGSDTGLQGELANREGALTEPRAA
FT                   ADTSVPVGDADGPLSLSPRCASSEPSKPQLHGGHTFASSAYRADSAPQHVGVVARNSAS
FT                   CVGCGQAASFAASHRSISPPSAAVTAAVPLMPHDGAGEDSPILPICATSFPHSGQSTGR
FT                   MSLPPSQRDGCCGAFSSWSTSSAACEGTEGDNTVDVANDATDDVVQGHACTIRQSAITR
FT                   KSLSTAVAEGEEHPQVQMRLLSSSAASPSPIRPPTDGASDKERLHDELPTLDFCAGGGG
FT                   EVGDCQHDDADSSDEYDESHLCCDGTSSPAEPTAAAATCKTRQRDTLEGLHLDVDDDDG
FT                   EDTEGQTWAEEAVRRSEGKCAVLRLELTCATERAVAAEAKAQVRERECAELHALVSRMQ
FT                   AQLAAARKATELATSKTRADAEVQVSVSTASLDDMAAPAFSSRNSPNRLGTTPSSMRKD
FT                   TALAEGTVWRRRHDIVAQELATLKGSMAEQLAVLDRLGMLPPFSEERVCAAERRLRHVK
FT                   VAHAPGTTMKASRPDAMISEAPHTLARSTCVDSAASVDFSAGGASVTAATKKIQARDGN
FT                   KIVALLSQRKQNGHREKPAAAVDAMATGATDSATTPSTSAPPVKRDGSEDRRSTLDAKE
FT                   NHYVV"
FT   CDS_pept        842212..843927
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2130"
FT                   /product="putative DEAD box RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26064"
FT                   /db_xref="GOA:E9ASZ0"
FT                   /db_xref="GeneDB:LMXM.36.2130"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ0"
FT                   /protein_id="CBZ26064.1"
FT                   /translation="MAERNYSPFSGFSTTSRGGGGGARSKGTSEGMGSKLAPVNWSTKS
FT                   LVPGKWRVVDASAIRKAASVKDDHGASKVKHLSDVDADEWRQANSITVSDSDQCPNPIT
FT                   EFDMLTAVPQYLKAKLLEQGFKAPTPIQAQSWSIVLSGRDLVGVAKTGSGKTLAFIVPA
FT                   LAHIALQEPLKAGDGPMVIVLAPTRELAQQIEQEAIKVLPQSIRCGCIYGGAPKGPQLG
FT                   LLRQGVHILVATPGRLIDFMEIKRVNLLRVTYLVLDEADRMLDMGFEPQVRAICGQIRP
FT                   DRQTLMFSATWPRDIQNLAASFQKNWVRINVGSMELLANKDVTQHFILTSEAAKLDELK
FT                   RLMERHRNQRVLVFCKTKKTADYLEFQLKRNGVDCMAIHGDKEQRQREFILERFRKDPR
FT                   LCVVATDVAARGLDIKELETVVNYDFPMQIDDYVHRIGRTGRAGAKGASFTMITKHETQ
FT                   LNASTVFQLVELVERAGQEVPGWLREWAEQGGGYHVPKRNRNMMGSFGRNGPRMRMPGD
FT                   SPAAGAGSSGGHFGLAPHAKGSPAFGMTDSGIQNKTFDYSSDDDSARPAKRARQ"
FT   CDS_pept        847394..848317
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26065"
FT                   /db_xref="GeneDB:LMXM.36.2140"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ1"
FT                   /protein_id="CBZ26065.1"
FT                   /translation="MHDRIFAFAQEKVGLTAEQAEYLSRKYWLNYGLSLYGYVKEYNVD
FT                   AKEYSDFVHQCSYDKLRYNKPLIDMLLSMQYVPEDARTHDGPRPTSIDHLYYYTNANHS
FT                   HARKVLDAQGLRPIFTRPRRVGLPVKEYNPVDDQAGAEDQVEWLGFSYEDQWRLTHPEI
FT                   ANKPMRRAYEAIYKAIEDQVAEDAALVATTTTAGSESAFASSSALRNSGSAEEVENKRA
FT                   HLRPENFVMIDDSLMNIDAPLELGWSAVWYAHDKQELPTDVKESASAPLYAAAVASGRL
FT                   QVIRNILELREAVERIREVNSRSASS"
FT   CDS_pept        849314..850120
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2150"
FT                   /product="putative COP-coated vesicle membrane protein
FT                   erv25 precursor"
FT                   /product="ER--golgi transport protein erv25
FT                   precursor,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26066"
FT                   /db_xref="GOA:E9ASZ2"
FT                   /db_xref="GeneDB:LMXM.36.2150"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ2"
FT                   /protein_id="CBZ26066.1"
FT                   /translation="MMPSSNGSARVHWSLRSIPRLLLLFVGFAVALQTATSAHALTYHF
FT                   VDSKPLCFSEIIENVETSQITGVYDWKPSAHSPASQVRLRLSAKDGTGNVYYDKEMMEG
FT                   EHSFAVQLNPNVLSGEQLICFTASSNFVASEETPVKVSIELDQAPKNEFNADKVVAETI
FT                   KKRRQIDGLDVYTYQEAGGELKDILQPRAYLETIDRELSAMERLLDQLVTNLGTSVMRE
FT                   SRMRETSESTFTRVWVCALLLIGIISGVLWMQFRFLKSTLRKKKLL"
FT   gap             853139..853238
FT                   /estimated_length=unknown
FT   CDS_pept        854946..855335
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26067"
FT                   /db_xref="GOA:E9ASZ3"
FT                   /db_xref="GeneDB:LMXM.36.2160"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR037177"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ3"
FT                   /protein_id="CBZ26067.1"
FT                   /translation="MADEEDYDLEVNRKETDKIERPERLIEVLQHDTNRILTEEMVEHA
FT                   QTVLDSMPVEHSYKDVAAKLKGRLDSAYGGTWHVIVGKHFGANVTNDDDTLINMKINGV
FT                   YFLAMRSGPPERPQEVADNETVAAE"
FT   CDS_pept        856458..858746
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26068"
FT                   /db_xref="GOA:E9ASZ4"
FT                   /db_xref="GeneDB:LMXM.36.2170"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ4"
FT                   /protein_id="CBZ26068.1"
FT                   /translation="MPAPKNKLKSFGKNRREIRSATTTYDDNGNWVGTPHQDKMRLVAN
FT                   KLFDNYYNTLQQLGRVVARTVYPTSTDACVSAASSSCAAAQDVSADVAASLWMREMELF
FT                   RTPLLTTCWINDTDPLAAHVRAYMESLDSSLLEPISWYPIAGMGWRILADKAGFRKRPE
FT                   MQPLRQYLIKQTALGTISRQEEVSMIPPFLLDIQPNDVCLDMCASPGSKTAQMLVALGR
FT                   HKVVPFDSDASPFPFEYDSDGLVIANELDAKRANMLVHQVKRLRLLFPFTLFTNHDARY
FT                   FPEMSLQPQPVDAEKAAAGAEVLRFDKILCDVVCSGDGTLRKAPHIFKLWSPKEAINLQ
FT                   KLQIEIALRACHLLRVGGRLVYSTCSLNPVENEAVVAQIVHRTRGAMRLVDARALLPKL
FT                   VCAPGMTKWTVTDAKGRVFPAPEGNMHEALFPPHTPGGYSSAAVDALDLSLCMRLFPTH
FT                   CKGGGFFVAVLDKVSEFRLKKLEELKAEEKDASTENAVEAATERQTIIGTTVPPKREKK
FT                   ETHTVSAGGAEETADAGVEALEAELTTAHELAKPKSLPPQFVGAPAEIQRAIIDFYEIP
FT                   QFPMQLLFVRTAQGERELRLTPGSVCSIVSRMAAQVLEHKTDNVLIVSAGLRVIAFECL
FT                   DKGWRIVSESAVLFAKLMRRSSRLVRVPVSLIQDMVVNGGRLKEKLLESVKDTQLRSRL
FT                   ECLPIGAFLLEIEAPKALGGVFYSTALRARSRIQLLVDHEDLEGVQLRLGEDPVKPAEI
FT                   PEAEKEDDA"
FT   CDS_pept        860330..861901
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2180"
FT                   /product="protein-tyrosine phosphatase 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26069"
FT                   /db_xref="GOA:E9ASZ5"
FT                   /db_xref="GeneDB:LMXM.36.2180"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ5"
FT                   /protein_id="CBZ26069.1"
FT                   /translation="MSHDVSRVSRPSLRPNSSSRSSSEPPNASLLSAAASAAVTTPPSD
FT                   TQASGVDVAGSAEYTCGNHQLDGSTSTVGSLIDASCSKRERNPEFNMYQLPIEEQFNLI
FT                   EEEFAAIEASTMNPRLYNFTTSNANPTKNRYINVLANEETIFPPTRLASVPPTTGGSRL
FT                   STSGSPSSMASATTPMKSLAFRAQKVWGAAGKRLLGTRRGGTLPRDSEGNEKFTTGCVT
FT                   EKSPQWYINANLVDTSVEPVFVASQAPVQECIDDFLAVIYSCEVTLVLMLTEVEEAGFV
FT                   KADRYWPEDSAPADRIESFGSMCVYKDEQDPYTYDATHELVRRPFYIRPSPGSQARAHK
FT                   IVMYQYVGWPDRGVPDSTESFEELLKIIQDYVVAPPTPNMPPAGPKSAAYSPIATSSGG
FT                   DGSTSNTGSDAGAGKLTPPVFVHCSAGIGRTGTLIGAYTAVKLTEAGLLTNTSIRRIVT
FT                   DMRKARFGMVQRVEQYMFLYMIVLQHMGVDARKFSARMQPRADMYNMRWMEARQKALLG
FT                   ARAAKR"
FT   CDS_pept        864430..866193
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2190"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26070"
FT                   /db_xref="GeneDB:LMXM.36.2190"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ6"
FT                   /protein_id="CBZ26070.1"
FT                   /translation="MINGVGAGLSRAPVRGEGLGEGSATRPLAAWTGFLPRPGVGDGST
FT                   APRPQYPLDLASLHQHALPLLNRTTTSSDKEVAQATFDHETEEDEDAVTDDETGEEDGG
FT                   GGRLSMVQSDPLRVVVDFAEVRRIAARTKTVAAAVASSDGALQQAEEAEAMLTDARKGR
FT                   ELHHHAKQDNANSCSLEARRDARDVASARALLEKRAWADVHRRATQAATTPASPSELLL
FT                   DLLQHLPSTAVRAIYDQSSCPPTAAASGFNEDFHKCVQQFMTHIVLQRDGRTGDAKQPS
FT                   VSLSDAAAAQQASASPRHRSSMQRKGAKQKQKDGEVKQLVAAVERGIADDVRDVVAYAR
FT                   FVMQERLHQEQRKGSERPSPPSKTAVGESEGDLCPDGDMRAPKQHQQLAELRAVVERKL
FT                   SLICAAAGATDEEGESETATLRTKRTQSKGGCGDDANGTPGATDAALQDSKTMFIAAHT
FT                   RFMDVVRSAAASRREKVEAAQVVEQRLEATVAAWRKSYDKLLTRELNRHRAGKRPEKQS
FT                   RTEALLEALQPHQEKHQKRQPHQPPAGLWEMTKGMHKKDRKHMNKLVKAAANVFPLPPF
FT                   QYPPAPPHFSP"
FT   CDS_pept        866812..868671
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26071"
FT                   /db_xref="GeneDB:LMXM.36.2200"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ7"
FT                   /protein_id="CBZ26071.1"
FT                   /translation="MEALFYDHTVTSTATRQADLRQALQAFLADSASRSAIQLIALFVH
FT                   IPVPSTVAVAAHAATGKATSAASPSPPAASHRSRVAKKLAWCAWEADRRLCQAGEDASE
FT                   MNKWVTHDDFSASRKAGAGIARSSFSSAFVVTVAFLAPHTRDDLVVYESWQRCAEMCSE
FT                   ASAAGVARGSASRTTRMLSPLRHASLIALSLGAPSLLLSWAERPTRCHLDSILLPHQSL
FT                   LVDLSWWVATASGSADAVSDPAAGSRVSNSALRDIFISDVQRSLKLPKGDSRCAVWISY
FT                   ATLLASLHPQVIGRGDGADGDGVNMDMRVAGSASRWKRGRNSLYGEVSGVDEQAFMMTY
FT                   GQIRHLLSSLNASRAGAVGRTQFLRVVLSYGGPSSALRRQLVHTCSRTKHGVTAVDAAL
FT                   LCTRSLVDVHALFGVLAGQDTVNVYSEAAAFVRTARRRASAGQASQQRHQRIAVQSARV
FT                   EMSSSPSSGPPGTEHEVADRGAGNLCHNAFVERGARALARRLRLWERKRLGKRGQRGVP
FT                   VRPRDKAAKRPMKRAHAETSGADSERVLVHAVERASRAAVSPKTGNKRRAEPLASGDGR
FT                   PSASATIALLPPQKQRRTDAATVSPAPTTDTALSWSEDVAGSG"
FT   CDS_pept        869640..871172
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26072"
FT                   /db_xref="GOA:E9ASZ8"
FT                   /db_xref="GeneDB:LMXM.36.2210"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ8"
FT                   /protein_id="CBZ26072.1"
FT                   /translation="MSKAFGRGMNNGKFDKDPAPRDAGIPIRSGADMYGNGAHTQYPQA
FT                   ELHYSDTAGPPADGTLLYPEAATNPIQAPKLSRFRIQGFKDVWATFAFAIFLIFSIAWS
FT                   IVQIATYHFDTDPHSRSPFSGPNGPRLIYVVIACVASACASVISSIVMLTLMQRIPVQM
FT                   IYVANIMTIFMFVASAVMAFLRINVVVGILMIICAVFQAVWLFLVRHRIPFAAALLRTS
FT                   ARLISTYKLTIVLNLMLCVASFGYIALWGYGVAAPVDRLYKDQGNGGYIFVIVLLVFTM
FT                   LWVSQVTPNVMHVTTSGLAATWYFAGSQNMPRNPTLASFKRAVTTSFGSICFGSLVVAI
FT                   IQFIRWLVESSSSDYENGFVQCLLSCVLRCIERIVEYFNRYAFVHVAIYGCSYIEGAKR
FT                   TFALCRQCFFAAYFNDCLVSPTLNMFAFAVSLVFAFIAGVISMSWPIGVLAFVVALIVH
FT                   SLFFVPVESAVTTVFVCFAECPEALRESDLELYATIHAADANGTHNNAPPPL"
FT   CDS_pept        873005..874132
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26073"
FT                   /db_xref="GeneDB:LMXM.36.2220"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:E9ASZ9"
FT                   /protein_id="CBZ26073.1"
FT                   /translation="MFRGHTFLVSLAASPLTVAELTQNGGRVVYHLDDKTPVTCAIIAS
FT                   DNQPGTPARCSRGWGSAKELPKSVESRIRSSRLTVVYERWVHQCLCENRLLLPCRDYPD
FT                   TIAYDPYLFAGVYFTTTQLPLQLKANIIALMQFYGATYHNHLLDTTNLLVYSHVSLSPA
FT                   APRHAVTSPLAPQPLVAGGRDEEAPSSTKETEAANTSSSQQLSTGRSGDNPNEAALPSL
FT                   TKLAVARQRGLACVTPQWVQLCLNTGELKPASSALGAAPLAQTPSLPSTNSSATLRTDA
FT                   PVPTVTAADEIRYHEEEVDRWIDEVLSSTPPSAHPNSGGATMGACAAHLPGPSLCTVPG
FT                   RPEEAAEVREALMLAAQLSLSGASVPRTRKRRRAH"
FT   CDS_pept        875893..877572
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2230"
FT                   /product="vacuolar protein sorting-associated protein
FT                   45-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26074"
FT                   /db_xref="GOA:E9AT00"
FT                   /db_xref="GeneDB:LMXM.36.2230"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT00"
FT                   /protein_id="CBZ26074.1"
FT                   /translation="MNRILPCDTNMKVLLVDDGALPMVATAFSQTELLKHGVYLVESLN
FT                   SAARQRNLMKMLRCYILLRPSLSSVEAACVELRMAKYRSYHIFFCGATSAEMLDRLANA
FT                   DSDSLVEEVQEVFCDFNAVNKDAFVLETPPPQSLVSSFMSASQVRRLAEGLASLMVAQR
FT                   RRPRIRYQKNSPFVQRLAAELVNVLKSDPGLYDYPARDTVLLLLDRNDDPLTPLLTPWT
FT                   YQAMLHEHIGLRSNTLKLPADVQGAEEEGYVFSEHDDAFFANNMFNNWGDLCNNVKKYV
FT                   DQCKEALNLDRPTATLEELKAFMQKIPQTKNLTGSVTKHTTVTTYLSGVIKKRNLLEIS
FT                   LLEQDMIASSDQSNHWTRLQTFASRPSTSQEDLTRLCLIYHLRYEKPGGASQVAPYLDR
FT                   VNSNYALLLSKLRQYYGLHRNTDRLFAATGVMAKIVKTFVDVGNIYTQHEPVLKRTLQH
FT                   LYSGQLDTASYPYLEQPTSSSGGGGVANVEHKPMEVTVYMCGGYTFEEAALVHGINART
FT                   AYKPADAASFAGGGSSIKASIGGEDVLNTHSFLRLLDQLSPS"
FT   CDS_pept        879908..887755
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26075"
FT                   /db_xref="GOA:E9AT01"
FT                   /db_xref="GeneDB:LMXM.36.2240"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT01"
FT                   /protein_id="CBZ26075.1"
FT                   /translation="MISEGDLVVLPSERSDDEPRSYGSHPNSQPVTSARRPAPLPPLDA
FT                   AYRAPPSTLVTAPGTQASVLNLVTALPLLLSLDRSHYTATLNNSQESVLDTFTGSAARG
FT                   DGRFGPLSWTTITTDAATAAVRAVLYARGTPSWQAKRRRLRRLALDSFFRSTVSARISV
FT                   RRERGLEGGDGVREAVARLLLHTRAVMSDISPTQAHLVDLFAAEIMCGVHGAGVAVEES
FT                   PRAATGKAIDEPADAKGEESLGTARASTAMMREQPKPAFEQRGIMKSGVFTATAITASP
FT                   CHPQDEIISTAASSTVAEQLLYIILRTSIAANTPRRPLVMHGDETPALLAGGLHTPPPQ
FT                   GTDGATALTATPSPIASSSAVASLTRKKPRLDDFDCVSPATLSSENRQSIYRYPNNAGG
FT                   ASPASALPYQPYCWLAPSMVALVERSRALRRHQRWTCDLDPVIEATVAGEGSSTHSSHL
FT                   FRGAGTRSAAVVSLLDNMRSSWAPLPGMTDSDDAAALTALVRDSGLPFATASPSVALDV
FT                   AREARPAGHSCGFQWGQTMMGGEDPAVETLFAHDRARCVDSRPDETDGIPGSEGATQTR
FT                   QRDADAAAAALPACRIPFVSCLPLYDEVVYAQVHLALHWCTAGLADPFCLTHIDNTAGP
FT                   NLSALRVRDEFYARPLAPNGGAGTTAAATAISGLASLLEWGCYYGTLLRRLHRLCDVAD
FT                   DVTLRGSLGSYGRCAMSTLRLLLSLLQRQIGELGYQAGGPHRLSFAELLTAHQRLQRAV
FT                   EQVEVLAAFFGVPAAATAPEAWDPVDILEKRCSSALLISRLYECFTARHADALGQYGSA
FT                   ATHYVELQQERLAELLASLGGEESEEVPLQANMRNSGDDPQRQKMRAALAAVESGTASP
FT                   SLKFSPLDTGDNYGAWEQHRKDLLSCSIDAIGLLLRSTLRPLNAMLHRWLTAGELSDPY
FT                   DEFFVVPSHGQTHSGFTLEPSPQRLPVFLSVAAATDLLHAGVSLRVLRVAATHVVCSAQ
FT                   KDARRLEGMAEVNDAAVEDYIGELHDTQTLRRAIEQFIEQLVHGAPTADAAHDMGRWGT
FT                   GVNDEGEVTDAAPMPLPPRVDLLSSYGAINWWKEHYQACTRVLLEVVESANPGEGGGED
FT                   GSAEAAPDPSLWLHADEEEEVRRAEEASATENEHVSGAASSETHTRDAERPLSCAAAAP
FT                   AARDDHHRDRSPHVTAAFPSKESTSEAPSYITVFINSDDDEDRGAHSGMGRAAGGRQGV
FT                   DSVSIASSSPRSSTTATTSVLGLRRIAGSRFSTGTTVSSTASSRGTMALYGAITEELRQ
FT                   VSLLEQQTEVDLGQSRHALRAEFDAQLWRRRRESRLGDWKAQRLALRLRRVRAMEGIVD
FT                   ELRDVYMVRAVGHAEVEGPASHSIEEAAPSHQSGSEKEETEQHGVGREPSMAGPAMAEM
FT                   RVVVPLRQLPPPRVAPPVILYTVPDDEDGVDGVTGGRRGSRVFFGRSRRTSFAANTTIM
FT                   ELPATAARDIPQSCGRQQHSLSVSIPRTNNWPRTSGSPSLSARTARRVSAAGAGAGGVT
FT                   FIDPLPTEVGVQHSEGVGVGPGIIRQLRDVTPAALSTFGVMGKPGPVESAQSAVAMFTG
FT                   PSARTPPPMPPSKSLHQCCEHVEVAMLSEHADMAAAVAVDEAHTAAVRRDEFGYAHPDA
FT                   LFRVADINDDQFLLMRTGPKSYARREAEAAALAELAERQAQLAACTVDDPGYLRQLAAA
FT                   AAAVANPCCDSPKDSTALPNSGLSAQQCSHLSMNTKRDGAAPDDRAEEDMDAGDSTAHV
FT                   GGNTYLPPELDSAWQHDDPQRGLREARATIARMAVMGKSFTEELWSWTATEAHRWYFDD
FT                   LVPLHRVLTGAEVDRALIVDIALTCDEAEALQRCSGYYRALGQYTASYLTHKALQLTLL
FT                   PPYGSLYCLTTQFLDVCLLQRAPIAVRLMDLWMTLVDAALEMMAEAEEATMVQRIISGD
FT                   TRLSALAALTDTRQGLNVTEAFSSLNSAFQHEWATCVTNGESTVKLEWRLISSGEEGHE
FT                   RLSSAAETLGSDAGFTEGDDTTEEGIWNVSSASRLPHEPTPLSQGSAEKASKKSFPIHS
FT                   FLASLSLTAASPWCSGAWLLPDHTLRCTGAIFRTLLFWKSAERIVLHTWRAGMESGLSS
FT                   VFFFCTTVRQVLVSSLQETLWARLAELTAVYRESLQFEAGVLYTYRALESFTIDHAAFL
FT                   RECEFYTLCGPQFQCRVRPVLQAMVDAVEEAESALRFAQMSIRVARRQYMATFRSMVSS
FT                   GSSSDSGSDSDRGTDSDCCRQARGRPTVASAPRHVFTPSRWSRQARERQSVGKAQAASS
FT                   VAWASHPWYLQPLEDALGRHSEKLSPPEATSGRLTDADAPETGSEVDVDSAGTPRRLSE
FT                   KGRKGQAAKAERSPSSAVSSATTAHFTTPVPDKSLLAVLGTTGGGEATHREGDSGSTAT
FT                   SRTKRRRGGSQPVGARQSTIATAVPTATTLRASAAARRSQTPKYSRSAGVVVRRSSAPT
FT                   EAPSSTATGAAKTATAALKRPRRGRYQQRRMPSAERKERRCKLRAIAERKIKEEVDHQH
FT                   RLVRDMISRQLRRFAWLTQSLRNALAEVMVEEDVKGMEDESIAAAAATSDGASLKSFKD
FT                   LHKTQQQHMNRNAYISTILRKLDALIEVMATQV"
FT   CDS_pept        888869..889975
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2250"
FT                   /product="developmentally regulated GTP-binding protein
FT                   1,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26076"
FT                   /db_xref="GOA:E9AT02"
FT                   /db_xref="GeneDB:LMXM.36.2250"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT02"
FT                   /protein_id="CBZ26076.1"
FT                   /translation="MSSLQKISDIEAELARTQKNKATMTHICALKARLAQLKRELIASE
FT                   SKKGGGKGEGFDVQKTGDARIGFIGFPSVGKSTLLSKMTSTHSEVAAYEFTTLTCVPGV
FT                   VNYRGAKLQMLDLPGIIEGAKDGKGRGRQVIAVARTCSLILIVLDIAKPLQHKLIIERE
FT                   LDGFGIRLNKSPPDIVIRKKDRGGISISSTCPLTHIDQETIKIILGEYRMANADVTFRG
FT                   DYTADEFIDAIEGNRAYIPAIYVLNKIDQISVEELDIVARIPHNCPISAHHEWNLDGLL
FT                   ECIWDHLNFIRVYTKPKGQVPDYDAPVILKKSPQPSVESFCNRIHRQLMRNYKYAWVWG
FT                   SSVKHQPQRVGKDHPLDDEDVVQVVKKV"
FT   gap             892673..892772
FT                   /estimated_length=unknown
FT   CDS_pept        893187..894170
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2260"
FT                   /product="guanylate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26077"
FT                   /db_xref="GOA:E9AT03"
FT                   /db_xref="GeneDB:LMXM.36.2260"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT03"
FT                   /protein_id="CBZ26077.1"
FT                   /translation="MSVASKASMPAVSLVAAAPAAHEAAQQTTGPLKDTVALKRLVDML
FT                   LFVGPSGCGKSTVIRRLQRDWPTLFEFSVSHTTRCPRRGEVHGQHYYFVTREEFQQLVD
FT                   AGHMIEYSRLYTPDTSSSTPQLSKPVGNLYGTSKKALHTVLARNRVVLMDTDLLGAINI
FT                   RRYCSREVVIARPVTVVRRSTVQQDGGAAPAAQAPLTLSTPRHASVSLENEHAAVPTAS
FT                   NSSKDATLPSSPSYTAPVVKRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRMKL
FT                   NQQWMQWAKENQSFFDHYIVNDSLDLCYAKVKEIVRAEVLMVESTL"
FT   CDS_pept        895474..896859
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2270"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26078"
FT                   /db_xref="GeneDB:LMXM.36.2270"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT04"
FT                   /protein_id="CBZ26078.1"
FT                   /translation="MAEAKVVKDLAEVCASGAETYSAWTTAKALVQRRYLSGKAQGTFE
FT                   DCCKLLASLTRVLRTYLRIDLAQELLRDVLFQVMDHFSTKQAAGATAALLKDDGATQSS
FT                   FDLAAANFLQNVFDTLLSATTRTYTLMGPMPLVVEWNRDADTGGVDAAVAQSKHAASWA
FT                   EDVVLEFALRAADFLSQTPEGTDALSRWAQNLFVSYEQLLALRLTLPSPQSSTPQGGKG
FT                   TSAAAPSPSVPVPALGAQMLRMSILSRASRTGKESSDSTSAATTPLTAAVHWLTHFARE
FT                   PNAVNHLFAQYVYIDILGRGLQWSSTSNASPGNSGASVKMPRERVNAALEEKCALTRRE
FT                   AISMARAAVEAYWQAFPLVLQQTNSASSRRLSSCAEESGKEDANVHPQCMNFYRWTWFL
FT                   DSLTLTFAYSGNASAGANEAAAAQQRERQRHVCAQLLETYADVAAELPGLKWKELVAAY
FT                   IGA"
FT   CDS_pept        897978..899465
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2280"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26079"
FT                   /db_xref="GeneDB:LMXM.36.2280"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT05"
FT                   /protein_id="CBZ26079.1"
FT                   /translation="MQTIGGRAPDVAPLSEIGSSRNILGTELGGTAASPQRGSSASAAS
FT                   TAANAQEKLVQELQAIRERRNWLIHLLYVRQEYSNCLQVIEAQLRETEGTCVYALYVKG
FT                   LLKRLEGSLSESLELVQTAVIISPENAVTRTQLGRALHLLGRHEEAIQAFQEAASIRVV
FT                   KGLGADWEIEYYIGLCHLHRRHYRRAIDAFLQSISIQRHDCTYLQLGKAALLAHDYATA
FT                   LQVYEEAVTLSPTNPDLLAMLGHLYLQQGNPGAAFDYLGRCLTIRPTHIDALVAASSII
FT                   QDSGDYDVALTKYRIVVAQQPDSSQVWNNIGACFIGKKMTYAAVACLRKSIFLCPFDWI
FT                   SHYNLGVAFLMIGRYCSALQCLNAAVHLHADHAPAFMLLGICLGEMKDLPNACRAYDHA
FT                   LAMQDDFLVYLNYAVTLYKGRSGEEACTKFRVFRSVWDQLTPEQRREQSSLIPGVIRQL
FT                   EDLLVPPSEPPMSTSDPVPEDSTGAAVAAAPNPESVP"
FT   CDS_pept        901336..902781
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2290"
FT                   /product="putative protein kinase"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26080"
FT                   /db_xref="GOA:E9AT06"
FT                   /db_xref="GeneDB:LMXM.36.2290"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT06"
FT                   /protein_id="CBZ26080.1"
FT                   /translation="MRMPSVFTAPSTYMADLEVCAATAYQAHSEAAIAGGSDTCKPAAT
FT                   TASPLPGPARPRLTPHAVNADAHGARELSISSTAVAPAYQLRGELGRGQYGCVYLVEEC
FT                   VHHHLFAVKATYDPMQVAALREQQRRQERQQQKPSKGSGGCVREAAFWPCVPHEEDHAV
FT                   VPFPPQLRHFSNEVMCLRECHSPFIVRLEGADKGENGEDLLIMEYVDCGDLRREIRRRC
FT                   AAGTPFTETEAVFVFLQLCLAVDHLHHLNILHHDLKPENIMLSSTGIIKLGDFGFAKKY
FT                   TEPVSHRVASTGCGTPYYLSPEALRGDRYSLKSEMWSLGVILYELLALTGPFAAATRAE
FT                   LRAHVHNADYAKLPTIYSNDLRSVCYQLLTLDPDQRPSTRDLFQDNEYLREQLNALRRI
FT                   SECSVNMSTEEKGSMFHSISAALRRKPPSAKGPATASFNLGWGGSYQISSHGQGSARPE
FT                   AGPKPRVERPAAMMPVARTRNVC"
FT   CDS_pept        914903..916351
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26081"
FT                   /db_xref="GOA:E9AT07"
FT                   /db_xref="GeneDB:LMXM.36.2300"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT07"
FT                   /protein_id="CBZ26081.1"
FT                   /translation="MEEDAPATATASPPPSYESVLVFLTTLAQWLKHARERLTCRDEVG
FT                   RHAIAVEVLRRHRERAYAWLTESVWRHTAAAGDVNTSLFPSASVELTAWVLLRLLVLLL
FT                   TWWLLMRLVRATTVPRLRARQIAVHLHGRLPTSVRDAQAAEAFIWPNSAQRGINATLLF
FT                   TVSACVSVACLLILCLLTMHVWVDVVLLRLLQHWTAPLWQAQAWVSSHVLWPSNSSQQG
FT                   SLRAPATSVEHYATSFMSAVSGLNSSLFNKLAWLRRVTQQVKLMYLWGMVGGTVLGVAL
FT                   WLLRYSSRLLRTYNASLPYFEESDPLLRWLAQQEAEATQERTNAAFAALLESQDRQERV
FT                   MEKLASSLAPATPRERQRYLQMAEEGVESHCLVDDAAPAAATGDATEDERYDGETAAAG
FT                   TGAVIISNGCSGDGDAGKLRAESGPPHDNALAAAFEAAAAAAPATRDEGTTEASCGTTP
FT                   QAEEEEGAATTASRMAKEGENPGS"
FT   CDS_pept        917345..918322
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26082"
FT                   /db_xref="GeneDB:LMXM.36.2310"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT08"
FT                   /protein_id="CBZ26082.1"
FT                   /translation="MNRTPAAGRNAPVYATAMSQFAVCRQPWNEYIGLLTKDDSQPFHT
FT                   TPQEKPAYRGRKRGREGWLFGQQVQLHYHRFPDEQLFTNLTRWRMGDTVGDVAIQQFRN
FT                   AQPFDIEDKDPQGFQRPAPEVYMKLNYKNPATISRFLTRTGHMYPQDIMPLNPEAVVKL
FT                   RVAKAQAIRIGLYPRFGNPFWFRSQSFRPKAYQENYDPTTYSTKHTMEHFAYNWVQTDR
FT                   IRQYFKGLEELHQSRRATTSSGGGGVTSEHKQQSQLYAVDNMSIEMHRNAPSYRADVER
FT                   SIKNPTVPGLMSTKGMKKKFHNLYSSTSTKRMGFSNPTLGIKKV"
FT   CDS_pept        919517..920752
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2320"
FT                   /product="glucokinase 1-like protein"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26083"
FT                   /db_xref="GOA:E9AT09"
FT                   /db_xref="GeneDB:LMXM.36.2320"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT09"
FT                   /protein_id="CBZ26083.1"
FT                   /translation="MSLTVEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQG
FT                   AQHDRSGLHIIYVRFKVTKHDIRQLLEFFDAVLQHLKKNLPNRAAHFLRRVASGAVSVP
FT                   GPVTNGQLGGPFNNLKGIAQLADYPAELFPKGRSALLNDLEAGSYGVLALSNAGMLSDY
FT                   FKVMWKGTQWDALSEGKPVGSTIGRGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECG
FT                   CLSMSWCANEDSKYVQALAGYMASKARVKGLGSTVAPIWEAATNGSGLEFNYAYEKEGP
FT                   KASALLKSAHEVAKLAKGGSDPAAMAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIV
FT                   SNSFYFDNPENVKRLKARINEHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSN
FT                   PADQLAPTKSHL"
FT   CDS_pept        922655..923851
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2330"
FT                   /product="putative endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26084"
FT                   /db_xref="GOA:E9AT10"
FT                   /db_xref="GeneDB:LMXM.36.2330"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT10"
FT                   /protein_id="CBZ26084.1"
FT                   /translation="MDEKPPPPPPPQQDSARKVAANALGRSAEVHAPKVPLSAAAPQPS
FT                   EEKRREWEAEQLRVALLADVPRTEYYYCRHLSNHGNGTVQLNAPHNEGGAPDEAFVHQR
FT                   FALPNFEASLLLPPQTGVTDNSEAHDVDSTICNPSSLNSPWEALWCQLRFDKARQSAAA
FT                   VAQQLPTLTFVGGVDISFIPGSDDGVACLAILRYPSMEHVKTYMHRCTLREPYMSGFLA
FT                   FREIQPVCELFDSVRVELLATQTMPHLLIVDGNGVQHPRRCGLATHLGVALDIPTIGCS
FT                   KKMLQLDGLTREGVETALETLGEAASSSPSLPRLLPLLGTSSPTQLYGYAVHGHLNSVK
FT                   KCIYVSPGHCVGFAVAAALVMTMLRHRIPEPIRAADLGSRAYISDAFASATATNSHPP"
FT   CDS_pept        924398..925633
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26085"
FT                   /db_xref="GeneDB:LMXM.36.2340"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT11"
FT                   /protein_id="CBZ26085.1"
FT                   /translation="MILLAFIGGSLWVIWSVAAFFMYRPRQISGATVVVTGACSEMGRR
FT                   LCMQLYARGARVIAWDYSKIKLQELQADVLKATKEAECLDAAGLQGGGRAAGSFHSGAF
FT                   VVMTVDVSSRLQVQRAAKELDGPLDIIVHAAHTHPSKRLCDRADDSAERLMQTNLLSPL
FT                   MVVRQLLPLLLSPSNSSLNAGGLPKAAQRRGDYAQVVTLVSAAANYTLSSDSPEYAASQ
FT                   WGMVGMHYSMREWIAQQRCEYMTGGGSGAPSETKATAAAGSRTRCPAREVRTTLLCLNE
FT                   IQYGVPAVMSSLLLNSPGMPTTVRASSPTTPSSSAASPESDGGGSTGPRGWSTSAYRDS
FT                   YTQLMQKRNAELDKAAVCCVKAICRGQERYCYTSAWATTVVYPLLMVCPVPWAIRLLRW
FT                   MQRTPAAAAAEN"
FT   CDS_pept        927558..928553
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2350"
FT                   /product="putative glyceraldehyde 3-phosphate
FT                   dehydrogenase,cytosolic"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26086"
FT                   /db_xref="GOA:E9AT12"
FT                   /db_xref="GeneDB:LMXM.36.2350"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT12"
FT                   /protein_id="CBZ26086.1"
FT                   /translation="MVKVGINGFGRIGRVVFRAAQTRPDIEIVGINDLLDVEYMAYSLK
FT                   YDSTHGRFNGAAEVRDGALVVNGKTIRVTSERDPANLKWGEIGVEVVVESTGLFLTQET
FT                   AHKHIEAGAKRVVMTGPPKDDTPMFVIGVNHTTYNGQPIISNASCTTNCLAPLAKVVNE
FT                   KYGIVEGLMTTVHATTATQKTVDGPSLKDWRGGRGASQNIIPSSTGAAKAVGKVYPALN
FT                   GKLTGMAFRVPTANVSVVDLTVRLEKPATYKDICAAIKAAAEGEMKGILGYTDDEVVSS
FT                   DFNGVPLTSVFDVKAGLSLNEHFVKLVSWYDNETGYSHKVLDLVLYTSAR"
FT   gap             928792..928891
FT                   /estimated_length=unknown
FT   gap             930371..930470
FT                   /estimated_length=unknown
FT   gap             932082..932181
FT                   /estimated_length=unknown
FT   CDS_pept        934726..936072
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2360"
FT                   /product="putative tyrosine aminotransferase"
FT                   /EC_number="2.6.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26087"
FT                   /db_xref="GOA:E9AT13"
FT                   /db_xref="GeneDB:LMXM.36.2360"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005958"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT13"
FT                   /protein_id="CBZ26087.1"
FT                   /translation="MTLDTQPAPAAQALKAGNSTGSLTEERREAEQQRAAENVSFRTIT
FT                   SSKHAQRTLQPLNSLTDNMKPSRSTKSNLRLSIGDPTVDGNLQVPVIVTEAIVDVVRSG
FT                   KFNGYPPTVGADNLRQVVSTYWCRFCQTKSRQEQLKGENVIITSGVSQAIVIALTALCN
FT                   EGDNILMCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLQAAAGMVDSRTKAFIIIN
FT                   PSNPCGSNFSRVHVSDIIDFCQHHQIPLISDEIYAEMVLNNGIFTSAADFDTNVPRLIL
FT                   GGTAKYQICPGWRVGWSILIDSMNVAGEWAAGMERLTQLIAGVNSICQEAIAQTLLKCP
FT                   RECTEHIVTQLEAGAKVYSRLLEHDIGISMDAPQASMFVMLKLNLSYFQDLKSDMEFYE
FT                   KLLDEENVQVLPGEIFGMSGFIRATVSRPPAVLNEAVDRIIEFCERHKK"
FT   CDS_pept        946230..949100
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26088"
FT                   /db_xref="GeneDB:LMXM.36.2370"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT14"
FT                   /protein_id="CBZ26088.1"
FT                   /translation="MFSLNIKTAASPSSAAPTPAPGVNTGEAPWATIDVDEADSFESTP
FT                   STNSSSGQGGRHRCQHDAQPSHSPQSPETPIKFDHGAYPHCPIFIPSKGRSDLDRSTMA
FT                   VLVRDLVPFVLVVEREETEGYRAMLDRLVGQYFGFAGMTFAANVDNGSEGATKTGPEAV
FT                   EWASTTPADIWEFPCACCCGGTGVAGSPSSPTTPGLSADALRALALRLSAAFHHGYVFE
FT                   PSTSAAAGGDHGAAELKNVSPPGSISPTASSASSGGARRPSAPFVLRNVDEVRALFVIE
FT                   VLPEINLGVSYVRNYILQVLVPRLMVACGVDRSGNVEELRLCGPGEHNTLTPAALRMAA
FT                   LEPAVYSVLEWKAETESYLDVRRASTTTNMVATSTGSAAGTGDSGVSASVGALSTPTGQ
FT                   TFAPALWSSSAPRSSTPSSAAAATRGTPRLLHGLFGFYWVLDDDIYGFYQSHGTSTKNE
FT                   RISARAMMRDVEVRLRQLRHNADVASPPPPSVPPSCFQTPPTPSSGSATASPYVLSQQQ
FT                   QQQQNFVFTCKEDALENNFISGGKGRLPTLQNYNLYYTTACFSLEYNRFALDTAPDTLS
FT                   VNSYNNIACLFNYALLHNPPQMRYFPPGVPHVRRPEDALVGYLDHSMLWYRFAVREDYD
FT                   FTLQLIARGLHTLRFRSLAFDVPQMMKVRGGMTDYYRNCHEDIRQQNDRFVLQWPAVAQ
FT                   HWVKGKEGNRRDDIRVRWDLLSPARAKYPGAFLYLSAPLPQLQPQRLGDDSTGGNGSAV
FT                   SSSDSVATATAVEGTETETRKRLRPSSPTAPTAESSLTPAGRRPYIPAAAAPVSVLSST
FT                   AARDWKGGYVVERWRDISREEARQHAGLVALSNDDIHIGRTVAVIPPFFDQKPSVVRAT
FT                   VIERAVESTDSHASSGRAGNASTAEAGDAQQFLPPRVIWTAVAQDVRGMPFLHVDTCFE
FT                   VPAEGIEKAAASIDQFFAKMEGETGP"
FT   CDS_pept        950430..951491
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2380"
FT                   /product="putative sterol 24-c-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26089"
FT                   /db_xref="GOA:E9AT15"
FT                   /db_xref="GeneDB:LMXM.36.2380"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT15"
FT                   /protein_id="CBZ26089.1"
FT                   /translation="MSAGGRETAPTNLIRRRNKDEINGDVSAAADRFRSRFEKATLEER
FT                   KAATTTMVNEYYDLVTDFYEYGWGQHFHFAPRYAGETFFESLARHEYFLAARGGFMEGD
FT                   HIIDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSSKIDYVKTDFCN
FT                   MSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYDPNDEHHR
FT                   TIKHRIELGDGLPEMETCTQVIEYMKQAGFVVEEAIDVISQFESSSIKSVPWYQPLLGN
FT                   YSSLQGMRSTPIGRIFTNVLCRVLELVHLAPKGTYKAAEVLEEAAESLVLGGQLGIFTP
FT                   SFYIRARKPSKEV"
FT   gap             951609..951708
FT                   /estimated_length=unknown
FT   CDS_pept        954192..955253
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2390"
FT                   /product="putative sterol 24-c-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26090"
FT                   /db_xref="GOA:E9AT16"
FT                   /db_xref="GeneDB:LMXM.36.2390"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT16"
FT                   /protein_id="CBZ26090.1"
FT                   /translation="MSAGGRETAPTNLIRRRNKDEINGDVSAAADRFRSRFEKATLEER
FT                   KAATTTMVNEYYDLVTDFYEYGWGQHFHFAPRYAGETFFESLARHEYFLAARGGFMEGD
FT                   HIIDVGCGVGGPARNIVRLTRCNVTGINNNDYQISRARRHDALAGMSSKIDYVKTDFCN
FT                   MSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYDPNDEHHR
FT                   TIKHRIELGDGLPEMETCTQVIEYMKQAGFVVEEAIDVISQFESSSIKSVPWYQPLLGN
FT                   YSSLQGMRSTPIGRIFTNVLCRVLELVHLAPKGTYKAAEVLEEAAESLVLGGQLGIFTP
FT                   SFYIRARKPSKEV"
FT   CDS_pept        957715..958731
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26091"
FT                   /db_xref="GeneDB:LMXM.36.2400"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT17"
FT                   /protein_id="CBZ26091.1"
FT                   /translation="MLSESEHHLVAVAFQSMDPNNTGMVALSEVKKRYFAYAHPRVKEG
FT                   SMAPSAARDTLDYHFGVCAGDHEGSITFDEFLAYHEKLADEAYDEHVGDVAAFTEKTIM
FT                   ELWRLGDMLLPTGVRPAIPVTQTPAGLYAVTLMTLVWVERRQVAAPPASGQQSSSSGGA
FT                   AHDDLFVLRGIKDVVRPIFTRGDLPDELQGYFAYPEELSGMAVDYVAPRLSIQRWYDFT
FT                   WEYSEGKYCGVEGIISTRVDLESLPAGLRQFVCEHATAVSRGTTWMQTKPMMNPMYKKT
FT                   SSAYGCGVTEECRKIHHWKVRTFEGKQYGNQYQGLCGKFFSKLGAPLKSNTATGMNI"
FT   CDS_pept        962918..968647
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26092"
FT                   /db_xref="GeneDB:LMXM.36.2410"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT18"
FT                   /protein_id="CBZ26092.1"
FT                   /translation="MTVSLHDLIKEWEVVNAELCRASLESHQRYSFPASSQGSSDDNDC
FT                   SAEGPSSSSPPLSSTTTYARVYSLLSRVCHIAEDARYNSFCIIQHLLWVTIVAWANQMA
FT                   NASGDLIRLPRGLRQYYEASPWCATRRGSSQRDGINDDTAGKTASSASTPVQRTSFPCA
FT                   LLPPLEFWDPSELEEMAGAPSPEPEVVRNASLHRAPNLPEVWSNAVQRIFALWCTTPMT
FT                   GSCAGAAQPCTAQSACGTASPGTLEYAHTWVIVAQHYQRFKSLLSLFFLRYDVVLEDAE
FT                   ELLQRRGRQQLPEQQERRLSDLHDEEVQHDGTHSSRLPPLPLRRRGRTSLVPSFSISPG
FT                   GAASAAGADNSVSSSSTPAALSTDREGTKKSGKQARLSACPPSSLPSTANLLRHLMRAI
FT                   VNESLAKIQEVTGEVLLLLLLPHVHRARMRSQVTTPASDTSNSGKLSHSAPPQNNSATG
FT                   EADTGKEASSALTTMHQLSGMSNWHSDEQDDDDDHVVWSSPPSPLLSYTAACFSHGNGD
FT                   APAPAPRAGAPTTDSHVRERAQQEEYVARNVFKLLLMVEDCRVQVLERWLVEKGKRVAF
FT                   FYGSQLAANLFDNAAVHQAAFAHDPSPCDPSVVTISPTRTLADANRVLRETLQAYVRLR
FT                   AKLLFLNAGTTHFLDALTPWGRTRMLESLNAFLCGFCGVILPFSLPLDSGALNKSTAES
FT                   SKEKASQAASSPLDGCDESVLFTPMNAAVADFAQEWGVPLWVAMCDDAQQRMEALKHVE
FT                   QRRAKRPKECMTLPENECLCVMQAAKYQQRQRRAMEGWPDGDVGEKDHWRGGLCNTATS
FT                   SAPVTSSFTAAAVSAVDDDRAEKPDTRDRHSVASTELEDAVSPTTSIVWLPRSPTVANE
FT                   GEDGSGGSDIRRHGGAEGANRAFTRRRGRGLDLKRVLQQQQQRRARLGNVKLPQRGVTA
FT                   SRVCDPLASSEDGGGDVVESLYTGESASVGDDGSVTAAAVGAGNSGDNVGRLRGNTGAS
FT                   ATEEGRRSGEGLTTAAGSHAKRFSRSAQLHQVATLPDEGFPCLLYLMPRRSRFALLDKA
FT                   AAAVQQQLFTRFSANVQAYLSDYLAECETAAAASAAADQRAALASQKKKREKATQVTTM
FT                   GGHAGTGTAAASSIAVVTPFPKPLLARMIFLLEMTYAALQGRGGVTSESHDNHTEDNHA
FT                   TGNGGSRRPLMETGLTATGQELGAAILEQGNGEFDSAVSTTLSTPTSPALLAIAAVRKG
FT                   FQGFLISLEKRAVLALVGALYGLVQEGAAQQPPAAQMDAVDTILNMASLLNSKDMFVLL
FT                   LKGYLAPQVMMCRSQPEIVVESQVVDRMAYRLGAAVAAPCITLLRDLQLAMSDPRSTMR
FT                   SPSPSGARAEPAEAWELNATHGSLSGDGRRGDGGDFGGASSRNMATECAQLVATRDAET
FT                   LRAIRPLQHGAFGLIHRVRVLCQAWWQPHTAVLVSSRRLRQLWEQHQLLDERFVDAVLS
FT                   VEWQYSGHSEPFRGYGQQVRPRELENSSPLHPLGSHWWHGDGAQNTGSLAAGTQLRTVT
FT                   AAAVVRGFSSALGNAVRRTGRQAGDFGYDDSDNESEDYREAYGGLLTLSTLQQYSSAYA
FT                   PSNSSYRGSNLSSVGSPGAVGGPGASGVHRGTSDGGQSTTADDHASTAVPADGQLERKR
FT                   LRWPLGNGQLSFYIFSRGAASAGRSASQGVQIVGPPLTLLVCQLLDRASEQLYTFDALH
FT                   KALPVQAPKPLLAHILHELVKAGIVVRSVAAGTRQLTYQLRNDTREVLQRKVIVDVRAA
FT                   ARQQWVTQTMAMTTADAADDGEDNSSERGGARNPASPANPTEAATAFPTSSLKPARQAR
FT                   LDAPAKAKAAPSASVDEPSSPTYSLDRTHKIKVCIVRIMKAERVLPHRELVERVALALE
FT                   DQFVVTPSQFKHCVAQLIEKEFLQRGEQAEYMFVS"
FT   CDS_pept        969278..971836
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2420"
FT                   /product="dipeptidyl-peptidase 8-like serine
FT                   peptidase,putative"
FT                   /product="serine peptidase, Clan SC, Family S9B"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26093"
FT                   /db_xref="GOA:E9AT19"
FT                   /db_xref="GeneDB:LMXM.36.2420"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT19"
FT                   /protein_id="CBZ26093.1"
FT                   /translation="MLPTTLKSCMDELSRYMDVFTSAAGKPQHLTIVGDCVYWTQGKQQ
FT                   MLYSAPVGLEVAEAFRVIAADEQEAGDEKQLTKEEEMLRERTRSQTTGIKKFHVRCSDG
FT                   AIFYTSGVEVYVYYQNGPRAGKTPLKLFDYMSEKDKAHFKAMGSKPNLFVQAIKSFDES
FT                   HPSTHTVMTFANNNNVYKATLTENPESEEIPLAVTVEQITHIGDDLHQCGVADYIIQEE
FT                   FSRYTGHYATDRYIVFSYIDSSNMRSVALLSSVGSPEVPAAEPMCPTYATEVEEMPYSR
FT                   VGDPNARTTLVVYDTATKQLRLLPDVAIRRVAPWAEYILRFGFKDAETLYLSVVSRAQE
FT                   DYAVMCCPIAALPTIAKEEELRSLYTEKDGQVAANIIGDAAAPELHVEWKQHIDFAWVE
FT                   CPPGVPVHYGKVYDVLCCHAAETETAHYHLYARPAGDRNPEAWKPLTAGAWNVCAGTQH
FT                   VCEDRVYFLANAEGRLKRILYSVPLSLESAPRTADALTRLTPLDEHVYSYCVKGDHLYY
FT                   VSSTAAAPARLYVSCVSAPQKRAEVTVPSLIATTPGADPATKTDPAHYFGGLPVVTPKI
FT                   VTVTSRRRVPLSVAVFVSPSAPKDAPGPLVLFIYGGPHVQLVFENDYETRCKAPVQVLL
FT                   QHGISVALVDNQMSNANGLRDLSICKKNFGNFETDDYVDVTQYLCNTPASEIGFPASLR
FT                   FDAKRVAICGWSYGGYATLLAMCQAADVFRIGFAGAPVGDWKLYDTGYTERYMGTLYEA
FT                   DRNAESGASRNRNETYMTSTISHYAGGFPEECNRLYIAHGLLDENVHFGHSCHVVKALI
FT                   DNAKPYSMLLYPGERHGLRQNRQSRLHHDALLVKTLEEQL"
FT   CDS_pept        978106..978903
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2430"
FT                   /product="putative caltractin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26094"
FT                   /db_xref="GOA:E9AT20"
FT                   /db_xref="GeneDB:LMXM.36.2430"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT20"
FT                   /protein_id="CBZ26094.1"
FT                   /translation="MASSVFLREDIKEVFSIYDEDVSGTISMQEAGRALYTVTGQRVAR
FT                   SELLKLIAYAQEAVAKQQQELQNQQDQVSSQQRSVMSAGSKNSQDATTAVDGDATRLAV
FT                   STRSSSRAGESISNFSVRESSPTTQQATTSTVAAPAADSPASPSGGASVSQIRFVSPHS
FT                   HLLDSSEGIDLDVFEQIVLRKLKYRSYEEELAYTFALLEDKSYPGFITKESVRRIAAET
FT                   GEPLTEAEIAEMFDPLVTGVSTAAVDLSTFTDLQLKARKAEDS"
FT   CDS_pept        979894..980661
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26095"
FT                   /db_xref="GOA:E9AT21"
FT                   /db_xref="GeneDB:LMXM.36.2440"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT21"
FT                   /protein_id="CBZ26095.1"
FT                   /translation="MGKPSVSASPSRRCAECERSFGITLWRHICDVCHHTVCDDCAPRN
FT                   TESVDAKGEKAMLRVCKACGATGHRLGSAAGGNSATATAQGTGTARPDPHSEAERERRA
FT                   RIIEERNKTQKNRGRPQNAGGEGGSRAAVANERLAPPAPASSSPTSAPPRASASPPVAP
FT                   LPPSANSGSQERLANPALEAAVRRQLQQQAHGRAAASSPAANMSPEKTRLLCEIEVLLA
FT                   KHLEDPPFGLRAADEAKLHGYLQFLKKKYRLSE"
FT   CDS_pept        981982..983337
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26096"
FT                   /db_xref="GOA:E9AT22"
FT                   /db_xref="GeneDB:LMXM.36.2450"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT22"
FT                   /protein_id="CBZ26096.1"
FT                   /translation="MQDWQIAVLVIVIVVFVGLATPLIYLIYRFGSRRRRYSSKRTNMT
FT                   TSRYADSSCCAKYGILDAGDAFAQLFRGDPRIHSSTHLLYFVDFQGELHWINFNKKPAA
FT                   KIDTESAIQQYIFETFHPIVEEDNRVVPLPPEMLALSYINYHQTLVVLDLNRLLARDAE
FT                   FGARMRHTAERPLLLSRLVADGADRAVLTALSRYGHTAGDAFVPPVTQTSGQCPALVTA
FT                   SPLQQYQQRIEVDLSTSRANPMSTTPAVSTSLPNTHAPPPTVQPPVAPPLLPPSNFSSS
FT                   YACDIFGMAPTPVIHPCDTHHITTSTPVSITAASYVLLNANGSGTELDAMSTARIEGAR
FT                   LRWDRRQSLVVSFVSGVLSGYQCIIDPITEEATLSTESAARATNVNGVESIVCRRADAL
FT                   YYTVERVNSTQWLPFDKAFYLPAGRWCVRARATLYCDNSSKTIAKVFTVSMI"
FT   CDS_pept        985292..987415
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26097"
FT                   /db_xref="GOA:E9AT23"
FT                   /db_xref="GeneDB:LMXM.36.2460"
FT                   /db_xref="InterPro:IPR037753"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT23"
FT                   /protein_id="CBZ26097.1"
FT                   /translation="MLQGILGSMPSTGIREAENVLRQSWPSLLKLRGEAKTRVCADAES
FT                   FLKAQLTNRPAPSDTLAIFTTIYVTAVHAIHSGLVAPVRWATAQESPFRRSMPVERALP
FT                   SRTEAARVVTSVCERLLLANAEVAGAYFSKLLRETAMGVPLLALVLRAYGEAAVNVLSA
FT                   HSEEPQYIENCIHHLVLATYKFTEAMSDDALTIAHPILLHVARVSGHTPDAMQLLCRPI
FT                   YSVSPMLTGIGLFDYVAYHAEAALLLAALEQYESAMYALVPVNQLSPTRGTREGEIGNR
FT                   GGAGEGDLPPWLHGLEDEEADVCDAIPRSGGCAADASRAPVTGADSALPEQQPVLLYPW
FT                   YRTECVGETRKYTSSTDAKGRTAKANSLMWRDILVPSAIEREMNRRAVTWANRLGIVLL
FT                   AAAFGGGSPRGVMALTPSVGGRIVDDEEASSIWTGMASAIVGHVCFPHPLFRLLTETTP
FT                   VSLRSFVHVVTTEKTTSARPYADLLVAISQRDTKNAYQCLGNPANVALFTADLTLDLVR
FT                   ATVLRELPRHILLDVARMYAHVPVQMLLDRIQLTRAVAKANGVTPANESAEDEEKPLDA
FT                   AAVDSRHALVQLLVKMSAAGDITSSHVCVAAAPAADAAAKEHATFYPVEEVARQLNSGA
FT                   APSFCASTASVKWTLPSSAALLQRCAQVVQFHICQYPSANLDTSLVPMLVQLQELHRVV
FT                   DADAEELCDTGIV"
FT   CDS_pept        988988..990325
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2470"
FT                   /product="putative acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26098"
FT                   /db_xref="GeneDB:LMXM.36.2470"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT24"
FT                   /protein_id="CBZ26098.1"
FT                   /translation="MNMARLVSAFGLHAARRNKPSTAPETSYLPHPRANINWTQQSLSS
FT                   NLTKAERKEILKSKLVLTKLVVLNRHGHRAPNAPFWKMCPNDIKSKKRYDVDAEDLTGL
FT                   GMEEEYSFGQYIRNTYHAFIGDKFNRTLHYFRAVGEPRILQSAMAVAQGIFPNGFGLGG
FT                   YLPSRPQFVPIFSDMDTHEYLLDDVPCFRRAEKDSHQWIDNDYQSFIDDPNTARVLKII
FT                   KEVCGEYIGAAEGYAYIKTVADGLTFNSDIGLKVAQGRLTPEMLFSIRNVSLQLLMQRL
FT                   YDTNEQQTYMAVDLPRNILQTLNHTHVGDTPQQLNDFTDTRQESTFYFMHREALYAFAQ
FT                   FFGFQYNVAGLPSGELPVASSIIMEKLVPHRDQCSHNTSNIYVRMTLWTPHNGIYTIPI
FT                   STCRIPELCELKELQHIHDTRVSLTGTWEQLCNYTPQEIDHTTDIR"
FT   CDS_pept        992750..993574
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26099"
FT                   /db_xref="GOA:E9AT25"
FT                   /db_xref="GeneDB:LMXM.36.2480"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT25"
FT                   /protein_id="CBZ26099.1"
FT                   /translation="MDPSKRICLKNLPEGCTKRELAELVRNRTGTPIHSIDLGLDADGK
FT                   TRRYAHFSCEGAKHVLEVLSTGVSLRDSTIYAHPAKTHYSFRYAEARRKRERAEAEEKE
FT                   QLEAFWAASRQRFLDRTNGGELPKNKIPKDFYASKRKYARIAAEIAQMSRNAHAAARGG
FT                   AAYAEHPRGAAHAAPPFSGADCGTNSAYRAASKDHGTSGGGAAAACEPPRTTAGGGDAN
FT                   AAKKCASRLTAAKSQAPAVAPPPPPPPGPTKEERKLSGLQAKLAALKEKLKK"
FT   CDS_pept        995728..997194
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26100"
FT                   /db_xref="GeneDB:LMXM.36.2490"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT26"
FT                   /protein_id="CBZ26100.1"
FT                   /translation="MHTKNADCEKSQQQKLEEDIKSPCTPLFHCISDVNPKSDKATNYG
FT                   CAKPLDWSPQTPETSPVSVAELRVTVVADMSEAETTSKSVTHGKAPRTNEGEATASGTV
FT                   EEPVCGVAAAGDAAPSAVQQKTQERGPSAPAKHKRPYATSDAVPSSSCHVDALGDLAGS
FT                   VRQHHPSSTPTLDSSSSSGGGDASKHAVAAGNVDGPLPPPLSGVFFPSTACDAVTTASL
FT                   VTLISSYCDVVTLVQLMRVNRSAHLLATSDAVWKPLLVSMNLPPLLSAYERDRDYYDFF
FT                   VKDVITTRALHGHYTFQAANAASGSRESVSTTSGSRSAVMNRDYMSRDEDSLQDDIFNI
FT                   ASLQLLISAASLGQSNHLIGRVQLLLTYKNESMEVLQGSCRFSVHRRCFSLCCSAFGTV
FT                   KRGPVFTVAVATVTKPWANEGFQHFSEHKNGIRLVMTPVLWEGQSPGSQITENDILVVS
FT                   RPKPVPSLITLTTGPATANSSLDAPTASRG"
FT   CDS_pept        998607..1000631
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2500"
FT                   /product="chromatin assembly factor 1 subunit b-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26101"
FT                   /db_xref="GOA:E9AT27"
FT                   /db_xref="GeneDB:LMXM.36.2500"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT27"
FT                   /protein_id="CBZ26101.1"
FT                   /translation="MGSHNTEKEEARRSAHVDGAGLDGEARCVPYQPLRVRTIEILWHF
FT                   NERNKEAELLGLQSSVTEGITSVDYNPRCHRIVTTGGDGNIRLWEIRVKAVDAWLENNA
FT                   NDMLACCRHLCRMRTSWMPLTARWSPQGEMIASAHCDGKVCLWWRDPSGGSAAAAEASD
FT                   DGSWGSGLQGTSGDSDGDVEEWKAYRHLTGHISDIYDICFSADSRYLLSGAGDGSIVIH
FT                   DLEGSTMPVLQLTNLHTKFCRGVAWDPWTRFLHTFGCGPSLLCFTHVPKSEGHHRRMHL
FT                   AGQRKCQGDYIGESCALSYRRLCWSPDGLLLAMPYGKVTRTGQQQALSTANLLASIEAK
FT                   EKAEATLGATKGHPRDNSSPTHRREAGGGKNLHDAPVTPIGDAGDDALDDILHCVYVYT
FT                   RGAPDKIACRLGVRGFSEVRGVLWAPCFFEPLPADKVLEGCSQQPTALSTAATDGTADE
FT                   ATTTVSSALPHSASAATAEALPSQLEALEAARQRRGAWGPAEYRMALAVWTSDAVIVYT
FT                   TDSSSRHSDFTDLHMRSITDVSWSHDASHLYTASLDGYISVIAFGDSLTAAHRLPYFSA
FT                   SPAVRSLCGLLERIEQVGISVEAGRSTGSFSAGAERGDRKAGGDASAGAAAAAATKTSV
FT                   AVVRKKRKVEKTCGDAATPSVAATKEVDMQQLEALLSDI"
FT   CDS_pept        1001327..1004029
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2510"
FT                   /product="nucleoporin interacting component
FT                   (NUP93),putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26102"
FT                   /db_xref="GOA:E9AT28"
FT                   /db_xref="GeneDB:LMXM.36.2510"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT28"
FT                   /protein_id="CBZ26102.1"
FT                   /translation="MFSSTSNIAPRRLGSAGPGGDDASALRVMPSTGDPTDEVRASLAS
FT                   LTARAQRLVSERDAEQLLRNGFGLFEASRKAAEEARHQANKCQSTSEGYAPATHASVEL
FT                   FMTQHLGFDAQAQQRLLQQLQRRHAQLGADLGPIDTVPSAEASGFTGIADVDAVVAELK
FT                   NDILLDVQHAVHRRQTSIVRDQVDTLFKAAWHPFYVRVADDYEALSMGANELAAGKAGA
FT                   TGRLSSTGTAAPSANAFGGASSSASSSLVDILNSGSSLAAELNSRIAAFAAIVEEYAPA
FT                   QWIKHFTAYVTETSLDGANDLTVLWTSIVQIIEPMQRRGSEADIMSYVASSRRVMERKS
FT                   LSRLLERVLRMDPMRFEEVENMSALHLMDVIARSCGATNPWMHAFVAMRVGRYDVAQLA
FT                   MDAIGIQSVRDAMAKMTATPPAERNAMPPASDLQPVYAEAKTKEDPYRQAVLLVLLAGR
FT                   TGESPAAVLRTILSLAQRVTDSLEDALWLRLSCIRGVDKSAQATPVQSLRTLQRAVLDD
FT                   MQDLVSITQGNACRLASFLIHALLPSTGLRLLLENNITHVDGFHMALCFSAQNLLQGRL
FT                   HSALEAPIDIARHMNRYCSVVLLGVDRRIRATVFAGTAIFAYFHKSGLTEAFVECCLKD
FT                   IICARLLGSRNAVGGQDALLLRAGTRALSEELLKALMQVAEDASARSEVAKATHVLLAV
FT                   AFLASQFCRPELQQRALRRAVQMMSPALAQVLHLPSRSSVVSDVLSQAAQLQQAVNTAP
FT                   HHLNEDAINAQDYQTFAQLCRMADVYAFNVNGNVSDAVDAFLQLPFVPPPNTAVTGGVD
FT                   AYVEAYCNAPGSVQLGARAALRIAISAAGQLLQHYARNSTSGGADVDEKRLRLLHRMQT
FT                   VLEWARQCCARTSVAYPAVAEGFERAYLC"
FT   CDS_pept        1005062..1006114
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26103"
FT                   /db_xref="GeneDB:LMXM.36.2520"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT29"
FT                   /protein_id="CBZ26103.1"
FT                   /translation="MPRDTDLERLTAFASDYAQLYARFASHFSIPERATIDGFAELFDA
FT                   SHIEYLHYCGGTTLERPFFPAITSELLMLSSAYLSIPEAVAPRGVRTFGLLLSLFLYST
FT                   QPARQRPQVPASVAKEGTTLPPVQTTASFVGSAPPRTEGPRATRITMVADSLTSSSTQQ
FT                   PQSCSAAEGTAATAPPSPPVPSSLRLPMQPVPVSVSCMRLLLSRLSIDTGSGVMSGQPA
FT                   AGAPPLRTAVADAPASALPAQLSHTEAKVVLALRRASGWHIEPYLQQGKHISALLSAHQ
FT                   GCAVPLVQHVTPVPRSLFAATLTARSMLNASAAPEEMGGSDSLFRDPDFVRLRQGYEAA
FT                   RRRLLLGERR"
FT   CDS_pept        1006885..1008999
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2530"
FT                   /product="putative DEAD/DEAH box helicase"
FT                   /product="putative RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2530"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26104"
FT                   /db_xref="GOA:E9AT30"
FT                   /db_xref="GeneDB:LMXM.36.2530"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT30"
FT                   /protein_id="CBZ26104.1"
FT                   /translation="MLGEPVAPPLKAVLQHDARNPSAWQPLRGASSAPSTDAGGEGRIS
FT                   DASVPAWSQHIHQVVRRAVLDPLRNAPSQIDGSRSHEEKCCESVAPPSPPDLSGQYKVI
FT                   IVDALGMPADLPTGAPRSFEDLLGLSPSILRTQLQKLMERKRYRALTPVQAAAIPLMLE
FT                   YRDVLCIAPTATGKTLCYVYTTLMHLLLKDINDRPAAAAAATAGDEGGGVSLNRRQVET
FT                   FLQEKIDKGEVCPYCELSISEVRVCPMTGFPHPSASELETDLALRSKERRAMRLEELQS
FT                   SVAEPRVLVLVPNGQLASQVSAVFRSLHCDYRIHCMVRASSAEEQRKYLQALEGGVDVL
FT                   VASPETILPALYKHKLSLRRVQTVVMDEVDDIVSVNHFEPMKIILGALPKGVQRPQRLL
FT                   LGASLPPVAYEMIKTKMLLPSHRFLLADLKTPAELSRAAASALALSPSSSSSPDKPNAG
FT                   DAGEPPAAALSVTLTGGFLTARTNLRHLVFMVGRAEKVQKLAWLYETGKLNPDQRTLIF
FT                   CNSRHNVAYVCDKMKELVSQVNFTTLTSHASSSAREGVLKMFRTGVSTSLICTDLLSRG
FT                   IDFQGVVYVVHYDMPTDMETWTHRCGRCGRGGSLHGRGYIYTFFQPENIKLAKPLVGYL
FT                   RQHQQLVPPKLREYAKQSFIDVFNNSLFHHPTRPRRKDDPQNSTPVLGRGTRRFPDYKQ
FT                   GTIHKHFRPH"
FT   CDS_pept        1009809..1011017
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2540"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26105"
FT                   /db_xref="GOA:E9AT31"
FT                   /db_xref="GeneDB:LMXM.36.2540"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT31"
FT                   /protein_id="CBZ26105.1"
FT                   /translation="MKLSKKQVKIPPIHKLRPGWSAVALHTVIYLLRHDIVATIVAIFV
FT                   VQPLYHWLVLQNTYVQGLSDAALFTLVFAVLCHCVPWALFNGVFLFFDSLHPQYGIKGL
FT                   RNNALLAPLGRRMAVYKLPRKPQQLPSATLIVSTLLDSAINHYLVIPVVLYAYLVHTNA
FT                   CVLRAPPPDTVIVGFASEDIVNYMSGHNLKQIPISLVNIASHFLIANIINEMGFYIVHS
FT                   ILHSNPTLYRVFHKKHHMYTGTISLAAEYATPLEEILANAIPTTAYFVFMFFRYTREEA
FT                   SRSAFVTSARAWPLFITWMWARLWETYEVHSGYCFSETWLGKLGLLHGHRARFHDFHHT
FT                   HNVCNYGSGLFMDALLNTMDPYVIYRYPDKHPRTKTLKEEDLKEAHDLEVGSEVMDQVG
FT                   ACS"
FT   CDS_pept        1013666..1014787
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26106"
FT                   /db_xref="GeneDB:LMXM.36.2550"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT32"
FT                   /protein_id="CBZ26106.1"
FT                   /translation="MSCESNSPAVDTTATAAAPKLTTLKEAIDRDGVPAASSSKQRRLM
FT                   DIHVTAYPGLVNQHMLPKHNTDVNDFSSIDPLQYRKAHTVRNNNAASYTEKEENVLDLL
FT                   TTNQCANRMTRLGMQLREERAKNPKGVPSISSLAPRGYHSRFLSPSFDERSTYRWDYCQ
FT                   WEPDGFHDTVRRELLAAYRDDWTEDEKADVAISMKIPYLTMAVSSDQLKDKATIYRKDF
FT                   MEDATQADYRSLSYKTNLEDLGTSYAYSAYSIDDPRRKVLFDASVAALKTPHSVLEKTY
FT                   SPRNSFLEKSSSGKQQSAAREELDRLRTLRREALRLSAAKRRAAESTDDDKTTKTVVIP
FT                   GLKGTGYRRVPNGNGSYVCLPRDHFCYQQVDNF"
FT   CDS_pept        1015882..1018662
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26107"
FT                   /db_xref="GeneDB:LMXM.36.2560"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT33"
FT                   /protein_id="CBZ26107.1"
FT                   /translation="MSSAEMLLDAAALTPSLSQLLVVDSVSSVLVYLVQDAVVDDPDAR
FT                   LQAFSEVLAHVSSSPKSDSAVSANGLGADGTSTSSATHTRAHGARWKWADVVMRGVTDP
FT                   WSRIRSLAAPVMADLLDMEVELVLQRHDSSSTTHLRSSNSTPCSSSVARATPRSAKKGW
FT                   KNELTATESSLPESVSVPLEYVWHWWRGTSLWYEQDGIVRMLAKLYSRSGTPSGDALRM
FT                   DEAGLRCLLFNVIFPALRNPQLPVRESAALLLGILADRRSSTSLSPAITSFVVDHVCRT
FT                   IMQVPTPARSHSPATLVSVEDTRVLEGNLLALKELVDADVIRAEDADVMPLLLRLSSYP
FT                   ASSVRQYVAQILRPPSLCVFTYLMQRLCEHQNCMPQHAEGDGDSSSNVPGGGEDEDGDG
FT                   LSWQRLETLMMALQQHLLYLHTTSAAMQDLFHASSDTNGILTPVVFATSLSVVFQATHS
FT                   PRFEVARMGLQLFPLLLQLSLRFCPPVALPRVCEACCGSDGCMQAELNRIAACGAVETL
FT                   AKAQTYVATFVVPVMWWFLTIRRLVAEVREKMAPSPTTGAPDETRAQVEDLVRPYATLE
FT                   QILFASQAHPSGKARSSAALPQHTATCALLPLVTYFATVMDPEEWHRCVNELLEPSWWA
FT                   GLLTDPARQEQARVGPDFVRAVHRCGTSNEVRRVVELVPTLTAALADAPTHQQCLLVAM
FT                   IRVAVVVHTARTVAVEEHALSFLYHEAYAAPALVEGGDAVSLGHVWLKHFIPTQEAIPT
FT                   AALWGEPVPPRGESIVLVESNSTVFQAIEKRCYQELYQSPQTEPVVLRELRALIMSLPH
FT                   PSMSGTHVYWYAAALAAVFGRLEKVCPQWLESDTAAAAAATAVVSGCDDANECWDDWDD
FT                   DEDGAAQGIYAAEEVRNARAVVLVLRERAAARMEAGDMAAAEDRFRPQLVVLAAL"
FT   CDS_pept        complement(1022101..1023651)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2570"
FT                   /product="membrane-bound acid phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26108"
FT                   /db_xref="GOA:E9AT34"
FT                   /db_xref="GeneDB:LMXM.36.2570"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT34"
FT                   /protein_id="CBZ26108.1"
FT                   /translation="MLRGIGFLYRCVVVVVVAVVVSAAVVSAAPMYKVELVQVVHRHGA
FT                   RSPLVDDNHTLICGTEFPCGFLNYEGQAMLVNLGKYLHHRYTENPSVVSKPYFPYSWYN
FT                   LSISYTRSTDVLRTLQSANGLLQGLFPNMSTFFPAIHAVGRKEDVLLHSYMVPMIRARF
FT                   NYAKEELRAVCDEVLDRLMSFDQLQAVAAEVHSQRFCANYTLRSRCAKRLCDIGRAYEP
FT                   TGRLESLPLLSRHLDDVCAVTAMSSYFYFAYNASNPVHQKQGAPFYHLAKLLVSNMVAH
FT                   QQRETAPPYKLYEYSAHDTTISPLAVSFGDNSMEAMLPPFGTAFIIELLSLTDAPAAPS
FT                   SFYVRLLRGHSGVRPESNFTFALSHFDMRCQDATGNTYIATDNICPFADFERFINSTAP
FT                   TSPMGTCYLDPGLLFRMDCPIDVVSDNRSLSEDCLFYRQHCSNYSCGTGYYLDAIDYGC
FT                   HRIPANNSTAGSSPMSSGGIAVLSITLFIVGGVASVGGMEVWRRYMKFKNKQSEAIIV"
FT   CDS_pept        complement(1026572..1029547)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2580"
FT                   /product="related to multifunctional cyclin-dependent
FT                   kinase pho85-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26109"
FT                   /db_xref="GOA:E9AT35"
FT                   /db_xref="GeneDB:LMXM.36.2580"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR033506"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT35"
FT                   /protein_id="CBZ26109.1"
FT                   /translation="MPLMNVCVYGLSSQMLEAFFVRECARSAQPLVASSSSELRFGLVG
FT                   GGESMGAWGLKWPVALECCQCQRAPCVRVPYLLHLPHHCDDGQQSSVEHYVAQVRLTSQ
FT                   EMDGLRNQQSAAEPISMPCRLVILEDAFFRVPSTPESSICATPGTVIAGVDQRYSQPSS
FT                   LCITPFEHEKDALTEGSGEAPQWLAVLDVRRHRDASLTVDSNPLGHSGRNDAAIAPVCF
FT                   GSTGEQFALLYNLPALPPRPSLPVPVMVSSGMAFPASEADADASIGSASDSIPPFCECG
FT                   PDGGECATVGNPGPLLSLTFYANDPTKPFDQAAWQSELMSHQSEVMRRRMRETPDGVPS
FT                   TTVCQITGVRPIPVEGSCWCRSNLPIPALLEQQLNEMRMRRSSAAAASNGGRDSYRASS
FT                   PAMSSTSSVCTMNSSHSSHHHSHVESSRRSARSGATSPSAGFLAKGWCVRPLQTIKPVL
FT                   PQTGNVDSTGRVPLVTARTQHVWTCLLNLRELEEFAIEMTVKVPYIADGTEVSLQGNTV
FT                   LFSGMLRSSTSGTVLLPVYCPAPAGAPVDVTPLWMKLYVQYLLVFPFEGSGQHGPLEIV
FT                   RSSETFAWLTVPTLIGHRGLGKTYARSPSASGGAPLVIKCSENTIPSFQAAHARKCEMI
FT                   EFDVMLSKDRVPVVIHDPLIELMALKREGVRACPGKAEYTPVRAAVHKLNYTRLRDLHV
FT                   QCCKSVDRVFPTKDLLIHHWDSLLSWARNCQPKALRGSSSSTQDSVCGGVSARTVKSSL
FT                   MGVEDFPNGVPSLREVLEQTPPSLHFNIEVKYPFQPLVDSNLFLQNDAFEVNGFVDAIL
FT                   RVVFEFADNGRKITFSSFDPNVCLALALKQSRYDVLFLSDTKEMRDLKDYRSFYVEGAI
FT                   QFASAQHLAGVSVNAGTLLSPEDEAVLPNIPEAPLHGSAERGPVTAELFHADDPQHAPP
FT                   TVPSSFGAYGRAMVAEMHHRRLKVWTWGDMNSYLYFAYVQAAKMQVDGVIGDRMPVFSS
FT                   TS"
FT   CDS_pept        complement(1032758..1034473)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2590"
FT                   /product="putative membrane-bound acid phosphatase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2590"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26110"
FT                   /db_xref="GOA:E9AT36"
FT                   /db_xref="GeneDB:LMXM.36.2590"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT36"
FT                   /protein_id="CBZ26110.1"
FT                   /translation="MACFPRLGWGAVLAAVLIACGISIAHAQSTIARYGASDEADILKV
FT                   LQVNVLHRHGARSGLPRENTTEICTESPCGYLSWAGFEMLLKVGGFLRTRYNTDPSVVS
FT                   SPMFESPNYDLDVSYSRSTDVLRTLQSAEAFLRGFFPNMSSLYAAIHTVPEPIDVLLNS
FT                   NTQPWLKFFYSNNKALLRTVCNPLTDELFPDWTEITKIGAEIYQEGYCSDYETRSDCVR
FT                   TLFDIAAAKKAIGELSQYPLLEANFEKLKRVTTVLFDYEYHYNHSDPLMFKQGGRGQPF
FT                   VQQMVTNMEGVIEGSNAYKLMHYSAHDTSLGPVWGTLGDRTPDGMMPPFAQVLVAELLQ
FT                   NKSTGAHYVRILRGNPGQSPDTKFDFGWDSKWQMQCIDALGIAYKAEGNICPFADFKRF
FT                   VKWSEPADARGYCYLDQVSIDIADCPSEPVAYGTPPTALVPSTCQFYRSACPQFACGMG
FT                   ETLNSVSMQCVCSKESCLRGNTSEESSGDAAVDADKKPTLRDPSGLSGSAVAGVSLATF
FT                   CAGAIIAVAATAAICMCARRRQRQQYVRMHATMGEGNQLNNEREGAANDSKEGI"
FT   CDS_pept        complement(1035833..1037995)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2600"
FT                   /product="cyclin-e binding protein 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26111"
FT                   /db_xref="GeneDB:LMXM.36.2600"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT37"
FT                   /protein_id="CBZ26111.1"
FT                   /translation="MFAVVPTAAATPTQAALYSLADSAKPVADALRPFLEASPSPTASW
FT                   MPLCKIEKVAFCKAVYSVLLRSDGVLLLLSHFAADGAASKAHVSVLESGGEAVVDVAAG
FT                   EAHIVYCTVSGAVYSCGYDNMYGQLGDGSVWSSNDAADGIADEQNVGGAREPVLSAPRR
FT                   IAGFGEGALTDGAHREHLSKEDTDTPLSSLKDYRVAIDLAPLPSSLACCTRSPTAAAKS
FT                   TPSGDSAASWRHVPPPADRHIKQVACGAHHTLMLTQSGRCVYACGTSAHGQLGGSRPVL
FT                   VQSTFRAITLLFGIDMVQVAAADAHSFVLLRNGLLYAFGDNTCGQLGLGHTRRVSCPTT
FT                   VPLTKKEEYEASMAQDHAAATTKGHRQLDAKAYATLRAPYASTESTYYPLQVPRLQDNA
FT                   KPHAITDDDDRDSGAAFAAAIKYGAHSHELESSNSSVRVVRVYCCVSWTLLETTNPGVW
FT                   LSCGVPLTRGVNRADVATTAARIDGCGVLGRPILRNKAEAYVFQPVHWAATLLSMGPNV
FT                   DAATGALSAPPTWVGNEQQAFSADPSHGAGEGTSDALQLPYVRINHRTSCSISGEGDSS
FT                   SCTRVVTTAPAAGQCNTADSRISSDTVPRFSHVNKGIEKAILRVSDTLVSAYPTSLLMT
FT                   FSSANAGGVGRDGIVTSMLIQSGSPAVVALEVRADSSSDVHEVRGSPTHGSMDEPLSAE
FT                   SSGTSILQVNSTHGAVIPLPSYVLVM"
FT   CDS_pept        complement(1039636..1041249)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2610"
FT                   /product="folylpolyglutamate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26112"
FT                   /db_xref="GOA:E9AT38"
FT                   /db_xref="GeneDB:LMXM.36.2610"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT38"
FT                   /protein_id="CBZ26112.1"
FT                   /translation="MPVSTLHPGVLASDSGGRASPPPQPPQHARSRVVAHNLGEDGCAG
FT                   EGTTSATAGVSKRRHRSFKDAMEVVVRMTGRRPNRCPDGFETTKRFIDRLGFAPILERI
FT                   RFVHVAGTKGKGTTSAYTAALLQAYGFKVGLFTSPHLTDLRERTVVDGRLLDENTYAQY
FT                   FFEFLDKYEALQYSDSQLDRDIASPSRANFFRFIFLLSLYIFEQEGVEVAVMEAGIGGR
FT                   IDSTNTIPSEVSIITSLGYDHMEILGNTIQEIASEKAGIMKPGVVCFAAPQVDHPETRP
FT                   VLEKHARKIGTPLVLLDRNMLPIHSWPKLAIGGVHAIEDSKLALMAARRIANIPPILPL
FT                   DEVEKSVLQSMTYAGRSQIAAVDDGANITFYLDGAHTVESISSATQWFLDVSAAHTRDP
FT                   APRRVLVFYTSRDPKRVLKAFMPYVPHFCKVIIAQVSNPRMTSHSADPSDADGRVSELR
FT                   EKMVATTEHWRNMYREVTCLPCARSFSALEDILDLVLPAASDNEDASKPAQVFVCGSFF
FT                   LVGDVMRLLKVYEAGGRRPE"
FT   CDS_pept        complement(1042719..1047929)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26113"
FT                   /db_xref="GOA:E9AT39"
FT                   /db_xref="GeneDB:LMXM.36.2620"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR033315"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT39"
FT                   /protein_id="CBZ26113.1"
FT                   /translation="MSADADATPTDPFLNPRRGIGASRSRTVNDGAMVVEVVDDCQTAL
FT                   SSSAAAAAPFENRVRPSATVARGESPQEAMAHLADSAATSTTAPAIVPCSRKRERPAVA
FT                   LASAGSSTSTTAAPPLVQKRRIAGQRKSGAKPSLSRRAGGAARTIGHSGQHSDEDMSDD
FT                   ALAEGAGVEGGSDNEEGYASDDDGEGDAEERALVSVSIALMTGQGALNAPSAASATPHS
FT                   WLVTDAFHVCLWYVLRYAGRALSAEDLWACRALLSLTAVDDTKEEHGGERATAPFAAEQ
FT                   ASSANMHVDDWAWSGSEESELLLRLLLRRAHSFTARHLEVRYGDWLHVQPALNTLTQRR
FT                   VIWWATKQTSLDSAGGGAETVCLHGAEEDAGTDLTETPLIPADELVCTEMAPSPVLEHY
FT                   DGARVARLLLSCCDEGRPQHRHTAAVSTSASTFSSMETVIRVAQAVRATELRTFLTTLR
FT                   HCSKARALMDERARGGDGCITTRAIASTTASALRTSGNVLCTDGSVGGGIMAEATSELR
FT                   LKSGGWTDDVACVRPGQISHNSMYDVIPGRKRDMIRYLVERRYSVWVPSRTVDGSPAAP
FT                   ATTDTATTDTMIPSHGPSLTAPHALSSAPLITRPSPRGTVRCPSAFSSAPDRSPFRRCF
FT                   PTLSVEADTVAQCWDRVIGSVYVPHSGLRQHLTWITELFHVLTSNNGAGMASGQGAKAV
FT                   AATMAVATPPTLLMVRPQLLLLLQTLRAARHQARPSLTEPSPSTAAHPGPKAFEESVAH
FT                   ALLPRWCSPPRLVNATKAPLPCVCGQPYRDISSNGRAGNKTESQPRPDASGEPKDCDSH
FT                   LTDTIVHTSRSFWDFGAAEDGTATQAWPTPPHVCLFSSPGSLQEYRRALSTQRELYDVT
FT                   DGAVTAAQRHRGKSSTFVSHMYDTVMAAVRAGVAAVKQHPHHARTAASASASLVSGKAT
FT                   HFGSMHPLVSPVVSEAAPLSKQFTSSVTTSLESLVYQQGCHAEHLLIFTPLYRWFACLE
FT                   LLFPLLQSARRYDDANACLHHLLYEPIFVLHHMPVSAARCPISPITYAFRYKPHKRGKW
FT                   LARLAQNMSNQKRYAEAYAVLAEAQAGYRELASHTVDDARSVPAAVSNGVGDVTNDKWL
FT                   PCDAMPNSIAAALCDVLAGKHSPASESGLPLKVQRRGRMLRVLWAAAASASFATGDNST
FT                   SPSAAERPSADSLALLHAAWEYARDRYCRRQDRLTLERLLAMTHRKVRQWTPPAAHLAF
FT                   ATRRLVDVAVRHVGGVRDKLDRMLWREPSGQGPGLSSASAGGAAEAAKSTTPSGVLNPQ
FT                   CRPALPVELLVLQHYLGRWNGVSRTTAAAANPAADRQHRKRKDTLTTDFAKKETERRDN
FT                   AGSAAVTSVWCGAHCEGQWIACLARTLLWDCYWAFPSVSPSFASFPVNARDHESDQPPP
FT                   QTCPTHEVLWLSAFQDGPLDLTTPIQFLWRRRALIEARLAQLERCTREELIAYVGARIK
FT                   VEGNTDEAARPSNLKARGRDAGVEAPRKEAHVVQRGDDKSYGRDEERARRRRSRDEDGC
FT                   DLHRHSYTSKMEEDFRGTNEGDLVLIASSLPATPLLSTESETSSLTLGQVGQERNAEAQ
FT                   RVESVKDSADASLSSRAPTLAVPEAWKVPVGSLPLLDILRAIPLEPLWRLXRCLYLSPV
FT                   TEGVPLAFSGFPDLVFWRTGGSGGGDCSNAAVQPSVEGGSAVRRTSFCLMEVKSPSDLL
FT                   STTQIAVNDLLHRCGFEVCVVHVDEVYDDGQRVSTKRIR"
FT   CDS_pept        complement(1049180..1059550)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2630"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26114"
FT                   /db_xref="GOA:E9AT40"
FT                   /db_xref="GeneDB:LMXM.36.2630"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT40"
FT                   /protein_id="CBZ26114.1"
FT                   /translation="MTLNQLKSWPSKYPTGALEETTPVRLRANSPKTASASPATAPTTN
FT                   TTPTSVLYSVLLRANMSRNAVAKNLTERSLHSHPVYDIDSVVREAVRAEVERLFPYRGA
FT                   FVESPGVADVDRAAPARRFVGSVSQVEERERSGCWSACVARVNAYCHISESDAHNPRAP
FT                   VPSTTTAVATTDTPSSSAARGTSTSVSQRFSGGPRVVIKSLQRKQTLAAMGATRVPAPS
FT                   KPESAEAPKKLFAPLLAENSIGVGGAIRDQETSSCTPPSAITDNSHRFTVVSMTQLPDM
FT                   QRHLERLFDDFAAAVEQCRVALDQQQLQSSSPAAWQTARKKRGLDSEEPSVSFLGEEAS
FT                   ASQHPQQPLHCTNSNHRPGNPTILSTDVSPRHNSHHPVSDLLSSDCIPDEWRHDHSTAI
FT                   ATDGSHCTSYARSASSESLQVADGSAPATTPSLEAEDFSNGVVMIAHTIAEHLHAILHP
FT                   TTTLASLEEEGVAALPGQDRGGSSRAGGPAALNAVTTICRQSHTGAEGEDRKPTSPASF
FT                   SSPSPLPALLSSGGLQSPPGVSSASLELRALRQLMHSVFWSRITAFLSSVSLKTPGKDC
FT                   PMWLSTTAVEQREACAYVQLPFWIWLYAACGLATDVIRAQQEAQRAFTISGQVTEPRKP
FT                   LTSSSAIANALPPPSLSQLLPTVETLARQLQRRQYERVEPTAGTLLTVNTFLSFTGVQM
FT                   TDSAVMKRLFPLQSGVAASDALGFATLSPHSAQCFTHEASVATESSSGSLTAGALDSAA
FT                   APNIISINTSSDRLISGDHTVSAFGGAGPNVIDRSSSSVGGAPVSPSHQGEAAISVALG
FT                   DAGNTAADATEEEAPQVHSGSYSCPSTVELYLQWLESANAARLAACSARSEAKRFPDRA
FT                   DAEADAAGEVAGSSPTSPPYRLDTIACIQPHTSSSTEDGQVSNGDGNSARGNSSDSSFS
FT                   YAAVQQPSEPFQVAAVIPSAGLAPCLGRVEKELHQARSAVQFARKLGTLYATQDMNTLL
FT                   QLLPALVKEGSVSPDVNFVSARAYGGAVESFGSAYSPRGGTDGTGTPAAPATPGDGVHS
FT                   HYTWTGTPTTSNSMTGPLPPLATPPQGAADRMPGNSTLFFHHANASATPPAVFPSVTSP
FT                   SLEARLLLEHLNSCAVAIVPNSYQLFVNSARALEVSFSLAVVLLSHVMGEAVPKGEVAS
FT                   VGQAAAVTRRSDISPSAISAKTGPATATVVVLKRLPAKAAAAALSDKSKGRVTRKTAAT
FT                   PPPPRPLSMDLAKVFGFGHSCLRWQHLSAYVRETLISVALRALQRKDVAMTQELLQCIT
FT                   LDMTIAHHDDQVRRHHPAPKPAWVKGVGDTKKTSGSTLKKSRSAFKAGGTKVNHLSAPP
FT                   HESSASFVNVWFSSFAHLADTTAHLLHGDHNAPSSLKGAVWHLAGLAHYFLLTRARGYE
FT                   MYGAQSHFCSAALCGYGSGNAAGVGLRTSSVTSSAAMQSFITSQLVEPAGKVLGVVVSF
FT                   MESVCQTLSADIESGGAAERQFREGVMFADNLSDDESLFMCPAVDGSVRLGSAGECTSL
FT                   FNDGGGGSYDIAATRLEASGSQTCWMELAIHYFFEIVDVLLDAALFLPEKPLYLYQLTV
FT                   SACSTAAPLIDFADTLSAAVLAGGAGSPALWGLSDLCSSMIATAPQVVADSPLDRVQEF
FT                   LSTYTSMVLQSAVTHFTVDSRHAHSRVATACETPLNTSAAVDGTLEDDCSRTFWERLLT
FT                   SVAAPANPSALGEVIFTARQPIPSASTPISAPAANLAVSPEASASSSYTQSTMWWPDVR
FT                   FNRYSHLIRIVEHAQLVSLYLNSCAGKDLAQTAPLTPYLEVSRAPRDSAPSMQVSVVTS
FT                   LLNTSTGPCAQLLSIPYACPPSTVDTSSNLIPESARTTSHERSWFHCTGSPADQALPRF
FT                   PAAAHRRVLTDRAMREVCGGLWIRVELLRLLRLAAAPLDADTFVSFTKTATKVAGQVWD
FT                   KAMQTHYTAIASMKVGVESVLPKTYASTYVRLLFLRYVQAFYADLPALSASGPATAPDH
FT                   TMSERVDGTSNGTPLTRSVDQRAASETHGDLSSRGDATPYRTLESLQMRSPVSALQHLS
FT                   QRLWTHYCHELLWALRELCWNCAEAHETAANLSVASVFGRLLQMISGRGELEGEECMDD
FT                   YGGEPVEKFPDEPYLDLKDVGMPVVTLDCALKPYATAEGVKMEGFVDFEVSSSGSSVTV
FT                   VPGMSEGRKRPPGKPPNSGSSGEFESRRESSWSARRSSVSKGSMEAEQQVMVSISDLTP
FT                   ACDFTERRRLGLNDHTIPGGTQATVRSMTPLSTSSTPVPAPPQSPVTAPPVVQKLSFTG
FT                   LKPPLYFTSSGDTAAAQENDFYKEQSMGPQMEKEPMEHVLSLTSMSLVDASSHISQDDD
FT                   DGECDVTYEARSDTLVSVSKHTLPKWTAHEPHESYSTANANADSATRGDSPKPPALTIP
FT                   KLSLGALGPPLYFTSTGDTAVFAERPMSPSLTCPPAQVLPALNCPTAAAPAVVGAAHVD
FT                   PTVTGAPLIGAAEAANALALTLPPAPVLPTPTPTTVDGLVLPKLSFGSLGPPMYFTSTG
FT                   DTGGFIETQNQKPHPAAGAATSAQIPSDTTPLKSGLTAQGTASGGATNTATATAAAITT
FT                   SNSPTAATAAAHFHGSHSSGESHSQPVFSSGDFAPTAGKVSRSGNVSDGGCSYAGGMGE
FT                   QDSKEGHAARRRCDSGLSLNSLPVLEGDPLSAVSGQRRRKRVPRTSRPTLTLMVAPAVT
FT                   MELILCICSIILQQDSGMIQYAYTVSSLTQKRVLPGMSSSSQRRWHGGSGGAAGASGST
FT                   YSQRSDVAQTDRWRYTPQHSPSSFHVIQAMHNYLKDSCNSLVIDLLEEWVLDEYASMER
FT                   VRMEQFESAYASSQEECSPQPPRHSRSDSESGGNIGSGMRQHSLQKPQAGSTGGGHSGK
FT                   LSAAMLTGRYVLLRLLLPRAITPLITQQNERRIGAGGYGSVTSGFVQRPGTVGDTQLPP
FT                   GWGQRGSRWRPAKTRGGTAASGSGSGGGGTTPQSLQMGRSVATTAEKIAPGVLDGLRVP
FT                   WRTAAQRIAQAVCKGEVAIKHIPLNVQGSESGNLPLCHAEVLSMYRLRGHPHIIPLLSF
FT                   DNTKDEYILVLPHYSQGSLRLWRQKHYPLGCAVLTLPPGIRDSRKSEPVPTAAPAMTSS
FT                   TPTPVDAPSTSLFATCARCLLQVLKGVVFMHDRRIRHGDIKCDNILITATDASAERGEM
FT                   DPPMLPSSVCLCDFGSCDTCDDDDIQNLKRDIMGGEARFLAGRWGVGRGTEAIQPPELM
FT                   SAKRRYALLHRIVTAVAPAAAATPASSSLFTLSERAERGTHTANFGGTSAEYLPHRSHV
FT                   GELIGSTGPQMTELLRRAELSVDIWGCGCLLYEMLTGRMLFGEARLGRLLVLAAVDDSE
FT                   EQNPETAASTTNAAAGPLPGTPRSRQKATVPTTSSVGGDTGSSCTPSVSQKALDDWERR
FT                   DLEKAVGKRVVDFMSALLNLDPLQRPSAHEALQHWKTIMVEAGLEIGA"
FT   CDS_pept        complement(1064914..1066569)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26115"
FT                   /db_xref="GeneDB:LMXM.36.2640"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT41"
FT                   /protein_id="CBZ26115.1"
FT                   /translation="MEHQYYFIEATWLEAAAAGICSRNGIILKDAIAKAEKGIPVQIKN
FT                   DSALTMHSLIQTTHASLEQACERYLRQNARNLRLTRASKPTPAVEALNEAERASCRELV
FT                   VRIAITGALTQYQRCTRKCILQDSSSFSPSSSHPAVSASKTGQGNGVTDKQLERSLQTT
FT                   LLKGLLYAFESFQECHSMNRDHYPPRVDSNTPGTVGWDTLVLLYLVHRIPQVARHASGS
FT                   AIDDCIGQVIRTWRKLLVALQSVDAQEAPEHSRRRGALSLVNGLLIILFQRYNTHQCAV
FT                   LLGAVEHAEKVAESSKETARSILHPSRHMVSEVVTYHYYQGRMRLYERKLDEAHRILRI
FT                   AYTLLPPAGFGNEPQRLNKERVRFFLSVAGVANGRRIPAEILRADEDLLPRLFGSLTAA
FT                   IERGDPVCFSAALDSHASTFHRRGVYLILQQAKILCYLMVVARVHAAMASLSDVDNSRI
FT                   TIPTLLAAYTYITSEEPQDGKSSAASKKRSRDDEAVSPVSEARMAESVMDEDRMALWIA
FT                   KLIARGYVRGYYSHEHKTLVLSKKVPFPLLQEEV"
FT   CDS_pept        complement(1067378..1068400)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26116"
FT                   /db_xref="GOA:E9AT42"
FT                   /db_xref="GeneDB:LMXM.36.2650"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT42"
FT                   /protein_id="CBZ26116.1"
FT                   /translation="MSANGAGPTATSDAKKARVEADVITEADPVPVFPLLSTDAAAYER
FT                   EHVHDVYSAIADHFSSTRYKAWPQVSAFLESLPPFSLVADVGCGNGKYFLAAQRLTLTD
FT                   PSHPMSTSGASLGMKSWQQAAAQASPPLVSFAPAHRYVVGLDYSEELLRSTQRQLVDPN
FT                   MHQGQRRRRLSGKRAKSEAEAVATPVSAEELPRTDTVRSDALRCPLRSGIFDAAISIAV
FT                   IHHYASRERRRLAVRELLRLVRPHGGRVLIYVWAREQRGQKKCLVDPETGDGFVRWERN
FT                   QKYDGAQQVFHRYYHFFSEGELEQLCKDAVSDDGTGTIQVAIRESYYDTENWCVMLERC
FT                   "
FT   CDS_pept        complement(1073108..1074508)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2660"
FT                   /product="dihydrolipoamide acetyltransferase
FT                   precursor,putative"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26117"
FT                   /db_xref="GOA:E9AT43"
FT                   /db_xref="GeneDB:LMXM.36.2660"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT43"
FT                   /protein_id="CBZ26117.1"
FT                   /translation="MFRCRAASKLATLATLRFLTITPIPMPALSPTMEKGKITEWCKQP
FT                   GDAIRPGDTFCNIETDKAVVSYDNATEEGFFARVITSAGEETVVGQTVCLIVDEKEGIH
FT                   SDEVKNWKPEAEEAPAAAAEEAPAAPAAAAPVAAAPVAASGDRVKASPYARKMAAEKNV
FT                   PLSGIKGTGGGVGRITSRDVAAAVASGAVSSAAQVAAPAKTAAAAAAAALTAPAKPAAA
FT                   KGTPPANPNFTDIPVTTMRSVIAKRLHQSKNMEIPHYYLFDDCRVDNMLALIKQLNAKG
FT                   NGEYKITVNDYIVKAVARATTLVPEVNSSWQGDFIRQYATVDVSVAVATPTGLITPIIR
FT                   NAQAKGLVEISKETKALAKKAREGTLQPSEFQGGTCSVSNLGATGIPGFTAIINPPQAM
FT                   ILAVGSAKPRAEIVKNGETGEFEMTGRVENAVNFAASFDHRIVDGALGAKWFQHFHDAM
FT                   ENPLSLLL"
FT   CDS_pept        complement(1075417..1076517)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26118"
FT                   /db_xref="GeneDB:LMXM.36.2670"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT44"
FT                   /protein_id="CBZ26118.1"
FT                   /translation="MPAAAAALCEYYGYLPRLVRHTGLLPSTCTSATSSMAPTALHSSL
FT                   YGADPSPPVRSGEFELPSTYSLRKPLVYDIAELPPKSVSSLRLVIISDTHERHREMSVP
FT                   NGDVLVHCGDIQEGLNFMRDVKAMLTDFSAWFTDNTLHPHPVKLIIAGNHDKAIAAMPT
FT                   EDVRRLFAPAVYLCEDSVVVEPANVRFYGSPRSISNSRWSPNTAFQGKKAWKPFMFASA
FT                   RQEDGPAAVSTAPRCSPEQPLRARFEGGTPGGPVDVLVVHQSPDIPRAHHSVEEQPVCT
FT                   YTQQVAPRRVLLCGHLHGAHGMHRLPVPELVRKSFRVATRDGGGQPEGVVRLDEIPFLP
FT                   CINAAMMVGRFGQNVLLPPSVVDLEL"
FT   CDS_pept        complement(1077294..1080311)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2680"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26119"
FT                   /db_xref="GOA:E9AT45"
FT                   /db_xref="GeneDB:LMXM.36.2680"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040018"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT45"
FT                   /protein_id="CBZ26119.1"
FT                   /translation="MSLGDAINLLREVYASTNNDHRKSCTLQLLQWEKALQAADAVRIG
FT                   IELLKTSNEGVAVQAYGAVLLRHALHARVLQPTQLPLMDLLSWYCNEPTLGPLLRADLM
FT                   ELLIECVIYSDDTVIGQVLGSLCTGIESQPRRMLLLSEMTVALVDPDFDRVPRESIGKL
FT                   KRSVTKQGSQLLNAATMSLYTYYMTSGGEQSTALAPDLEPCVEAAFKVIGALAPQLPFS
FT                   VWQEHSLAATMEVLLRWLPAQRPVLACATGLLRSYSAGDANKSAILRVLLSIVLRKIPA
FT                   LVATGDIGALDEILSLALELPKDFVQLEGVLLVQSIMSVFSIPSILFGQEAVQLMERMG
FT                   EEAFRHVDAIEIYNGLRLLLPKNLCHPVQGTNPEGQELSREQFGFEQLFEEVFADFRRG
FT                   ASKILAQLARMYPERTNQYLLSLLGDLPDPQGTPEDPRTRSRFVRQSSLTFVYWEVTQF
FT                   MMEYLSAAFEYSTVSVNACVSTLLAHEPSDAVLRPVYFNMISYFWKVRDGDGMNVWEGT
FT                   INILLNCINDEGSRYTDDIDVSAARRRAHTLLVQMCVEHSRRFLPRAPSLIKQLEPMLM
FT                   RANGMERSLLYEALIALTAVMPAHESDAYLQTIVNPLVNMLATSPALTDQNVFNSIMCA
FT                   ATPDDKDARGVLQGCLNTIAAVFRRCQMTPYVVEKATQLFPLIGQLLLSIHSMQPSDLP
FT                   PEYRSILEQEAGERDLFLPGKTRKSDAHLVNAVRGARATLMNIRIALYQVFGELSPILP
FT                   AERFGEVITALTTSAQIPTHVTRSLTERCLLPIGKEHPTLLIYIFQLLHRFFAQRKEQV
FT                   RRQRMAEANARNTRDDVVESKQWLYYAKDVTKFIRGHVLDSHLWKRDKALFLATAEVAM
FT                   SIFESGADNRTAQSFLISIVNLTTDAAVLPEVESALSEVRVVVYSRLISYVTLTPDGEL
FT                   TPCERENVAYAISEPYVRLFPNLTPSLTMAGISQEQQETLNAHLLIVGNFAGQRRKVKE
FT                   FLINIAKVNTGASGRG"
FT   CDS_pept        complement(1081162..1082118)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2685"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26120"
FT                   /db_xref="GeneDB:LMXM.36.2685"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT46"
FT                   /protein_id="CBZ26120.1"
FT                   /translation="MPTFFFCFLLSHHHLSTLPTKEAALLYERRDCAAMSRRVNAEAVG
FT                   QILEALFLLRSSRLAETTTTGSASSVPSGCSTPEPGSTSEDAVDCARRLLRDCVLTAVE
FT                   IEPAQPDPSSLLAVEADPSIAVKKSHFSLSSAAAWRPRREIGAVLEGRDLHRIDLSGTR
FT                   LSASFNRSDLSEAVLLGTYFAHCTFNLCDLRRANMAGAQFHSCTFLSTDMSAAAVRRAH
FT                   FSHCIFHRADLSDWDAAGATFFQCSFTLSDLSRWSLDGQTTVVSPTDWGRCRRLDWVMK
FT                   PGSSVRECRVVGDANATTALSLAPAEKSSCHPSQRHH"
FT   CDS_pept        complement(1082742..1083761)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2690"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26121"
FT                   /db_xref="GeneDB:LMXM.36.2690"
FT                   /db_xref="InterPro:IPR033351"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT47"
FT                   /protein_id="CBZ26121.1"
FT                   /translation="MPLVKAETDESFVAEVAENVGGACARMNDHISIMIEEYLRRRTQQ
FT                   VRDDAKQELDAVCKQLERRIADAEAAKAAEEARHHKKKAQVMQAAVELQQMHANLHLER
FT                   LFHIWRRCADVRRERRRLAEEAHVYIGRLSLFHAYMQWRLFAAALRQKRLEAKEAHKRD
FT                   CREQELLGQIEGYQRQLEEERAKDASLNEKLKEAFLRGMCALNREAVHVLHGSEENQDA
FT                   DVEAIAEILSRESHSRHRSVTPGHMDSSTPSNLHAHGVCPVHHIDAKGNFYHPCFSPGH
FT                   CEYDRHSGSRAPVSAAVPPSASGPFVVRADPKSARSIDSSPPVPFRHLSKSSKTQWRM"
FT   CDS_pept        complement(1084708..1089039)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2700"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26122"
FT                   /db_xref="GeneDB:LMXM.36.2700"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT48"
FT                   /protein_id="CBZ26122.1"
FT                   /translation="MMSRVRSGRPSARCFSLSCKRCAGYPTQWSAVRHQSQSSLGRSRD
FT                   HQRGQPNADPNTGSQISVAESPDLTQHIQFGLNNLEHVKLPDMSDEARRRSDIDKEREM
FT                   RAKFGEYGPGERLTKSSPQMRRDMLEEQQDVDGLPWEVRWRKSLIPTSEEVIQDIRDRF
FT                   DLFVQDPIEREQEWYLHWKDRSFKIQKDRMIWPQGYTDYLDHYDENGRRRVLPTDQRWT
FT                   DSSWRHLADTRYKDRMWLIEGEERKAVHQSLQTDRALLKEEEQRQSEMGDVYHGILSGV
FT                   VDLDPDQTYQALSGTADPLEVAKTKIKLQAYGAHQALTAGKRELNPAQIDPISGFPKAD
FT                   MEPLPTGITVEQGAAIATQASIQYEMLEQEAEAARLAGHDPAVAMTKAHHNTSKQYGDR
FT                   PMLRAQVEANIQKFKELETKRQALDPGKTTFSLTDGEIVEKIESPLLEETAEGQPAVSQ
FT                   IHIKVSVATTESDSGAVDPSRPEGFIHVAERPKNAEPDVPNELFRVPQSRELNEMPKWY
FT                   RETLVETEPMIRQYGMVHDPLEEKQPEREYYVPPPLRDDERVTLDDAPSGASAFDEVKM
FT                   HRLKSLPELVAGYKALPLFREVSKNDSLEAAAEAQEKDAKEKKLVGKDGKPMKRSERQR
FT                   LERQERLRKSKLSYDSDILLPNLPWETDSIVDPYRGVDAVDAVEFNKEDLEKTWRAYRD
FT                   AFQQTLTEFGNLTQVTSEDKCEKMLYDAMERFREGRVGDHPEVPKEQEEVFRLVFEAHT
FT                   KHFLADFYKFKGNRATEANAVKAEADEILRRASAKSKLLGRNFMNFVQEMTSLELETIR
FT                   KNPVQRYAVMVRDRKYEPITQPFMKWIKNELGEFMITEFQSAEQLETHKEFLHRHLNDA
FT                   RIRCPSRVDGISDASRDAAVEAFYQWCRGALAFYTGKKFHCMFLDFADTRFRSRAEELY
FT                   EDSIELFSNYAKAGKDIVQIPVPDSDPPYEYDEKEFLDGENAVFAEISGQLDKAEALWH
FT                   SGSSKRWYPMTDETEYMWFNERRGRLTLATDISDRCLENVNKKTHPSIHPFPERARVFL
FT                   EGAPLTQETAEHLWLRYMGDLYWEHSEFMQRQGRFQTSQSYRDKCVNLYHLAVRTARER
FT                   LPASWKAPLLTEAKYMLRIYTPGDHVLRHLQDVETVVDKLFAQGEPRHWVEPFSELPYR
FT                   LAVVHANLPAYGEAITKEVHRRLKWQPSNELLMKDMEQRARGGSVTPELVPYYSTLNAV
FT                   AETVFRRKILKWRSKEHEGSDPFLFWTHMYFAFRVHPKDRDEVQRMWDMYEPAYVYIYT
FT                   QCALASRVRGHRLINDALRRLCQILLAGDRSQKLVLMEELTKVREKMAHLIDRKELDRT
FT                   INALEAHLENSAQHAYTYGTALLYKEAVQQEKITRNPLLRTQMAAKEYTELRKRQEELR
FT                   INGTTLDPQQAAKMQEKEGGLADESLDAQPSLTTKEMFAEK"
FT   CDS_pept        complement(1090117..1091832)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2710"
FT                   /product="putative mitochondrial ATP-dependent zinc
FT                   metallopeptidase"
FT                   /product="metallo-peptidase, Clan MA(E), Family M41"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2710"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26123"
FT                   /db_xref="GOA:E9AT49"
FT                   /db_xref="GeneDB:LMXM.36.2710"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT49"
FT                   /protein_id="CBZ26123.1"
FT                   /translation="MSYGQPQQQPLPSDLGTKERPIVVVSAPQKASWATRFWMFLLFGI
FT                   ALSCFISLVEEFNDRFQEGQPTNKSGFARSGISGLFGSVDVKPVNLDNLEVTFDSIRGC
FT                   DEAKKELEEIVEFLKDPEKFYNLGGRLPKGALLTGPPGCGKTMLAKAIAKEAGVSFFYA
FT                   TGSEFDEMFVGVGARRVRELFAAAKANSPALIFIDEVDALGGRRSRSDHSTSRMTLNQL
FT                   LAEMDGFDSDEAVIVLAATNTPETLDKALTRPGRLDTTITVDPPDMKGRAEVAQVYLDK
FT                   IKTDSTVNAMDIARGTTGFTGAELSNLVNLAAIRAAVLNKAKVTSEEIEYAKDRVMMGA
FT                   ESKKIVPEEERRVTAFHEGGHALSAILLKDEGADPVHKATIVPRGNGIMGLVQQQPDRD
FT                   KYSQSKRQCLARLKVCVAGRVGEEILLGPDDITTGAGSDFQQATNMARHMVRQFGFSDA
FT                   MGFVDYGTPDTAEGAYISDETKLKIEKEVHRLVEQAYIETKELLLSHRAELESIANNLL
FT                   KYETLSGKDLEKIIKGEALPERPPRLSQASESKAAPPRGGNSDQANGRRTVPIS"
FT   CDS_pept        complement(1092491..1095307)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2720"
FT                   /product="conserved hypothetical protein"
FT                   /product="transportin2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2720"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26124"
FT                   /db_xref="GOA:E9AT50"
FT                   /db_xref="GeneDB:LMXM.36.2720"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT50"
FT                   /protein_id="CBZ26124.1"
FT                   /translation="MYTPTEGDLVSVIQLLHNNGVEVSNSKAAYAQLKQYESNPAFCIL
FT                   LSTVFGAETNPVADMVLPVPWAQYRQLAGITLKNNLTSARHALGEGAVKEAARFALKSL
FT                   TNPPDMRIARTSAQVVVKVTALTSLEWWIGSGVGDLPSILLNDLLPGGESKTLAALYCL
FT                   QYLVEDVPKQIGESSEHIILRVSQLAASQSAPVTIRKAAFRMCFNIYEQASLLDWNVDT
FT                   LSPLQMGLSKASHSLSSVCTSLLECSCGGDSAFVILVLRTCSFLLDYFDFFGQMSPNEM
FT                   QRYTNWWITNSAQIICSSQNSISGNQELVAAAIDLISTTVDLYDRNGGETAVAFLVSGV
FT                   PQLISSLAPALVRYALLSAEEVANIMDTDDYRVRDSTAVSFEVKGGTKDISEDDMLDDD
FT                   AAAMTLRSSALKLVDVLSTFSSDATYQAFIGPIQQLWSSSEWREREGGIVLVGTIANGC
FT                   THELRAVLDSLVDQFVQFISNQSEHVCVVSIAMWSLSRISETVLNSSPRTMNTIIPLLA
FT                   SRLQSTSKRIQITSVSALNVVYGVLENYGSTSMVMPHLPLLLESACACLSVYSTTNLSL
FT                   LVDFLNKLISLLNDRATAERLSSLLQGERANRAALFEQSYSAMYIREEPNILLDKDIFS
FT                   LDRAMIAFISVYPSNEVAVANLSTWNGVLADIKNRNVTDDADLVFNTLLICSAYTNSVS
FT                   TTILEEWLRSTSWGLPVSAAHFLTTSRIHEVKVAGITILCGLLRAVGSGALPTGLHDTL
FT                   LRWATGEVSEAEDPKFKEHLVRLIGQATSCYPGQLSTVATEALKSANAALRSDVFGDSS
FT                   YYFSAMAFDLCGALDAVPNYAALFRIDTMSQLMAQAENTVDKSEATIHLFQALVQLPAD
FT                   VFSGVFSSAIKIVYSWQQAAVNYPGTKEAIQSFLFHAGKTCPAIFQSILEGLPAAFRNM
FT                   LVSFYQLQ"
FT   CDS_pept        complement(1098856..1099314)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2730"
FT                   /product="putative D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2730"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26125"
FT                   /db_xref="GOA:E9AT51"
FT                   /db_xref="GeneDB:LMXM.36.2730"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT51"
FT                   /protein_id="CBZ26125.1"
FT                   /translation="MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDTEYI
FT                   LRKILGARVWSNEDGSKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPEDAL
FT                   KVFNTLRDKLRCEYAPHKIATGNFQHYMNIHLSNDGPVTLILDSKKRS"
FT   CDS_pept        complement(1099847..1102906)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2740"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2740"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26126"
FT                   /db_xref="GOA:E9AT52"
FT                   /db_xref="GeneDB:LMXM.36.2740"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT52"
FT                   /protein_id="CBZ26126.1"
FT                   /translation="MDASGISASWTDLLAQSPSSPGSSSRVALSEVAALCLALEAPKCY
FT                   AVYRPSNLASGVSRHTSPAPALATPQHFLQLLTRLREALGTSSEAARIAEVLVDLLNKP
FT                   PHPHQPGPWDLTQNEVRTVKATAIQHVMDTIQGGGDALAWLTRLLRLTDTCAGDGEATE
FT                   SEVPLLSTALQERYSLHGGSPTRRVHCGDADGEWLLTRSPVVLAAIAAAMLRSTTKGMK
FT                   AHALELLEAATITRLSWTSLSPGKAVAGSSYCSDMQHGAPKALFDEMVAVRCAEAAAVQ
FT                   GDAETVTRLIFLLYRARGALGFATLAEHRERRRSGRGSEGTWRRTSSGLPPRTSSWFSA
FT                   RWWCRDDGAMVKRPALVEEDAADMRFELAVVRLLKSAMQALLYHPQRTSDTVICTVEEA
FT                   LSLWDGLRGAISWPGIAAIGAELLRYLADQHARLSVAADAGNGGAASDDVHVQRASLRV
FT                   YGHLCRAAPVRQRTTAQRDELNHFTSLMLRIFSAELVVIGSAGMLVPVAASTTAAEQIL
FT                   RLFANLSGPRVQELALPYALAASLVIFAAAATQKGYSVPPSLLAPLAAYFSETQSLHYY
FT                   CVAATSAGVPAHVAVSGSLVLLHLLLWSSVPEGEWARGDGELWPLLQRMQKVKETGQGA
FT                   DAVAAVPATAAAHRVTAWLRVSGDQQRSLLWLLLLSAKQRDTSWCSAVANAFSSPASST
FT                   VVNCAVSSVYAQLPQAELKSVVELLYACGNNDDPAQASQTLDRVVSASLQLPIRTLTLE
FT                   TLDAQLQRFSAGRQATSVLVLGTASIRALAERCATTSRKDADDELTVEDFLRVLQPLLV
FT                   GPTAALPLRFTVVVLTPASLVELQRMYTGADDAPRQASAFVRALHDALVSRATPSAYQV
FT                   HAASSWPLLPFLALALREQKELRCVDGLREATAVARHLEHTLPKESRPLVCLWVEREAL
FT                   FDSPHTLSAKANVLRHYGVREVSTHRAHVEKAKRDIFSLVRNGPAGTVHPTGAQVTGEA
FT                   ALAEAKAARRTRHHSLLSAVSERSRRQRSA"
FT   gap             1104074..1104173
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1107464..1109242)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2760"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26127"
FT                   /db_xref="GOA:E9AT53"
FT                   /db_xref="GeneDB:LMXM.36.2760"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT53"
FT                   /protein_id="CBZ26127.1"
FT                   /translation="MFDSFKHTFSQTKYVAHREACGLHVIDEVKRFRALVCVLFCSICV
FT                   SLVFAFDLFSDEFQTRFHLSDGDLSTISTVGVVFCYFVIPYGVLYDHIGPLPLLVIAGM
FT                   MGFIGCLGLGLIFDGKIKGTTATISVFYAFMNTCSGLFDAASIVTLVELFPRNRGPVIG
FT                   MAKVMTGLGSSVISSINRGFFTNNISGFIYLIMVLTVVVALMAILLIALPPYFVNWWRA
FT                   RSKTEEQIAALTSLKDIYAKKFVPLRRIAYGYVIVACLVIFFAITAPILAYTKVSRGGK
FT                   AVIGGITVLLCMSFWVMALPIPWLGGVSEPAEQQRSTFDDTEGNKPLSTFPVSDDDAAR
FT                   KQSLVGVEAVIEDGPQDPRYGGTIWETLMRPEIWLILIAFVCQSVLGTIVTYNGSTIYV
FT                   ARTGRPRTAELGSLYTALLGVGSAVGRISMGLFEAYVQHQDPKNRKVLVTIALPVAPFI
FT                   ATIAGILILVLPGDALLLPYILVYFEEGVFNGVRALIFPCIFAGHHGILYNMSFFTNVI
FT                   GVICFNRFLFGLTVDKEREKMGHTVEQGCTSHACVQTPIIVVTCTAAFAVVLATVAHLR
FT                   YARFVAQCRKALKAAA"
FT   CDS_pept        complement(1112829..1115069)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2770"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26128"
FT                   /db_xref="GeneDB:LMXM.36.2770"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT54"
FT                   /protein_id="CBZ26128.1"
FT                   /translation="MSAGRASSQHRDRPRSSSRRRHYEDEDYVQPRDERTSRSPLHHRH
FT                   SSPHRKPYRTSSASTQRKGLSHISRELHQYLKDDYAPEDGVPPLRRQSTQPPRHRSSPT
FT                   YHYNGDNGGERVYHRRAVASTSPRRRSTPHRRRSSSRHAASVYPALSTAPVAVGDGKRA
FT                   SPRRSARTSTDGTPRRSRRQHEPSHVGYGSVARSPCPHHRHSSTSPHRSHRPTGSPINP
FT                   ERRAPSSSRKPRHASTEPHAYSSQGSARRHRHSDTTSSTAPAPAKEAAHRHDALRYRSS
FT                   RQAEVADKREATPHRSRRHSRAKAGGSAEKEARSPRRHTSAHRSRSSRPESRHHSERRR
FT                   RHHRTSTPDSVDEGSRRARHTSLFRPLAEDPYAAPPPLTGSTYIRSGADSHRTRCPRSG
FT                   SHIEVISVHSGCQAPTNGWPHSHSSTAHSLRRVCDNGPPVVIPSPRGQQIMQRIDSTRH
FT                   WLQNIKESMKKERERAPHQVEDVARSRASRHSARKEYRDSTSRAGSAWRHRTPSTGSHR
FT                   HTRGKTHAAAQVASRQDAGEAIPPATSSDRPHRVSEQVPPPTREKRHRSSQRHLGRPTT
FT                   PLAAPRTPTPDPNLLSALMDSVNSSREEGIDYPILSFMSFLDGNTFDSTASLCQYNVNL
FT                   ADSLSDEHLDILRAAVFDHDEEAFAELLYGDDVEAEIGGAAAALDHSDDPSVQHELVVL
FT                   QRKAVRRFNEKCAKALKALLLAEGGLAEAVQVAASQLEHEAYEADGSSVFVP"
FT   CDS_pept        complement(1116617..1118098)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2780"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26129"
FT                   /db_xref="GOA:E9AT55"
FT                   /db_xref="GeneDB:LMXM.36.2780"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT55"
FT                   /protein_id="CBZ26129.1"
FT                   /translation="MSTTSTSHDCHRAPYHQQLQTHIEALLLLFLRDFCAEGASPTRSG
FT                   YRASHLQAIAQTFYVLQIVQCSAAPRRERETPYSLFQTGGGIARLDVCTERDLYYRNPP
FT                   LFAPRGQRATHESINRLCGWLEVVACVPPHQQCGGGPVLTSLFRSPRCLLSRLRKGAQG
FT                   TASLTPLYTRESLGITAAGKSLLAGAITLELCDPAELIDVSARGSSGITLTYSLAARMV
FT                   GCREADDWQAARDGISLSRSYKLVLIEKESVHHAVLQSIAKSGSPHTYSCILLCTKGYP
FT                   CVAAREWLHRVHALWPALQLYIMVDGDPHGLCIALTVMGLLGSKEYPSPIASSQPTPTL
FT                   SSFSSLSGATPASAETAKVKELLPLRFLGVCPSLVWGCNFHGEASLSADPLCDLASSQG
FT                   IPLTMNDVQVLQRIVSIVQASLASTPGTSDSAPLLRGCDTVIARHTLQRVLKEAEWMQR
FT                   ARIKCELQFACRPIGPLTFMEQHVQRCDAELSEGR"
FT   CDS_pept        complement(1118810..1126873)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2790"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26130"
FT                   /db_xref="GeneDB:LMXM.36.2790"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT56"
FT                   /protein_id="CBZ26130.1"
FT                   /translation="MNSIFVLIRPHAWSSAVVDRVRTCLANVGACVDAEDTVSASTLLS
FT                   TSTVERHFGSTHYWAASATDAVLRHPLSASENVNREEGQPAFCAAEEDLKSLFYAYYGE
FT                   LWDSALDDGRLRTAFDVMRADNVSAAELASRCTSAGDDAVLALPLGLTVTRILSSDERE
FT                   GDVPLHYVVNGAYPAVLEAFRRRSSGASGAAAPCWWCVASWPSQAAQEVSPEVTERMIR
FT                   LPRMLAEATSTPYSIDVFTGALEALACRVCWMNVPLYNDPFARSLVQHGLPLSWVAALL
FT                   RGPTLHEHGHFTDVFDMTDGKDEGDVAVTLVALYDALRSPDDAAEDRNAVDDAAALYDW
FT                   KNGRVDMTAASSGPLAEDSIPSRTYAVALVHPRLWSREELAHLLEAKLEQLEVCVEAVR
FT                   EVSAEELEAKLDLHHGDVARYALDQEALRRFAVDENKAVAAEATACFEKNCGVPWEVAM
FT                   QEGRIWSTSLAEDLLGAELAAAILKHCAMNTHTTHRLSATLSITELSRQELMTQLNPAC
FT                   PVDAVSSASDSVNLQGKRKEVATPNRPYSLTSESYFVVNAVYAVYRRDVLGTSTIACAP
FT                   ERAGGLWQLSWRADAEQQSVAVRGAAISEVLCAAALVDPVLLREGHNEALGVEPAAPYG
FT                   AAFTESVGAAYPLVQVSADCFGAMRARHLWWGIPYEDDVVSRDLVRSQGQSWVTLHASF
FT                   SASPTAESAAHEAVLALLPPVATTTEAMKLTLATLEENGVCIVEEADIFGYDAFDYIFS
FT                   GSTALAVARQLAQKTGTGLWAMMSDDMQVTLRAAAAALADETAQPFTPENLYGGAMVCD
FT                   ALHIPLGALEAGWRRTKPICVGDNCWLGYLATYEVWVVNGHVPLLEHRYNAETARVHLL
FT                   RVQWDASAVSWNEMRKALVGQCRNDNDGETGSCGNSPAGSLTRLLSRIANRSPSNTKRL
FT                   VGEPLHVFSPTAYHALVDVLRWPRVGSSGPLSSEVALEDWLVRQPSVQRLLQRGASTLA
FT                   IVVQQVRETLKTVLQPLLPSQDSSPSTPCWTSRFARLQRAVQLHHGFIWLHPSSTTPAV
FT                   RDAVPALLLAHRVRVRDSGAVPLQVALERELLDVLHDPFFKNAYVRSAAEVPITDAEAQ
FT                   AFARHFNLDWMGAVQLGLVLNAKEAEQKYGTVHVMMWWESLAPEHQAKLSDSLFVGYMA
FT                   EEGLYVMNAPYSYRRSRLHVGSHEVVWYAVEWNAADMSWDDFLRDVIGAADPAAAAAGS
FT                   LRQHFGAHWTRYSLTGRPDEIECVLHASKTPLAALAERCRWLAQSPRQDPYGCLLLQSG
FT                   VHPSLLSTLLTNPSVYSQDTGVITEAFHVLPQEDVHALVRQLRDAQCTRTVLILQDKTR
FT                   LVPPATALLPDAPHLREADKGPADLTILAQLRAYRHVALTGAVDPFVQCGFATAHQQNR
FT                   PSPSSPFTCSAVLYLDPTCVAVAERVSSSYHTLRSLLEQQLHINGVHIVHERVVQCASA
FT                   AEASVLYRCHQHREYRYGVAIPATESLANSMQWQIRFKERFGVSYRHASVALYNAAEMS
FT                   RVMQVTERDVAALCRRSKSRHPQDTVIVGEGCVVQRLQPGKPFYVMNGDVMEAEKEFVA
FT                   AQATVGVRVWMLTWDSARADMGYAKLQHLIAELQAPTGVLRQWWAPEDEEGDLGRASGL
FT                   STRDHDAPFLHVSESAVAAVRQRQLWWRLPVWSDPTVVAWVNGAAGNETARSSTDASAL
FT                   NPRTVAWALQDPLISVAARDDDGPVYLWDTVVGMDAWHTCARIRCCWAAAVEDEHNDET
FT                   TRDNAVLTLAPQVATNSAVHHLVRSVLLGNGLRIDAHGFIADHGEDIVALKRTVQYLYP
FT                   EDWSYAIEEPNEIQLNFDEAVCVARTFGTSWEALLDGGRLLPGSRATKRLGGMTAPQLQ
FT                   LFVKTAKNSLWVRPHLHIVELEEYGVYVINAHVPYLAHTIASAITEYPLPYYLVSWSPS
FT                   LWSWKECLAQVFGCAEPTLAVPGSIRGRLYASWSSFGLHAAPEKAEGGGGGVCVSEGPL
FT                   QSLLSRLHVQWPPLDDFESDPIGSVVLRQPESSGATALLRAWLRNPVATCDGIGTGVLS
FT                   HLACWDTREVLHLLETVTVTRKKASGAEALLLPSALAKARSEVHEAEARRAAEAAREAV
FT                   FQQRYDLPLLLTFSEAAAPPVVQTSDNTAESALLHRNVNTLLFFSHQLDTAQRALLRQH
FT                   LEQHSVAVTAAAKYEEEEQECTASLLDRLYATEAFFADCPNLAAVLSESDEVAVEDQAR
FT                   FSAVFCDEVLWLELLARSALSQEAEHDADTSLVGSASDEVHQRRYIYSAADAMKIWRLT
FT                   PHELWAEVRQGVSVRLSEGLEVTRLCRMTPGCASDTNERAVATDTGAPWKGHYVVNGLY
FT                   AAVRDSLQAPAATCEKSNAPHAQAPPSLTKWNVTWDAQTLSWHDFCQFVIGYADCTQAA
FT                   SLSFNALIAESIVDARASHEENKDETPSPLSCVGVMAASGPLAAFAVRRSWCWNANYHD
FT                   MYLPDPFLRAVGVAGMDHDVVLNEGWLLNPLMAVAPSMRRLRVFDWTRGCDTPAVLDWM
FT                   HSRKQMLDHTSIESNEARGASPAPAEASHDSEESAEIVAVAQTVAEELHPPSPPPRMKS
FT                   QLKMAWVYDALLHASTHADYKLLWQHYRSLSAPAAVAAGEAASTHKMSNTISFALFYRD
FT                   FKYLDNFGVPCMSHELKNLFIDIETQRHGRMSYEEFAHAIAVYHSL"
FT   CDS_pept        complement(1128263..1130887)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2800"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26131"
FT                   /db_xref="GeneDB:LMXM.36.2800"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT57"
FT                   /protein_id="CBZ26131.1"
FT                   /translation="MYSPYDAVYGHDTTYIRRMIVEEYVQELKEEEADVRGVTPALCAA
FT                   GLASEKTASATPTSSTPARRTTRQYEQRRMALSSCNPNVAFFSKYPMYDRLGRELCVAF
FT                   QMQDMAVQQELRRLEKENGRDSRRSGVRLSAELPMESDTTGGSRPMSVRASAATAEGHE
FT                   LTQTEEVSRVVRPSHIDGDTLVGIDVSATSHYPSVSAICTSSCPASARPSEFSIFRDSC
FT                   GTAAAGMNRGGLIKTHSCLPVRSVAEEEGILIHRSDGGGGSHRAASMPPAALPRLPDDA
FT                   DGRRSQWPWRSEKRHRSRSSGGGGRHSRVRFINDDQSADDMQREEQPPQKRVHGALPLP
FT                   PRLFTPPPVPLSEGDNARVEETAVEDATRWTATSRASAAVRATKQLFRSTTHTNTSTAS
FT                   HATATPSYRQPIASSAYGLSATAIAASKVGAAVEHNVQVWAAAMPPQLYSEEEATDVET
FT                   TPELQCGSVVRLGSAWYRLVHFHLVAEVYVAVRISAPAKTAGSPIETDRSPGTGISVTV
FT                   KETRATDSHAAPDQRPIGKELMVEAVTDTEPQQDCSVGAAAPELPMQPSVGDGEDRIVV
FT                   ASTAAPTGPIAEAERNYVPCRNDAESCPLPISADNACLGEVSSQEYFVYRWRMTMLPRG
FT                   GDEARRAALGLSLCAPQVHVHGIRYADGGGITVLSMPLGYRAVPMSGLPLSLGSYTTLM
FT                   RVVLKAFSTMVARRTVHGNLSALGELFLAWPMVSEQSSSLPRVEEKQRAEEANGHVGAQ
FT                   DATRQPFMVLFHWERWVDFSMFVDRNAGRTIPFDFEDDTAPSVTTYGKDLLGSLQLFLE
FT                   HPLAAELTSEQYILLQKLIVIATEPTQVANYLIQMKNLMLSLPTDTEALHQSFDAAVMR
FT                   HAR"
FT   CDS_pept        complement(1131472..1133409)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2810"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26132"
FT                   /db_xref="GeneDB:LMXM.36.2810"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT58"
FT                   /protein_id="CBZ26132.1"
FT                   /translation="MRPSLIQCFPHPFTRQWPATSNPVTCECRQLYALVSVCCCVPNTH
FT                   LLVLHESAHLNTNLITSMPKGPKYVDFAITPRTTTEDLCGFLVRAEMAATGPPFAAAAG
FT                   NGGVVGASTSEEVSVFHASPGESLHEELAPTAVPTSASQTRNQSSPPSRSTVAQRQVVV
FT                   VCLHGIADASAAVQLALVDLLMFEQVRNHHRAVRVPTLRIVAFCSSRNYAILLPEPLRA
FT                   LFTLSTYVSTLASDSAVVLQTATATSSSIVNKRFMLEVMTAPDGQSLLETVTLSGTVTR
FT                   YLRHLLLVVRGSFAAGMSPGALALRRIPRWMTILKALAILFMPDEELLRSRLPQTRSTL
FT                   LQSYSRAISSTTFERTMSSTMHRMGTPVSRSMSPETQAAYQQPRGLQSVGSDERRPVDH
FT                   TAAATVESGENSKSGGGDNAEIKSFSHVVVSPSDIACVLHCLVGHLMTMPREMVPSEAI
FT                   LSATSTMMGNAAGSGSLVEAYGRMLDVHRYGKVGLSLQDPAMWDAVAASWSLRNLHGIA
FT                   NPTTDLANGLDSSLVSHSTYQNYSMTLGSQESAEAIGEADPGLSRSHGARYGGNPEQDA
FT                   LAASSHAPHEQYFQTLNNRPFFSVAEAWKWTATNKFSILDVASTPMLNYWEVREAMRAT
FT                   LLCRSAPAPG"
FT   CDS_pept        complement(1134867..1136666)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2820"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26133"
FT                   /db_xref="GOA:E9AT59"
FT                   /db_xref="GeneDB:LMXM.36.2820"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT59"
FT                   /protein_id="CBZ26133.1"
FT                   /translation="MFFIYPTPQYPRRALEFVFKSLYMLANTIHLMSLVVLLSDFHIRL
FT                   SNSMPSYYTNRDLVISDAILLVMEDCTYNGSIRLGNVRGTVEVTAGNIGYGLMTTAQYV
FT                   TGLFVLEFLLLVNNLLVAFNYTKGNRHLRIFGVHVPLYHITVMMTQVYSIAIVVLVWAF
FT                   DGNRQLFQRALQHCAEEMRKTKYEQLLQSEFDGYTIFSTAVYWPFAATCAAELIYIFGL
FT                   IFLCYFSNDEGIILFSEADAPWESRGFLCNTSKPLLRLHTAQRNAIIEDARNAIKEGQK
FT                   VRIVRSYQLITEEAFEALVQAMREQVARALKEKQFEQMKRTFGDNESQLDNMGFAWREN
FT                   LMASPPEQVSGGGVGNGLGNTFEAGPADQFFNVPFEDYFTDNGGAVGRSEVICSVDPLS
FT                   IQEGGFGDDGTFGIDDPSYGDGNNGLMLDHADGGGETIDAWSPQEDASMMNTVGEIYDP
FT                   PQPQQHTQHVSHTKHRSRHRRRRGDRAREDDENYQVEPDPRDPSHQQQRGYGRSDLDGG
FT                   DAYTSQPNYFDANDDMVYVANDMGSGRGAYASGAGPGGRLDGTNGNYPLSTRESRQRQQ
FT                   SRGRQAGLEQEDDVADALSDELG"
FT   CDS_pept        complement(1137527..1140793)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2830"
FT                   /product="putative pre-mRNA splicing factor ATP-dependent
FT                   RNA helicase"
FT                   /product="putative dead/h helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2830"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26134"
FT                   /db_xref="GOA:E9AT60"
FT                   /db_xref="GeneDB:LMXM.36.2830"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT60"
FT                   /protein_id="CBZ26134.1"
FT                   /translation="MNVVGDAVAAVGGDDDAIAEQQDMSFLMKLQELYCKSVLYEQLEQ
FT                   MMGHPATQEESDDYLDDVEGLVKLYCSEREAAKKMTPQGEEADAAAQREAVTEQHILHS
FT                   LSVAINGEAEADEEPDIPMSSIQQLYHVLHDCLTTDTVETGLAVGSLLLADDAKRSAEE
FT                   AARLAYQQQQRHMHGGVDTTSMNTSTAERKNAMKVSPEEMFRLAQHVRSGLADEAELLK
FT                   LRSEDNEEEGGGAQDVELNDEEPRFLRNMGFSSMLHRRINYRAPLPSQLLRDARTPQHR
FT                   QAILDRLAQRQQGDLSKLNSMEAVAQMQEKINMERRVIARKAQRTQQQSREYDFGAIMS
FT                   GRDDRSVLDEDRYGRRGGALESEEYSTQPTLLHSELNVLPEESGFRPQDMPTKLAPWMK
FT                   HSFGHKPRFGLPETMQTIQEQRISLPIYAKKEALLNFVDAHRVTVLVGETGSGKTTQIP
FT                   QYLAEHGYADRGVIACTQPRRVAAETLAMRVAEEYGCRLGEEVGYTVRFRDVTSSLTKI
FT                   KYMTDGMLLREALLDDSFQRYSVIILDEAHERSISTDLLFAIVRQALRKNEVLKVMVTS
FT                   ATLETEKFCAYFGASEPFRIEGRTFPVETYYLTDPTTDYVRAALQTVMMIHLQEPPGDV
FT                   LVFFTGQEEIELGGEQLFRWMEMLRRQVSTPLPDLMVLPLTATMPQEVQSKVFEPTPPG
FT                   CRKVVLATNVAETSITITNLYYVVDSGFCKQNIFDAKHGIDQLKVMPVSQAQAKQRSGR
FT                   AGRIGPGKCYRMYTEKQFTTDMVSETVPDIMRTSLFHVTLQLKAMGLDLLNLELMDCPP
FT                   KGAIVSALEKLRYLEALDDDGLLTPLGSRMAQLSIDPSQSKTLLTAVDLGCSEPVLTIV
FT                   SMLAVQKRGVFYRPRDQQDASDAARRQFMQPEGDQLTLMAVYDAWVENGMSEDWSKHNF
FT                   LKHRMLVEARDTRDQLKEMLARRNQHISHENDTNLDQVRKSITAGYFFNAARRVDSHTR
FT                   SYVTLSDRREVYVHPSSVLIDDPPKYVLYDDLRMTKREYMTELLAIEPKWLVELAPAFY
FT                   ARPKDGRLTKEQAAERFTPILKSWETGSSWRISRLKKQRR"
FT   CDS_pept        complement(1142481..1145918)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2840"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26135"
FT                   /db_xref="GeneDB:LMXM.36.2840"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT61"
FT                   /protein_id="CBZ26135.1"
FT                   /translation="MGSAPSVQDHLQKWETALGELEQLCSVNRRLMGQDRIYGSGVALN
FT                   DPHRTTDDEATSDRGGARRPSSLVSFSPTATAVTPEGGMGVSAGSFHRLNRNSASTAVT
FT                   APIPESRTGFGFTAYSGAPGASTVTTLNFVQGGATPLPGNATNDATNRSAGSASVGQQQ
FT                   SKHTRQQVLEIRKARMSLFRSYETENPDALTDLMQCSHFGAAAVALSYLLGGDANCKDR
FT                   RRRVTLEDIFFATQSPLHMLHSGSPHLPIMTGIIREFLDVDNRFKGDYSLEAVHLDVSP
FT                   TMGQVELGPNEVGDRQTRMQLPEFQRLITQDCEEETQAIRIVNYDPYVLEQAMLVDAFE
FT                   DEDELNSPLATSVLGPNPHHMERQYSPRNEGAYAVVVDVRNAVQLMVTIAEGVVNDSLH
FT                   VKLKEVPVASLFKAMMTAKEGHRAHGFIRVFKKELNPEFTTDEIKTFWTPELLSGKVLG
FT                   TTQLGTNAVAISHHISPHIVGVAWAMHLLAGVRPGTHGYGNGLPVSDIIRTMKLPAEVF
FT                   VDGVLPLEQVYEYAAGYVQRSKRDVDVHLYPVLTKIFREDAVPTISVFDLESILINVKD
FT                   ANVDPECPEHVMVIMYNACVAHNVLYIVEEPQWCVLAGYDQEMQTAVLIDAHPKTFSHT
FT                   WSCPLDRLHKAMTGNGYLIFSKRGTNPASRRVGAPATMAPTVESRLELVERQHELNSSW
FT                   EGKTAFAVPKAFTFPSLPVMPTMVAMTCTRLGVPTTFDDVVQRLPFEISALVIRNLTLE
FT                   IMHVCLTQYLRVVGLQDEVQVKAYHGESNADGLLTLQLPQLEELIQTSLDGNHLLLLHF
FT                   DASHLLVNGASHPFGTLGMVVGYDAGLGSVRVADANPNSFLREWSAPLLEVFESVLDSD
FT                   VTRKQRTRGVLRVSRAAAPSAAAGPVFAPPCSRPFRLELLPVLNVFLVSPSPHFQGMSF
FT                   AFSQLGYYYSPEEIFYEAYLKTMDDQRRRGSQAFAWRDVEVSLSIINKKIDASFMAEGC
FT                   RKFLESRNGHQSGTQETISVQVLEDIDVDEELDELLEKSTRSSDTVLLLNYDVLRTHQL
FT                   SNLGRSVAIVKSYNKEKQLVELWDAEYAVFGLSFVVTKQQLVEMGDLENVGSSPYGFVQ
FT                   FKRVAAGAAPKKLGLMSAPSTLEEEAELEAAATAAEVR"
FT   CDS_pept        complement(1146826..1147104)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2845"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2845"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26136"
FT                   /db_xref="GeneDB:LMXM.36.2845"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT62"
FT                   /protein_id="CBZ26136.1"
FT                   /translation="MSTVAELQAQLDALRARNAQEVEAAKATLTKLQQDLNYMQEDTEA
FT                   LSREEEALCKQFGKGRSTDTALSTSEHTNIIAQVLSALVECDDSKCC"
FT   CDS_pept        complement(1150644..1151426)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2850"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26137"
FT                   /db_xref="GeneDB:LMXM.36.2850"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT63"
FT                   /protein_id="CBZ26137.1"
FT                   /translation="MFRMPAVKKPFSSHRLSDTQKSIEDGAPSPYVPATPTSVTSVTFD
FT                   WAHACPIYTIKGNSVWHKGGGELPYRPVIGDLAMRPNTGKYLFSYRINTDNSRVGFCTS
FT                   CVYTNDEDLQNIEFGKAVAMDAERSEPLLDQNLAQPSFLQAIGAVPTPPSKPWEAYMDL
FT                   QTSKVFVNGVEKHSFWRLFVPISGGVASFVVDTNAGAVQMFMNGKYVGMMLDEQSGLKG
FT                   NTVYPCVGISGCDMANRSIESGCMGAFVEPAHAFECLY"
FT   CDS_pept        complement(1152861..1153274)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2860"
FT                   /product="40S ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2860"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26138"
FT                   /db_xref="GOA:E9AT64"
FT                   /db_xref="GeneDB:LMXM.36.2860"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT64"
FT                   /protein_id="CBZ26138.1"
FT                   /translation="MVFQKKKAEVSIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQL
FT                   IRKKLAVLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMGFG
FT                   KARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
FT   CDS_pept        complement(1154125..1154538)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2870"
FT                   /product="40S ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2870"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26139"
FT                   /db_xref="GOA:E9AT64"
FT                   /db_xref="GeneDB:LMXM.36.2870"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT64"
FT                   /protein_id="CBZ26139.1"
FT                   /translation="MVFQKKKAEVSIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQL
FT                   IRKKLAVLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMGFG
FT                   KARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
FT   CDS_pept        complement(join(1155351..1157443,1157545..1160437))
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2880"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26140"
FT                   /db_xref="GeneDB:LMXM.36.2880"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT66"
FT                   /protein_id="CBZ26140.1"
FT                   /translation="MHSGNPRRTVTKMMEVSARKERREQRRRALGVDCADRLTWKEWEP
FT                   GKEYKRKILVKNVERASQTIQFSLPVNRKTFITPFPEPITLSSGVSHEIAISFRPTEMV
FT                   ELHDAVTITVEGRGSFQVRLDCLTPYAKLTLQPSHDFGYCAVGSTAHAQVQLQNSGTAP
FT                   VEFSWEVSGPFCILPSHAVLDEGEIMHITLLFTPTEGCTMVAQALCRLTGTDDVIAALK
FT                   ISGIGKYPYICFQEPSAEERTLVVQMEAQQNSGGSSGCKLIHLCNPSPVPVSVRIRRVD
FT                   ESLMCAFRFAVEGKVAVEQDDSNGEGAFLVPRGAVQPVRIHYTPGSPGVIDFNTFQIDC
FT                   EHGNSLQVELSGTTLGPRVTASISSLDYEAVDLEHMPAEKQRTRHLTLRNASTTDAPFT
FT                   WMNTLPGAAFTVVPHSGVVAAQSSLQVAITFRPTHPILYYRRLYLLIEGAKDVVGVDVL
FT                   GGAYTSSLRPPTLTLADVEAARLRMERGLGLLTPEELTTVAAAAAAAEDELIGSRQEND
FT                   QRGGQRSTVPASTLEIWRRIQEDVCSPGVVMSGAKRKVRVPLSNLETANGSVSIDTPFG
FT                   VDAKPLYTFGGGGKSGSDMRGHLVTVMNTSNATAVATWSLPASQACPYAVVPTQQVVPP
FT                   NGSAIFQLQFNSAVSNELPAACTLECYVNYESMSAFYLAPDACVVPPQCFTVTCTSASV
FT                   SVLTSAKQKLKHQQQSTSNQISYTRQVCLPACRVGGSSYQVIALQNKAATPVRYEVTGV
FT                   MLKQVSAVVLPPNMKRVAPEREALTAAVEARAPQQEASEVGEAVFSVYPTAGVVPALGR
FT                   QLLVVKFSPGDTAQYAASARILWDANVLHSTISPTSSAALPTAADTTHLNLFGEVCLPQ
FT                   LQWRQVGEDATVPPSMITLPPSCVSGESQQRAWVRNPTALPVAFRFDTSAELLGALRME
FT                   PEQGVVPGGARLPITLFFSPQQPRVFHGYLQLYVPMLVHAGKSGTAAAVVPRLHNSRGV
FT                   LPARTHTTVLVAAQPAPGLTEFLVYAIVSGLSTNLANVPNVPTAEEAERHPHCRWRLRA
FT                   AHPAVQVVDVDLPGVARPLAWQQLSLNAINAQLATAAAEPEDSDNSAHASFQHYVSGLD
FT                   PISVDLGVAHEGDSTVCLKVSLKNTGDCPAPFDVMLPTQHEANRERWCLENTELESLYY
FT                   IIDRGLVTVIPQQGSIDVGQTVQLEVHYVHSEVGVHRLPMVLRVGRSWRRVAVVLEGRT
FT                   LPAEVCALNFHHQKVYELMPVALGDMEPPLQFITATNPFDEPVEYSVDLMALQEQAREH
FT                   YGFPVFQCVDPRGTVSPRGTVHIGFYFRPLEAREYRVSVLLQTVQGEGYYVDLVASGYH
FT                   PRKVTATSVMQWIDHALMQVPAVPPTLAARAHAAFLSDDVCRLGAVPYFTLCRRTCTLQ
FT                   LAAGCPTAMRYTWHLDRPQRGDAQVVVRPSEGVVEPGKQQTLKILFYAGSTSQVLERLM
FT                   TCAVVPCAAASDGEEKQHGGSGSRHGRRTRATPLPSLNSSSDGGSSATFLSLLLQARVM
FT                   PRDDYEALYGSEKLNTTYTPLLYNSHVDPVSSTLSPVASQTTTSSATATEVCFVKGVMD
FT                   ELIRSLVAAPAVQSSFTALCAPRHVTYANMRVLHAAKVTNTEAVPAAAAATLSRGNASS
FT                   AVATEEVLEELLCSALAEAVAAV"
FT   gap             1157445..1157544
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1161860..1163902)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2890"
FT                   /product="putative ATP-binding cassette protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2890"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26141"
FT                   /db_xref="GOA:E9AT67"
FT                   /db_xref="GeneDB:LMXM.36.2890"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT67"
FT                   /protein_id="CBZ26141.1"
FT                   /translation="MSSPAPPTDRADAGLLHHLPHSPAESSAPPPASSHHKVVLTWEDV
FT                   SYTVSGGDEGGSRTLVRHVFGYVQSGEMLAVLGPSGAGKTTLLDILAQRKVKGKGDITG
FT                   RILLNGEPVDPAAFRLCSGYVQQEDIMHSYVTVEEVVRFSATLRASPTFSEEALESRVS
FT                   QVLRQLGIYHVRHSCIGSALVRGISGGQRKRCAVAAEMVTLPSLLFLDEPTTGLDTFTA
FT                   LHLLTLLRSLSRSGVAVVFSIHQPRSRIYEVFDRVLLLNGIGEEAYFGPADDAVRFLAE
FT                   IGLSSSYSNNPADYLIDAVSVLLVEREEWRSEEAQQSAAVEATTNGNQGCLSSPSVDTE
FT                   ERWEQLPSVAPTQGRDIAAAFASLRLADVMRQIDELQRSSRAATAALTATESQVRAYHR
FT                   SWATQVRCIAMRCLRNRRRDPVATYVSVTSAIVFAFLTGTIYYQVGNSQDSIRSRMGVL
FT                   FFILMISTFSSLGSLEMFLTDRAIYAREHRNGMYSTSAYYIGKFIQDAPVAVVINFLFN
FT                   LIVYLLVGLQRTVVKFLIFDSVGALVTLNSYALCLFMSSLSKNYATANILTSLLLVLYL
FT                   LPTGGMLVSLNSIPLMWRWIKHVSFVRFAFSVMVANEFDGLTFVCDPVPSDIAPCITSG
FT                   TAYAASQGMYTKDIRSHILIVAFSMAVYLVLGYLALRGFRSTEGK"
FT   CDS_pept        complement(1165090..1167657)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2900"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26142"
FT                   /db_xref="GeneDB:LMXM.36.2900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT68"
FT                   /protein_id="CBZ26142.1"
FT                   /translation="MYTSTCAASECVAASIRWLDYASTTLNPDRLPEHAVHLDELLDLL
FT                   RSAQPPPSTLQDEWSTQVWAMAGEPYLVYLLRCLAHQSGLTQLSPHFVVPSTEFDSDNG
FT                   GAVAAVTAGNPAKHPSRLFWERCVVVGVRVEPTTKNLLQTGWETQPCPHCVARDGAAAD
FT                   VHDVPGRRSQPCVLPLLYGGTQCDECGHALPLVPTWTRVLYLVLQRFDRSRAAAVAYGE
FT                   EVHRHLWLGVTIDALLYTSATEQQQQLLVVHAAAAPAAAASSTTLPCAETTKGAFHIFC
FT                   QDERVSRLALKWGGGTAFSAAANLHDVARRVAPQLQGQAYAKGLLLLVVLYIVYHASHP
FT                   AAVGSHRYPLHVLLVGPAKTGKSALLREVAQLIGLEAEVLDSTVVRTGGSGGAAGGSSF
FT                   SAALPMRRSAVLMAGSGMTASTLVLDQLPSTAAGAAAMAPLLEAMERGHGCGAASDEGG
FT                   GAVAGGLDVYQLPSTIIAATGEESAAAVQLVPYFSLVAAVAPTNSLDDTAIISQDVVAA
FT                   SRARSSHSRATSRSTSRTTQLSASSPHHSQRGPSVPQSTSHRTDPSALSERLTHDDVRY
FT                   LARRAAEPVLLNSVVSHAVCYDAFIDKLVDCAGLLEETQPSVCRALPPPSACRGQRHIG
FT                   HPSAACDSLRAAPLAIDEHLRILCALSRARALLERAELLCDAGWTAQMRDEVWALYHGH
FT                   LVAFADLMQRRSCGSGAMAPREPAEVLRTASCPSSFFVACGGSTATPAGYPSPSRFSGD
FT                   AAALGREWKGGVCAMSSREGRGLWHPQKTPSKKRCRLMFVDALRQRQRLSAHMESAVPP
FT                   SEVEHLFGLLGGSSAFGDPLDVVISQMQEEGLLLRRPGGWRSL"
FT   gap             1169133..1169232
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1170042..1171082)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2910"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26143"
FT                   /db_xref="GeneDB:LMXM.36.2910"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT69"
FT                   /protein_id="CBZ26143.1"
FT                   /translation="MLLSARSIAFARHTAALWTSARRFGAGPTRLLLGLEQVQDVPTST
FT                   DRKPTGMHRGPGKRQTAPKEAAQYQFIKKWDLQMRETWDELEPFKGLPKPKAQFGNEAA
FT                   EVIWPYALLLENVIKVHPYTKSIYVYYSQRQSTPLGELAARVAKRVSQAYLIPITFHNS
FT                   HVYVEAEMLLEYSETPWVVVHCLDGTHKLIPVKPQAGQTVKGGAEELLNGIVSACNEMG
FT                   SAVKNPKEVMRLLSERPLQNQYVRVNYQWYGDTPEERMSHLIKWDYEPEEVVPQLRNRT
FT                   QHVLDWMNYDGNLPTHNSVRVNIRREAARMRKPNVSAGPKTFFNSSGSRANARTARFNN
FT                   SRSPQS"
FT   CDS_pept        complement(1172019..1172360)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2920"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26144"
FT                   /db_xref="GOA:E9AT70"
FT                   /db_xref="GeneDB:LMXM.36.2920"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT70"
FT                   /protein_id="CBZ26144.1"
FT                   /translation="MLRHSKDLQMCRKTAGTALGYVCRLHEGRCVICDLQFSEIVDTMR
FT                   EAHLCEDCSVLAAEGEEACIMCGSRRVTDVAYYCPYCVALEKDRDGCPRVLNQTRQQRL
FT                   AALRAAVSQ"
FT   CDS_pept        complement(1173852..1175459)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2930"
FT                   /product="conserved hypothetical protein"
FT                   /product="predicted zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2930"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26145"
FT                   /db_xref="GOA:E9AT71"
FT                   /db_xref="GeneDB:LMXM.36.2930"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT71"
FT                   /protein_id="CBZ26145.1"
FT                   /translation="MYATVPILTLGPYSLALVAGLLLYWNTSLIVSRVLTAFIVSMIAM
FT                   KVDLAFHLFFSCCHRVVSLLCRFRTFWSPNDSLDFLQTQSQFYSIADVVSLALLVGNAM
FT                   QFWTAALVTRIALSALATRTELSIRWWQSQSTAEHALFVLGSLLCCTGCALQWAYYTLL
FT                   PTEERTQGGTGSLLMWYTSIVYIVEVGLRSACTLATTVMRMWGYRVLKSLASQVDHISV
FT                   RALEDSGLNPFSEVHDLYMQYLYAVACAATAWYYTSSSTPMWMQCFMLVRLYFITLASG
FT                   KLHYYRQVLDRFPSVTADPTKTCGICLDDFVDGENVKCLPCGHTFHGACVRSWLIRAAV
FT                   CPTCRQPAAQSRHHHFAAAHHERISRQPQVSLDMRIPAAGGGFTGSLQPLAPRLPAAAP
FT                   LARASSQYISRSGAETQSQSPSLPVELRRLPHYEELQRVDAKRRSLALHRQQQLISEET
FT                   EGRVREQSAAIDALLFTETPLLPAESTSLPPQHGTSGRRKRQRPPPESTAGSVTSARHA
FT                   AFSGAAATEDVSSRRRME"
FT   CDS_pept        complement(1176569..1189096)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2940"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26146"
FT                   /db_xref="GOA:E9AT72"
FT                   /db_xref="GeneDB:LMXM.36.2940"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT72"
FT                   /protein_id="CBZ26146.1"
FT                   /translation="MDEVINVISKCITQLDLFVNGPAAHLTGTAAPTTIDTIRKCIADH
FT                   AYLFTDHQINGQRVWELVCSATFTVGEPRAPTTATTATLLSLFYRLTDLVAASARAPEA
FT                   GILQHLVRLMCDAVKPPLVRGASPGQLRCLFEAAMRLLKILLPLKKHADVQTECLHLLL
FT                   ALMQLSDVQEAHCAVVASGDEVAQVAKLCTDICGAKYDVALRPQNASMQLLGGLCEQLA
FT                   YVHALSGQLVERILKCFLDVARNLAQRAEVNQTLGEGLLRGLAGFLGRFPLRCEEDAPA
FT                   LTLINNIVLSALMLGETSANYTFCLSALFLLRRRASDTLAPFTLVCAAEYSAALRSLWM
FT                   HRNKDVRRETHAAAAVFWSTLSSQLQQHWSSEVADANNTRNTDAPHELHSIVEPLLQSL
FT                   DSSADREASYALEALYHLLPAVAALSGPQTLQTMSTRLEERVGALLSTPSAQRTEALFQ
FT                   QVPYLLATLGQLLTLLPSVSPRQQAVVRELLDRVLLLYPHPKFYNREKIVPGIVLVTRA
FT                   LTHHPRAPHNTLPRLLSERTLELVGEAPGAAMMRLAGERISSEERLDRMATLWTRLLTI
FT                   HEESGAEAEAESKQRLSAAFYRACTGFCEQARLEVVVVASNSEATLERILVDGVDGVQP
FT                   SFPTHYSAFLSFVDFFVRLSEGLKRSGRVCHPPAEELAAWLEALVRGASAEPHVSGFYT
FT                   LLHRTVVGEGMCPRSLTHNQPSANAPLASGTSDVTSDGHHENHPCVSPVLRHFLCTECP
FT                   RRVHVYSDELLYQCAMCVVVGAALVGREERGAVAGSRPGACNDNRRLDAYVRAFTVVMS
FT                   ATPTSPQAESTTGSTNEVVRSFGNSPAMLESNGQHALRVLEKKASHSPRWAAAVLPALT
FT                   SALRSAEAVAAVRAPVQMLSARHGVTIAAELQHHSNKAIFALLCKGERASNSRRDSMPR
FT                   WLATMQPVTVPLVPVDSALHIGYLVPLVSRLSLHGKQPAVRTAAAEVLYWCVVWVMGKK
FT                   ANHWGSAVFPPLLSLASLARTGTGSSSGGCGSMVHQELHGLLMQTARWFGRPAGTPEEA
FT                   ESFVLVLLRGLGEREATQRQVVTEALFAYAIPPADEPQTVTPHFRAVIRHLVMMECGVC
FT                   EWSRLGAAHCLHVMMRRLCKARVPGLACIVQAVAQGAVGCLRRCTEAPLWGAVETATGN
FT                   EVQESLRWLGACCRDMRRLENEEEQREADQVAADLVHAACAVLPALARRHTACAITLLQ
FT                   TLPAVTHMSANAHQVLLFSQELIREQQQRLGPAVVRSLDSVVGGCATLVALLQSGYCTE
FT                   NNKRATAEAVPSVIYARADDCSVDTELLRLLTVVLQAIVEEARVATHESRCVSPRLVRW
FT                   LLELVDVVPEQTHATHFSLLLTPTVIAQAARVMVAGAKGTVVKWAGDVGKDATVDVPLR
FT                   RCAPSSRLAPTARGCLELIEFLVRVAGQRCRVAQVIEEVLCAIQETSVFDVFTAASPAR
FT                   QLIDALSVGPSACVTGPVALAAALCQTEVPCSSGTTTLWMLIADSMKISPKMVVTMLLG
FT                   LLQNSAALNATGGEGVCEGLLVLIFSEPDPALLREHLRDLLASDAVQHHISFTSSSFAV
FT                   SLDDDDGAAAVPPSSRSSSVLLSRAFGSAMNRCWQQASAALPTDRLVSALPSLTTVVLS
FT                   EGALRSSSEAVFLFSFVGDWLAELQRRSLTSEHDKVLCCVCADLVAAERGLRKSTPAEA
FT                   QDDGRGSARLTALLMVVQLIGPAIRTDPTLSSALCDLVLVVSKPANIYSLLASVDATER
FT                   VGWGFQVLTAIVTPRPVHRSLAVFPVDLKTVGVAFDFLNEVLNNALPLWWTELKTPQEK
FT                   TNGADVVQSGTALFAAVLPHNVQVLEVIAPLLAKESMPQRDTIVREVHGALQALSACPQ
FT                   ALQLDACRCVSCLLRDPRTHPGICDALTQHVLLPLLQASAEAVRLRLFEEEVHNWVTEA
FT                   GRAPALGCFCVQTAVFSCLALMHRLCPLTNLRGSINTAFTGRNPNTTGVELTLEVLKAC
FT                   RAAWQPPTVGGDDNSAGEADGDVGDSARADAPRRYRQAAFRCLLATLSQTQQAEKVFCR
FT                   CLFHERSVAGWNGLFLVKRRGVVVTDLLDAVGEVQLWRDMDRCQVPELFAHLLRYFPSS
FT                   SVTPGEPPEWVRHVVAVAQQPQLRLPVRVVFYEMICRHERFFGTFARRIFDGVADSVAA
FT                   IAPSERAGKTIWELLAILTRWHRKGGSGAFTVGSAASLKALARYAAFHLAWKHSFTAGE
FT                   GSRALDPTSHERLAELLEQIRRAQGATPASLSTPQPLTVAEVKMLLSHPAYERRAALEV
FT                   IYLITNACGCLGCTGDSREVVEVYDLLGAFLGASASPQLYRITARLVGLEHRLLGEAAT
FT                   QEPFSAVRKLLRDALRGTVCATLAVCKSDKMFLEVLEAMQEDRSDDLVYQLLSRTDLLR
FT                   RYSIRKDSEKLLTLRVLARAGTYVADNYDSIHVCLSGLLRGGHGELLLGICTVVRNALP
FT                   HLSMESVHHVLRDLCCLDVLQAMESAEPARVAFYKMGLAALQRWTIVRENQEKQDGGDS
FT                   VSADAEAFLVRCGLRDVSPAVQGAVLEFLDVHAQHVPDSMWGRLACLFTAEDGASGDGL
FT                   SGSGGWVRHVAFLLLSLSKRSCNFANPTYFFPEALHSEGSSPTLATSADTAAEGSVARR
FT                   QRRSAPLFSEVVQCGGPAEAATANTACPITAALARIYTPSALVPRPPQHQQQPLSGARR
FT                   PRATGAWQLDAAPCATAAAVAQSLLHMESGDSEQENAVISTGVMVSCQISTTMQLRDAH
FT                   GAALRAGPSVINAPSAAPLLESNRAGRFSEVRLTLQSLLVPLQVLCLHEDEVASRVLID
FT                   LISNPAVASPATSESPHTVSLCSAFASLLPLFESGATTRQCEHAKNPFTLFVALELLLH
FT                   AQAAGWPSFASLDCAALVRLTGDVQACGGTVPTVSLPVADGTAHVVERLLSSPQPSTAR
FT                   GAPTRPCLAFPTLGWHAYHVAQRLRRHDDAACQAALRLVKATGRHGAQVIQLQGALGGM
FT                   EVGGAAYSVRVIAKLLEDEEKEAAAAAVATVAFPATHVSGGAFTLFAAREEVLRHYRSR
FT                   ASRLLLDWCGAASALQSGTPAGAGGSGEVSVEGARLRLRAQLQLMCDGAESAVTAEAST
FT                   ASRHRTGFEWGACLMANGRWLDCQLHVETSVDHLLGSTTSHYDGGGSSLACGYLAANSL
FT                   SQLADAAQVLRLVSTSAASSAGVALQTYLDAMPASVPLSGAYGPLFIDDVLLIRRLIID
FT                   YHVQRTGDLSGSLQLTDNERHKLVARIHELLGTWTVQQCEELLLLPEKTSAIETIASNA
FT                   DHATLSQPTRCALEFLKKRSSLFCIAVTPGEVSGTSREEALAAFQKAMGKDVQQRAVAG
FT                   LLSPTAARQWAADVAQCEVEMLASIGSILSGSAESTASAQKREMWVSTLKENLQDTIPS
FT                   HVTLLNALEKLLPPASRGDGTLADMCGDAKDAAHASSITAATQSLWQLYANTFLWCAQA
FT                   AGDRNMEGDSGGHLPVSARVPRLLSLFALPRVAEAAAKAQWRGTWEALVMLPTPVWLPW
FT                   ATLLVNALLQTEHAVLARILLRLCRERGQVLYYPINCAWRSLADLGKRRDAGRAINDDL
FT                   TRELAELDKWHQSHRMALVAEFAAALDELVEPQHRLEVRLSEVELLVKQHEQCTRGGAQ
FT                   TEYLMAALQLYERCKGDLMDPARWGRAQLYHRLAAQVLQELDGRNAFSTEVLKSGEQFR
FT                   SAKREALRQVTQTLNTFASSASNSATTPQELRLYSERLPRALWRSATAATATTQPGYTS
FT                   DAAEPILQPAQPSHLLHTPLDAAQQCCTLVGVADRVLVLKSKRLPKKVDMYTSAGICTY
FT                   MVKGGEDLRLEQRIQEVFTFANLCLIASPRFRLSALTIRTYTVIPVSPRVGLISWVPRT
FT                   TPLQELMKEATPPGAHDAVARFCRARGKPQDILPLYKTAHITRIPEEEYKNLVLCLRQS
FT                   ALVESLESIATDHCSWFGVRDAFLDTNAAASIASFVLGVGDRHAGNLLVDLLNCEVVAI
FT                   GFGLAFGDATRKLPVLELMPFRHTPQLQRVQGVLGDDVTRCRMRRVLQVLRAERHVVEG
FT                   MVAALLMPDTDAIGDEARRIAGHQLDVVRRKLNLEHPADIILRDVARNAYVTQDKDVWS
FT                   GVKACLCEGKREENVEDDDLTETALSTLHQEDVFVQRLLRIASDPRVLGRAHAGWQAYM
FT                   "
FT   CDS_pept        complement(1192604..1193845)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2950"
FT                   /product="succinyl-CoA ligase [GDP-forming]
FT                   beta-chain,putative"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2950"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26147"
FT                   /db_xref="GOA:E9AT73"
FT                   /db_xref="GeneDB:LMXM.36.2950"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT73"
FT                   /protein_id="CBZ26147.1"
FT                   /translation="MFRFGRLCTPKAAGVQRRFLNIHEYQSKQILKDNGGRVEFGIACK
FT                   TIEEVEAACAKIKTEKKVVKSQILAGGRGKGVFKDGFQGGVHVCDSAAAAVEAAKHMLG
FT                   NTLVTKQTGPKGQLVNTLYVTEAVAGIKRELYLSLILDRKSASPMFIGSAEGGMSIEEL
FT                   AKTHPEKIKTMKVNVAEGVDHDAAVAYAKELGFSGETAERAAEQIKAIYNIGKSKDCTM
FT                   VEINPFVELENGDVMEIDAKLSFDDNAVFRQRGIFALEDQTQIDSKEVLAKKHDLNYIA
FT                   LDGNVGCLVNGAGLAMATMDTISLHGGSAANFLDAGGSASEAQIVAAFKIITGDANVKS
FT                   ILVNIFGGIMHCDVIAQGVVNASKVLNTSIPIVVRLCGTNEQRGKDIIRNSGLVIHPVE
FT                   DFDSAARKAVELAK"
FT   CDS_pept        complement(1194599..1194997)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2960"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26148"
FT                   /db_xref="GOA:E9AT74"
FT                   /db_xref="GeneDB:LMXM.36.2960"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT74"
FT                   /protein_id="CBZ26148.1"
FT                   /translation="MLAIQWYTVALILADAYELLQLRQANLKGLTYDTWWLDSRANAPL
FT                   AVALYAGLLVFLMLSRLFVLLEPLNRWLLMLNTIHEGIRLVLYSLLFTQHSGATQLNTI
FT                   LLTLMLWNTLLYGRQYYITMCMLREHSK"
FT   CDS_pept        complement(1195765..1196280)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2970"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26149"
FT                   /db_xref="GOA:E9AT75"
FT                   /db_xref="GeneDB:LMXM.36.2970"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT75"
FT                   /protein_id="CBZ26149.1"
FT                   /translation="MWDLSITRVFQAYCAGAVLFEVPVIVRLLSGDMPLPKAGAWVDDK
FT                   DYYTNNKPLVYVFVAMLACLVVSRGMACALPKSRIIITYLVVVHTFEAGLYLYCCSHKE
FT                   DAPNSEVYIMGTLMVMNIFLFAARLVQLKTQLTRAEIADLKRRQEQLAIIRKKRADYAK
FT                   NKEEKKNK"
FT   CDS_pept        complement(1200163..1200876)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2980"
FT                   /product="conserved hypothetical protein"
FT                   /product="predicted bromodomain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2980"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26150"
FT                   /db_xref="GeneDB:LMXM.36.2980"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT76"
FT                   /protein_id="CBZ26150.1"
FT                   /translation="MDVSKRPREELHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGYY
FT                   DVVETPMDLSTIRKNIEQGKYRTDAEVENDVVLMLSNALDFNEKGSQWHDLAKQLKKRY
FT                   LTLARESGLSFDADQAFIPTKKVRDDESTLRKAEKKGEEKLEDVLQAMEKDKEIPLEQL
FT                   RAMYARRTTKGKADQQSSDYSSGTGNGDRDEEVFSDEEGTNDSGSSSSSSSYGIEEEED
FT                   SLDSESASKDDDDDE"
FT   CDS_pept        complement(1201694..1203157)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_2990"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_2990"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26151"
FT                   /db_xref="GOA:E9AT77"
FT                   /db_xref="GeneDB:LMXM.36.2990"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT77"
FT                   /protein_id="CBZ26151.1"
FT                   /translation="MLRRRWGAHRAKHRFVDRVKVLLCSGSGGDGASIMAHEHGNEFAG
FT                   PGGGNGGNGGNVLLQCVKQHTDLSHIVDLGSQISAGAGCCGFSREAHGKRGQDLWLQLP
FT                   LGTQVVDMDTNEVQYDMDEEGMQIVLLEGGQGGKGNAAFANKWHHSPIESTKGLPGNTM
FT                   LAQIELKTIADCGLIGYPNAGKSSLLSAISASKPTIAPYAFTTLRPYVGVLHDLYGNVC
FT                   RVADIPGLIEGAYENRGLGHQFLRHVERTKSLALVVDMCDTYVPNTGSRNSSDVLQPWD
FT                   VVELLLQELEYYLPGMSQRVIMAFANKMDIEKDSTGTATQVKLSELKRRVSMPVFPISA
FT                   ALGIHLGPQHEQTGLAPALQFMCGEVFARQSHEREMRQFRFSHERAQLEHAFRAKHNGV
FT                   FLPQVHTLGAHGVEVPQDLDDEAANGGGSLVDQQLDFLGNSGLGVEFDAYENSAARGQL
FT                   HRYRDLTMKGKYWNLTRKDGEVMKGEKWS"
FT   gap             1203439..1203538
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1204850..1207714)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3000"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3000"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26152"
FT                   /db_xref="GOA:E9AT78"
FT                   /db_xref="GeneDB:LMXM.36.3000"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT78"
FT                   /protein_id="CBZ26152.1"
FT                   /translation="MSDRREDEPAAKRTRREVDPAITFPYELDTFQKTSIDALEEGDSV
FT                   LVSAHTSAGKTTVALYAIAKALREKKRVIYTSPIKALSNQKFREFSDKFDSVGLMTGDT
FT                   TIKADADCLVMTTEILRSMLYRGTEMLREVGCVVFDEVHYMRDKSRGVVWEETISLLPE
FT                   GCQYVFLSATIPNAREFADWVESIHPTTKVHVIHTDYRPVPLQHYLYPAGADGIFLIVD
FT                   EKGKFRDDNFGKAIASMGTEGVANGVGAAGPANGSSKDPRGNHKGGGGRSHGGSSQSMM
FT                   EIVKLVMDRNMYPVIVFSFAKAECERNALALSRLNFNNTEEDALVMEVFNNAMESLAEE
FT                   DRKLPAIEHLHPLLKRGVGIHHSGLLPILKEVVEILFQAGLVKVLFSTETFSMGLNMPA
FT                   RTVVFTSVKKFDGEKNRYLTGGEYIQMSGRAGRRGLDRVGVVIAMVDEAVEPDTLKQLT
FT                   GGGADVLLSSFHLTYNMVLNLLRVEDVDPEFMMKRSFSQFQRLRDKPALEEKGAALRRS
FT                   IEEINLTHESAFRQYTICEDMIAKKRNEVDHILRQPKFLKNWVQTGRFVHIVRASDQLD
FT                   FGWGVCRSFAAKSTNPNFSDPSTFSIQAAVICMKADASNPSALTPCPVSEYTSEKADLY
FT                   TVTFDFSDVQSLSTLKTNLPENPDSERGRAEVVQILSKLQRQFGNSIPVLTSAQMGAED
FT                   AQLSKLQTQVSKLQKQLEDNILATSPTPELQEEFEQYKRKADLEAQLEQVKGELAGMSK
FT                   AVFSEELKQMMRVLRRLDYIDKDNIILRKARVACEITTTDENEILLTELLFKGVLNSME
FT                   TEMIVALLSCLVNVHRTPDGFSLPQEFEQPLKDLNEIVTRIATVSAESGLMQENSSVEK
FT                   VMPSLMEVTYLWAKGAKFVDLVSKTTAYEGDIVRMMRRLEEMLRQLASAARSPAIGSIE
FT                   LHEKFLKGIQLIKRDIVFASSLYL"
FT   CDS_pept        complement(1208147..1208605)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3010"
FT                   /product="putative glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26153"
FT                   /db_xref="GOA:E9AT79"
FT                   /db_xref="GeneDB:LMXM.36.3010"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT79"
FT                   /protein_id="CBZ26153.1"
FT                   /translation="MASIFTYSAVQNGKTVVLQKYSGYTTLIVNVASRCSLASANIEML
FT                   NKVQQAYDSRRFTVLAFPCAQFANQEPLNNTEIAQWCEDLGLLFPVFDRVNVKGSSADP
FT                   LFQMLRAQQGAPLWNYTKYLCDRSGVPRRKLEPSCSMDALRQSIECVL"
FT   CDS_pept        complement(1209433..1210173)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3020"
FT                   /product="putative exosome complex exonuclease rrp41"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26154"
FT                   /db_xref="GOA:E9AT80"
FT                   /db_xref="GeneDB:LMXM.36.3020"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT80"
FT                   /protein_id="CBZ26154.1"
FT                   /translation="MSRQKEYVSPAGLRLDGRRPREARRMDIAFGTLSACDGSCDITLG
FT                   QSKVCASVFGPRESLHKQEAKHDKALVTCEVAVAAFAGENRRNPQRRSRLSEDIGAAVV
FT                   QVARSVILLSQYPNSQIHIYIEVLQQDGNEKIACINAACLALIDANVAMRDAVCCIDAG
FT                   ILDEHMLIDLTNDELRSQCPVIAAAFTGHDTRNIIWLETTSRLPPDSATRLLKCAEEGA
FT                   TKLFETTMRKALEEHARKILALQS"
FT   CDS_pept        complement(1212100..1213416)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3030"
FT                   /product="clathrin coat assembly protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26155"
FT                   /db_xref="GOA:E9AT81"
FT                   /db_xref="GeneDB:LMXM.36.3030"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT81"
FT                   /protein_id="CBZ26155.1"
FT                   /translation="MLSVLMFLNSRGDVVLSRTFRAGNSVRSLAETFCSEIISTKQVDR
FT                   CPVNIVKHMCFIHLKLTELYVVMVSDSNVNCLMCLQYGARLLQHIQNDYEGLDEKRIKE
FT                   NFIALQGIIDESMDFGYPILTDAESIREFVTKDGVDAAVLKNTHESERIADRMTGETPW
FT                   RVEGLAFRVNEVFVDVFEDVNLLLSQTGETLQSSVLGRVVMNNFLSGMPECQLHWNAKV
FT                   MSHGITEAAGSNGVGGIGEVVPLSSISFHNCVRLKASGEERRVTFVPPDGKFTLMTYRS
FT                   SVNVQPPMKVLSAKAREISKTRTEVEFTLRSDTPAGRVAKDVQVSVACPDNTATAEVRV
FT                   GRGKANYDPVSHAIVWKLPEVKSEEEIAFFAEIRQIAPTENTELLWTKPPIRIAFQCVS
FT                   LSLTGLRINELVVKEPTLMYAANKWIRYTVMAGDYQCRI"
FT   CDS_pept        complement(1213897..1214253)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3040"
FT                   /product="putative pre-mRNA branch site protein p14"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26156"
FT                   /db_xref="GOA:E9AT82"
FT                   /db_xref="GeneDB:LMXM.36.3040"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT82"
FT                   /protein_id="CBZ26156.1"
FT                   /translation="MPDERILLVTGIPSKQCTSEYLYSLFGAYGGIQQIRIGSSSITKG
FT                   CAIVVYEQCEAANNAVGALNEYALSKDRVLRVSVYEEERDKKALERRKRKREMQAEYKK
FT                   HIADVAQAADEPTE"
FT   CDS_pept        complement(1214850..1215278)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26157"
FT                   /db_xref="GOA:E9AT83"
FT                   /db_xref="GeneDB:LMXM.36.3050"
FT                   /db_xref="InterPro:IPR037485"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT83"
FT                   /protein_id="CBZ26157.1"
FT                   /translation="MARIKHKAFIGKKICIAWEVLHDGKGWKAQGKALEILRFYAFSSE
FT                   VYLMCRIRDADDKKQILNLVKAVDGIERHRVLFCTTEKGYEAFTRQIDPSLLVSHNAAQ
FT                   VEFLRRVIQTLVLVSGDGVVASNVACVPSVEAIAVDLE"
FT   CDS_pept        complement(1215955..1218075)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3060"
FT                   /product="cullin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26158"
FT                   /db_xref="GOA:E9AT84"
FT                   /db_xref="GeneDB:LMXM.36.3060"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT84"
FT                   /protein_id="CBZ26158.1"
FT                   /translation="MSSLVSSRKRMAEYSTFSDKWSIIEEAIRCIFKKEVSKNSFQRIH
FT                   HSVFQLCQAHYGSLVLEQLEEQFFAQVSITVNRIDGSSTYVADFLREWQDYNDSVSQIS
FT                   NILLYFNKNYMYACHHSSIEHLGERIFCSSTLGNPEVSECLIASIKQLIHVPAAESTIR
FT                   DIGQELYTAEGSKYFARCMETPFVDAMVDKYVVQREQQKQALTTSGYLQWVQSVVCSES
FT                   HKYADTFFYILLDKLTSALYSSLILSDPSSVNEMLTGPTGLVHMLEKWDVSSISTFVQV
FT                   FCAMKREKDVTDVIAHVLKEKCEDIINDRDASVFPFPGVQKMLQLIERAKALDGLFPSE
FT                   EGHSQSPFLRVIRSVLGNDTRFMEALSVYYDNGIRQGKDDIVNTVGNNVLTILQLMPDL
FT                   EAFEVAFRSHLAVRLIYAKPHAVDMECLFIDRLFNIYGSSVVNRFQKMVEDIRSATAAQ
FT                   EKLIADMKTKKISPPLEFDVLVLTSGLWPQYTNIPLSIPQSMESCKRVFQEYYRRRHNG
FT                   RKLVFQMSLGSIAFQLCHGGRTYHVSAHTHFVNSIMALNSDENLSVAVVARQGALSCDE
FT                   VLTQFNTLCHVGLAERNGTEFRFNRNFYSSKPKVKVSAGVQKSAHDGGSVSTATRKGMD
FT                   GARTMSLDATIVKLLKEHNGMDHQTLCGAMESELRDVCSPTRADIKLRIDALIEKGLIT
FT                   RGESAHCYFYCS"
FT   CDS_pept        complement(1218947..1219651)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3070"
FT                   /product="fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26159"
FT                   /db_xref="GOA:E9AT85"
FT                   /db_xref="GeneDB:LMXM.36.3070"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT85"
FT                   /protein_id="CBZ26159.1"
FT                   /translation="MLHPGVFISKAKTDSLCTLNMVPGISVYGEKRIELGATQGGDDKK
FT                   EYRLWNPYRSKLASAIYAGVSSIHMGPGSKVLYLGGATGTTVSHVSDLVGPEGMVYAVE
FT                   FSHRVGRDLVEMSKRRPNIVPIIEDARYPMKYRMLVPMVECIFMDVAQPDQARILALNA
FT                   QAFLQNGGHYVISIKANCIDSTLEAPVVIASELNKLKKDKLKPLEQVSLEPFERDHAVV
FT                   VGVYRPVKKSKQ"
FT   CDS_pept        complement(1220677..1221474)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3080"
FT                   /product="putative lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26160"
FT                   /db_xref="GOA:E9AT86"
FT                   /db_xref="GeneDB:LMXM.36.3080"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT86"
FT                   /protein_id="CBZ26160.1"
FT                   /translation="MKAFFIGKREYRRVLHLQETIFNAKIARQVSVRRGESKLPLLSDV
FT                   VILVEHSAPVYTVGRRDTAHGLPPYCSIDVVKTRRGGGITYHGPGQLTMYPIANIQLLW
FT                   KDCTAEKPRSPIEWFSWALEEAMIQTAAMYHIPTHRFKTGVWADQYKDTPAQKLGAIGL
FT                   QLGSWVSMHGAGLNVASDLHFFDDIIMCELPGRRATSLSNEMQHRGVAESPPLVQATAP
FT                   VLLQKFIDSLHQPPSCAAPPLVDLSADADWHERVIDAAGISAP"
FT   CDS_pept        complement(1222024..1224501)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26161"
FT                   /db_xref="GeneDB:LMXM.36.3090"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT87"
FT                   /protein_id="CBZ26161.1"
FT                   /translation="MQTQAHKDVVKNITTASQLEGELQLSQAQHGVAVLDVYNAEWGHC
FT                   KALSDTFRRLFTDVGDLVHLRFFSVECNAVLESLKDPDEMKPHHPQQKGTVFSKDTLVS
FT                   FWKEMLEKRQNHSKPFFAFYKEGRLRTQLEGIDTPKICRIVRDLCNQQNTVSEYVTNAD
FT                   VLRFWESHFSLSENEVAASEFAQAVQAVLGASAAELSEADLADITAEVQSTSGATVSAA
FT                   DLQSFVGDSGMVKDAILTVVAKKRAMATATSAAPPPPPEEELQPAESEEKGADEEPRVS
FT                   PPRPSSAEPGEAVEEAAADEEEAEVGGEEVDVDADAAQEALPAGEDSAEAASSAHDAPS
FT                   HNDEQNEELPKTVTDGADEEPAVELPTVDAAEADEVGADTHELDEPAMANPVEQQATQQ
FT                   PEGNEPDSAYEELPEQQAAADVEPPTPSPSLPGEEHGESDVEEASGALADETRTEDDMQ
FT                   TSPAAAENDDGQHEELPEDARPPSSAPQPPMDTMEPEDGNDEELGEALSSAPPADTVNT
FT                   TGDQDESVVNQIFTNHWVTVTEEEMHVWNTVAALPLHYPQSTMLMADLTNDTTPAHEAL
FT                   STTADLPTLAEYLTAQGVPYSDINMMCIAADQKVASESLSYGKLSLLLISSDPEEGKGL
FT                   VPHCETFLKELSDGTLLKNQQPLAFTALALSASVAYPDECFCYCVPETAVAAFQELAVD
FT                   DIFILNALAPLKTTVPQDGQFILRIIGLPKVIELATTDESEDTMVLSQWYARLRVAEQG
FT                   AGALTAHFVENVCDDELQDFLSIYIERLIEDENRLDKKQGDEEKPAEGEFDDEELNDGK
FT                   PAEAATPEPEDVL"
FT   CDS_pept        complement(1228008..1228658)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3100"
FT                   /product="putative ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26162"
FT                   /db_xref="GOA:E9AT88"
FT                   /db_xref="GeneDB:LMXM.36.3100"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT88"
FT                   /protein_id="CBZ26162.1"
FT                   /translation="MSEARQIQSMIDFIEREAQEKAEELEAAAQEEYDVEKMRLVEAEK
FT                   AKIRAMAEKKLKQVDVDRRVARANYSKLQRMRVMEERARTMEKLHEQTRQKIVAMINNP
FT                   PQYKPMLVRLIRQSLMSIRTDAVVQCRKEDEAEVAREIPELERWYKEKTGVTISIQTSK
FT                   TYLDTVEAWGGVVVKSTDGRVVCNNTLSYRTKTCFDEQLPTVRFHLFNTEAPL"
FT   CDS_pept        complement(1230222..1231355)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26163"
FT                   /db_xref="GeneDB:LMXM.36.3110"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT89"
FT                   /protein_id="CBZ26163.1"
FT                   /translation="MTRVLVNREDCSLRVKGDLITFLYVTVAKDPLVVTARNVTQLLRS
FT                   RKDDAAAKLVADGESYVLKFESLRDREGFIESIVRAQEAEQTLSNDEWVASTICHAAVD
FT                   VGVVDKEELKAIMNAAGQRGVEQAFDALETLVDRETFQLLPITEQMENDVLRQTPVLAA
FT                   IFQQRVVDKETKKSFWEAVVRKYFCFSRTFLEEDIQRLEGARPAATTAPPPPLSASAAS
FT                   SSLSVINASSMCALPKGAATAVVDTDINEEDLLHLNEKAEPLQHSFHGLFAAHRHVPVG
FT                   SASVLPVNGTLLPFPQETAQPSPVYRPRFVGRHVLHQLPSETIEKAALETLRTFWRSGV
FT                   KQRRSILAKYTRSSKKGSGGFIQRMCLEQADRAVQDT"
FT   CDS_pept        complement(1232284..1233975)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26164"
FT                   /db_xref="GOA:E9AT90"
FT                   /db_xref="GeneDB:LMXM.36.3120"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT90"
FT                   /protein_id="CBZ26164.1"
FT                   /translation="MAYSNVPTYSPGVLVGNWFEDIALREDQLKLYKEQRHAAEEHPEK
FT                   AATNAVVRSMLASQLEEPTTVVAFKGDDVRIGHPYLLVNDKTQAVLALDLMTGGGASSQ
FT                   SQQYTLSGSLAPGPQVRSTWTLLRCKDEHNHSYNRNSSDVLHYGQRVRIANENVSAKGF
FT                   LYVQSSLSSGLHSSEVQYAVAALNACADNVFVVSRAGTVRDDVHFGFPVKVGDGVVLLH
FT                   SLTNLPLACNGERAATSYGMEYAVTCGYTTDYCSRSRGAVVVKPENVFYFSGGDGTDAV
FT                   LMRPRTSSRHQSRSSVVLTMTTGTGVTALLERIRQGALEIGGRIGFRSLSIALGVACNE
FT                   QRQRRFLDRNELRKAIARLGVLLSPNETDVLMKRFDTTGNNVVCAQDFLAELRGTMPLP
FT                   RMQTVIYAYQQLSIEGRGSVEFKDMCSLFCLNAATIPDVVDGVLQREEAVLDFESCWPG
FT                   RVGCKVGTVTLDEFVEYYADVSPAEESDERFCKLLQQSWAIPATSAYLSGEPHRLLTVT
FT                   YDDKPTETVRLPDSLVLDTQDRKAVKRLLIQRGLRGVKDFTLSTNM"
FT   CDS_pept        complement(1234921..1235586)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3130"
FT                   /product="cyclophilin-like protein"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26165"
FT                   /db_xref="GOA:E9AT91"
FT                   /db_xref="GeneDB:LMXM.36.3130"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT91"
FT                   /protein_id="CBZ26165.1"
FT                   /translation="MDAVDLYVCAVTSLLAEWTTTMFARSTVRWAAGAGHAFMDIAIGS
FT                   QPPHRVTFELFRKRCPIASENFLKLCTGENVLPRVSSIEGIGEPSFQDQFLPQLTYRNT
FT                   TLHRVCKGYLVQGGDIVSGQGTGQLSIYGESFDAPEEVKASKFDRMGLLGTAVSAPHLN
FT                   GSQFFILTTDKAPHLNGTCICFGRVVDGWAVVKAIEAIPLTAAGEPGERVVVVECGKL"
FT   CDS_pept        complement(1236630..1237379)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26166"
FT                   /db_xref="GeneDB:LMXM.36.3140"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT92"
FT                   /protein_id="CBZ26166.1"
FT                   /translation="MASVDTQWAIKSILQLGHHHLRHGVETTSSSSSCLVLPTSPSFKS
FT                   ASKAVQVTAMPRLMRASCDPSYVMLLAKRPSGIAGVSLRPGIRVPWTGLPAAASSPVSA
FT                   PCSKKTRLLASYLQRRGFAATPPVPTETRSSSPQFRPVQRSMPLLLHTNHLIGWKLNDA
FT                   SPAFPVYAHTLAELQRLRSNDVAALKPQHCLIASEYCEWDNWREVLGEPGWDLFSADED
FT                   AVERLLQDGLAISTLEEEGGLYPVEVV"
FT   CDS_pept        complement(1238697..1239752)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3150"
FT                   /product="putative ADP-ribosylation factor GTPase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26167"
FT                   /db_xref="GOA:E9AT93"
FT                   /db_xref="GeneDB:LMXM.36.3150"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT93"
FT                   /protein_id="CBZ26167.1"
FT                   /translation="MNIRQRKSERHKEVLRKLSQNGGNKNCFDCGMRGPLYVVSDFGIL
FT                   VCSSCSAVHRSFQHKVKGITMSEFTDDEIARFSVSGNDRARKVWLSTFQDQLPRSGDVM
FT                   ALKDHVRIAFEERRFWNAQEFSALQDSWEHAREQPSQASPPLSVTKPAESSFASVPEAP
FT                   TAQSGSASAPTNPARPPQEDVFDNLFSAPVQSSSTPQPTAHAVAPPPPMTTSHAPAPPA
FT                   PQQPATVTSILADLFAGVPPPVVQPAGGYSALHLQQQQQQSIGYPADGGMYNITQGPPS
FT                   GMMAPRQLQSSQLPYPRQQQAQPIPYAASGPMGYMPYVGSQQAATFNFAAPSASVANPY
FT                   LYQQQQQQPFT"
FT   gap             1240196..1240295
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1241346..1242320)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26168"
FT                   /db_xref="GOA:E9AT94"
FT                   /db_xref="GeneDB:LMXM.36.3160"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR027684"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT94"
FT                   /protein_id="CBZ26168.1"
FT                   /translation="MEAKFLKLRQEREEQRRQRSKETGAITLQRQQYEAEAELLEAEVT
FT                   QLLQEGNVTESQQRIDALRTLVQDTSNSISLTAHEMAKANVILARLQQLVDEKRSGAAP
FT                   KKFKFSSRLKAKPTSDAEPTTSSLSPTGTSDTKEATATATVSVAGTVSSTNGFGNVHGP
FT                   STGTDLFISHSKSIFVNGCADCDIYCLPVAGSAFLSNCTNCRVYVACHQLRLKGCTSLD
FT                   LYVWCASTPIIEECDAMRFGPYRCWLGLLSSCTEDGKTYATHAEWVSRVGEIEDTARTE
FT                   QNYVKVDDFQWVKKSASPHWRVLAREEERASTTVFGPATPPSS"
FT   CDS_pept        complement(1243125..1244159)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26169"
FT                   /db_xref="GeneDB:LMXM.36.3170"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT95"
FT                   /protein_id="CBZ26169.1"
FT                   /translation="MNSDDECPELISARVPVTVLTGFLGSGKTTLLHYILSADHKMRIA
FT                   VIVNEFEFGKTIEKGLTLKSSEKPDDEWLELNNGCMCCTAQTQTVKALESLMERRGTFD
FT                   LILVETSGLADPGPIAAMFWQDLPLCGHLYLSGIVTLVDAVNICKYLHDEDVMQEAERQ
FT                   ILMADKVVLNKCDIATEAQQKEALAAVREINPVATVIPSDHSRVPNLRDILFIDTTRAA
FT                   TELVHLHEHHHSSITAVSLEFFEEERALAVSSYRDVHAIGTDLLYRCGEYNFEVVRCKA
FT                   AIWCCEDGQYSLLQLQSIGDLFDVTPMVGQSVPFGCTRALVLGKKLDEEKLRDIFAKYL
FT                   KATK"
FT   CDS_pept        complement(1248027..1252259)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3180"
FT                   /product="receptor-type adenylate cyclase a-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26170"
FT                   /db_xref="GOA:E9AT96"
FT                   /db_xref="GeneDB:LMXM.36.3180"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015232"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036310"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT96"
FT                   /protein_id="CBZ26170.1"
FT                   /translation="MWQPPRLVMNRCKGSSTHSPVTAVILLLLLLVLCAPVSAQDGSLR
FT                   ASFDVECALLQSAESSTAALSAADVTAQMASIICARESLADPFVWVPTDGLQNTLNVYM
FT                   SILPDKLLNSVVETSSSTSCTLVTSISEGVLDTRSMTKNVYFTNADPATEMLALLSYVM
FT                   VNGAPPKIGFVYTSAAEGKNSAGATVYQEFLRRMDELAYTGTLVTYEVTRAHDSAKFAT
FT                   FLKNFVDGDSAVFFFLPAGSETNSMFLELIKRSSDLKVLMPSWLIRTATSQYLAATRPK
FT                   TSPSNIIVSSTNPHPEDNNFEKSMYQFRKDYGKNNPPLAPNSADGIEAVAGWITARATV
FT                   ATLQLHTLWIELPTQKLYFDGLFKQRVYTIGDDIVLGAYSNSCNVGGRMVLLYSLINMN
FT                   SGEPSAYYGLMSLSDANLMLKPWECHAADVALNISRMVRTVYVKYHNIGENTNYMTMQM
FT                   DGMISAAMVSTPFTKDTIGPLDSLAGTAWKAALDSSSTIAVIGAASVGVDKSPVEKVLV
FT                   DPVFLQPTLYQNASNVVYLTATTEQQLGAVAAWVAKSAVAPALYAVLRDSGASATAMQS
FT                   TLQRIAKQAGVTVQSVKTLGAGDELSSRDLPKSGLLLLTGMVQKDLDTLQKHMKKSKDA
FT                   RVMLLFDEVTQWYRQIEETVANSPSFGEHLLFVTNLPPWVPKKQDVSRLSVEFLRAALG
FT                   PGYHSPASMRGFLAVRVLSMLSYNVANPSMSALLDAFYTQQVLQISDLTLGPFKRTGCT
FT                   YSPRSNQVECTGFLNGGAGGIYMWSYADMVGETNGPIAGPYVVDLVGYVAADVEDSRSS
FT                   GETPSGSPGEVHSSSSKSTIIAAVAVGVVTIASVVAAVITCVLCTRNSRDNRNAPKDEN
FT                   EPVTLIFTDIENSTALWATAPQAMSSAVTLHHKLVRQLIIKYRCYEVKTIGDSFMIACK
FT                   QPFTAVQLARDIQVELHQADWGSTAIDDAYKLIGKPSGGTDSGESGLSPWSGLRVRAGV
FT                   HSGLAEVRFDTVTKGYDYYGNVVNIAARTESVSCGGQVICTSSVVGALTEEEQGTVEFV
FT                   ALGPHRLHGVEESIEIYELRTVPGRVFPSKESGVSANPLASLSAGANADSDSKVEEDNL
FT                   MVMQEDTFTEVATGVEPVAEVLEVYFSAYTEHQKIKFLQKTCKCFCLPNPPRRMFASND
FT                   AYLNSLMLTVATRTSAVINFRHKKLESDTLRSETEAQADAPALELVTHRDAAGEVRRQS
FT                   SVFFSGVDSPVSGELKRRRSVMTDRSGASLPKHGNSDSTMMLVLDNGELLTLCNSAGPS
FT                   FTEKSPEVSEATEVYQNGAPSIRGDEVSPCFEGGNGLLFRIIDKATKRWAFYNDTIDFV
FT                   MHVYFSVGRTSAVKWGPGVAGKVTQAEETGRYEGELIVPPLATEVLMTGRVNGYTMRYC
FT                   ATPSGDGE"
FT   CDS_pept        complement(1256004..1257704)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3190"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26171"
FT                   /db_xref="GOA:E9AT97"
FT                   /db_xref="GeneDB:LMXM.36.3190"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT97"
FT                   /protein_id="CBZ26171.1"
FT                   /translation="MPPAPPPALLPIEESPVGTQPATYLTSGITAQNTSSNSTAGAVVC
FT                   NNCKTRGHLRRNCPKIKCNLCNRLGHYRRDCPQDASKRVRSVEGAPREEVNLDEEYRWS
FT                   VCRNCGSSRHIQANCPVRYQALECYQCHQLGHIMTTCPQTRCYNCGTFGHSSQICHSKP
FT                   HCFHCSHSGHRSSECPMRSKGRVCYQCNEPGHEAANCPQGQLCRMCHRPGHFVAHCPEV
FT                   VCNLCHVKGHTAGVCDNVHCDNCGRNHETVHCHQPYMAPVAHDRVSEEGSASLPSEHDP
FT                   CSADQSNNSATPRNSEDDASNRSDEPRPRAVVSCAPVVPPYIPQEGPKRDGRVAIVVDG
FT                   SYFERCVVVRRNRSDPAYYRYITEALLYTIEYIGDIFQCEPFAFWFDTDTAAFTDFVET
FT                   SMPLAHRKHAFRETSLRKRYLTDEMNSGRSLPNVVAKLVGGMKRQRGFTEDGPGHVWVQ
FT                   TGVDVATATCLIELFQDRRQFQQVVLLSGDADIYPAVQYCNTLRRSSHQHADSNPVRVC
FT                   GTSDSMSKLYGQQQDLTDFLPRLLLDRPSHTEGGRTIEFPTSKVFMSVH"
FT   CDS_pept        complement(1258945..1261791)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3200"
FT                   /product="putative DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26172"
FT                   /db_xref="GOA:E9AT98"
FT                   /db_xref="GeneDB:LMXM.36.3200"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT98"
FT                   /protein_id="CBZ26172.1"
FT                   /translation="MPTWLNVAEKPSVAKEMAQSLSGGNCRTAQSQSRFNPVYEFKFEG
FT                   KTMLVTSVAGHLMEDQFPPNTKNWSTYPFQGLFSAPITKYVRADLEPVKKNLEALASRA
FT                   ETLVLWLDCDREGENICFEVMQVVQSKRPQVQVKRAHFSALTARDLLNAVHNLKLPDKR
FT                   LSDAVEARQEMDLRIGAAFTRYQTVKFRHLFAAIPGVLSFGPCQFPTLGFVVRRYWQQQ
FT                   GFVPEDFFTLQLQHGDTKFHSSRGSMYDQVAATLIYEDMLQAAAADGHKGRITNVQQRP
FT                   SHRRPPVPLATVVMQKLAATHLRITSERCMTLAESLYQEGLISYPRTETDSYTFQESEL
FT                   LELVRVQTANADVAEYATAMLADIATHVRPPLRGGHDDKAHPPIHPTKAWNATQDERGR
FT                   LYNLIVRHFLASLSPDAVAATTQVSAEFGGELFSAGGTTILQRGWLDIFPYERWNNTCI
FT                   PNYQIGDMFQPTAVPLKKGCTSAPPHLTETHLISLMDSNGIGTDATIAQHIKTVLDREY
FT                   VRREGQSLVPTTLGIALASAYESLGLASLLQPQLRAQMELAMGDIANGAATKEQVVAAA
FT                   VQLYEEIFSRLMANTNAFYEELKRYLQPAVETDACAVEATVVKANFIPCGTCGGPMDLV
FT                   ERAGERDREVWSVRCHACNKMHRVPNGRLNTLEPVSPPHTCPLCGFLALRVANREKQTS
FT                   YHVCPHCFGSPPKAWSVSAKGAASAAAPFPDVEAAAEFRCFQCTADCPLAKGLEAIGIT
FT                   TCIACCQHELRLRSGAKGFFLSCRGYPSCHLRVSLPAAASVKPSPSQRCPACSAVLLTF
FT                   DFSGRQGVPGLNMLDAICVRCDARIKDYITVKGMPTGDPNASAAPNSAASVASTASGTY
FT                   TLPSVKPSSARRSVRGGGQRGGHGADAAATNTSSGGVDTVCGCGAPAKQFVSRKEASRG
FT                   KRFLTCANRQCSFFQWLD"
FT   CDS_pept        complement(1265465..1266241)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3210"
FT                   /product="14-3-3 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26173"
FT                   /db_xref="GOA:E9AT99"
FT                   /db_xref="GeneDB:LMXM.36.3210"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:E9AT99"
FT                   /protein_id="CBZ26173.1"
FT                   /translation="MTETIKWKNVAIQDEVVPKPSDIKLPDDLAELIYMAKLAEEAERF
FT                   DEMLLCIRKYVRLNSELDTEERNLLSVAYKNVITPRRNAWRVITSIESRENAKENSATL
FT                   PFVVNMRRELEAELSPLCDDLLSLLDTYLIPAAQGGEAKVFYLKMKGDYHRYYAEIDSG
FT                   DGQRQAALNAYQKATDVANSSLAPTHPIRLGLALNFSVFYYEIMKEHEKGFQLARQAYD
FT                   EAVTELETLDDEAYHESNTIVRLLRENLNLWTDDQL"
FT   CDS_pept        complement(1266971..1268623)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26174"
FT                   /db_xref="GeneDB:LMXM.36.3220"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA0"
FT                   /protein_id="CBZ26174.1"
FT                   /translation="MASYAELLQTCAEFQENFSTLTGKYNALSLELKNTKAVCERKQRQ
FT                   LDEVAAREEQQRKEILELKKEASDAAGFRERHHAATIAMEHLKSQVASAHQSALDASLE
FT                   HEQEVQQLKQQLEDMIKRVETAADGQRLREARRQTLELEERCATMHAQLLEDRERHSQQ
FT                   LMTAHNALREQQSRNLELEQRCRAMEADVAEMRAAVRRSTELQNEAALLKERYSTAATV
FT                   AQHQVEELRAEAEEARRRLAQLKADHQAQMAQVAQDAAEVREELHERVASLTAGLATAQ
FT                   NNLAEERSLYRKMQASAEEQVTQARNASVVEASALRRAQAALKEENTRLQWRLEKMDDE
FT                   LREGQQALQALQARHDSLAAKLQQSQSQLDTAAQQEAWLTCERQSIADQLAVARQQLDA
FT                   LNKALMNHEEVALQVQQLTMRLANATEEAQSHRHAALLCESQLRDVEEVSALKVRELRR
FT                   ELKAYKKQCTNEAARADRLRRKLMTTLVEKEAELYRVSRARGRTITLEGEPATIPASGT
FT                   VLHDSAYSDVISMLRSQSQQAEDLHTRLVQLAR"
FT   CDS_pept        complement(1270315..1271925)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3230"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26175"
FT                   /db_xref="GOA:E9ATA1"
FT                   /db_xref="GeneDB:LMXM.36.3230"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA1"
FT                   /protein_id="CBZ26175.1"
FT                   /translation="MNKAYDIIVIGSGAAGCAAARACALHHPAASIALIEQGSRAAVPQ
FT                   VMRVPLMQPYIASVRKARPFLQTLACAPETNLADRSLPFTLGRGLGGSWLCNDMKYMRG
FT                   TRKDYEGWADTSWTYDTLLPVFRSLEANSRGASRDHGEDGPLRVTDTQRSNIDSGMNVR
FT                   FFEACEAAGVPATSDFNAGEADGFSAMQSYIDGGARVQAFEALIEGTQPRIPNLDLLDE
FT                   TCAERIHCTAGRVRTVEVSHRGDKSLLEARHVVVCAGTLRSPLLLQRSGIGAKGSVLDA
FT                   PAVGQNLITTSAADLVFRIRNSSNVCSKSISWCNASYLYRQWREYKENRTGVFSAFVEG
FT                   AAYVRSQLQQDAPDLSILFFRTPQMGMAHWLMDGFTMRVTHHYPSSRGEVLYNGSKGTT
FT                   FIRSGMLSTREDVLAMDEGVQWVGLLTTRDGTLQSVYHVDEKGRHVSPFWSYGAALHHP
FT                   RDRLITQRSTAAFLAEHVKSGGDLYGTCAMGTVVDSQLRVNGIDGLFVADSSVVPVPTV
FT                   ASSSTLGSAIGARVASFIH"
FT   CDS_pept        complement(1272565..1273491)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3235"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26176"
FT                   /db_xref="GOA:E9ATA2"
FT                   /db_xref="GeneDB:LMXM.36.3235"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA2"
FT                   /protein_id="CBZ26176.1"
FT                   /translation="MDSLYFIGKAQFHQLATHISLYHEDMSAGYKHLSTDAVMAVGLKP
FT                   HKFTYWNVPMMSGYLGKTVPLDIHGGYVMIDEEKVMPMATSYGMLRYALLTSAVRAKEG
FT                   GRWRYDFMTMNSTLAIGTAAGFGLLSFGRKRIGWMRRHPVGSVMASFVACLTTTVIARQ
FT                   GIKALGIGIVQAQNSHKRALNCLHCVDCLEDVNTYTLKQIEELKAQQIPQQAGMPPPPE
FT                   EYVRRFKKGVEMQCRLLETDMEEVRLIRKWAGASLCDVHQHLRDDPMGYTEPHGLVLLA
FT                   SDRARAAERPPLAPKPDDDKGIRPAKN"
FT   CDS_pept        complement(1274571..1277132)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3240"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26177"
FT                   /db_xref="GOA:E9ATA3"
FT                   /db_xref="GeneDB:LMXM.36.3240"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA3"
FT                   /protein_id="CBZ26177.1"
FT                   /translation="MEDVQAGPLERDDKQIAAAAKATNSTAVRRRRMGEVYPIMKNTIY
FT                   SDEECEEVVVLTSWDCGMRFIRYISGLFQYFVRNPKAMGFFITTAIILLFFKYAQQVVV
FT                   KAVNAAVRAHPGLEPTDTIRSAVTSFTEELRALERAAQTIGWAYMRDSVKGYDIGTAAG
FT                   TTFSSLVRNFQLSFIANMKTYVVYTFPAAASTALTSRRWGQIGCASNETNSSICFYVSN
FT                   DSTVRQWDTVSNTGDGGPLVSRAYIEQCMPDLLSVATAATKGSALATSGVWTRPYMACN
FT                   IFPQKTVRTISYLLPIAFNAEGYATVMAGIDVSLELLMEIVNAMATPNIELVVVDNRHN
FT                   ASRGGQFVYDSFDKSIFWTTPYGVLDAPVGRIRDLAESVWSEHGGTLAVNGSFYQNGLI
FT                   YQSLTMMSHWTLIASSPLVLSVAEVAATLGVIVKESKGIATVASGLYQDCESAANMQQN
FT                   SVTVEALGEMEQAFGTHLHSLYTSYTLAGTTKQRSSSASAVSESSKNSNADSESVTHVL
FT                   PYSSTWARSSAVSSAAKATLATPAASTRRGGSGMEMLVLQAATGRLPVDSLGISAAWRT
FT                   SSGGSAAKDERVWGVCGCTFTSVTNKTCFFTDSSQTEILFEGSVFNASAKDKIEMSPSS
FT                   ASFYGLFTSQHIDSTTTTTGFWTKPYLRSSASGNASVAVSYVHPSEHDRNGYVMRATII
FT                   EINAAWMAYTLKANQHNGTTALYLIDRRGAGTFLASSTAVQVTDAVYTALKTPHQEFNR
FT                   IASAVYSTAGNTWERSLSFHMETTLVNYQVVEGQWGIVEVIPGDVALQRYLPTPAVTSA
FT                   TDALRLLPPGETVQLFLYLGSILFFFFLNLLILGCSHLGRQ"
FT   CDS_pept        complement(1278800..1280347)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26178"
FT                   /db_xref="GOA:E9ATA4"
FT                   /db_xref="GeneDB:LMXM.36.3250"
FT                   /db_xref="InterPro:IPR013176"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA4"
FT                   /protein_id="CBZ26178.1"
FT                   /translation="MALTTSSDVGAPLISLAVYCPLLCADKEEHGADNILFYFPSDTHL
FT                   NLQMNQVGFCIAISSLAPRFGVHCSWHQTIRKQRSSVCLMSPAEDLWVSAHVRGGNEAA
FT                   LTTHHLLQLSCALFELLYSADTLLQLTLPNIEEGRKEGPPTGSGSSTLSTPTADKALSS
FT                   DTAARPALRSFFTRCATFISSVLAAQCKARDGATEQMGRPGAAMSAQDWAHYLSAEASF
FT                   GLPLRFVSDRELPSLQLGRVEEVVRHILWRPVSGCTAGPDCDAPSSLGRDSVHCCVFHL
FT                   PSLHVVMADSRLPRVVVQSLKYYLVLYAPIACTSFRCHVPPGGPCEAAVWLDGNVVVVL
FT                   VDRHEDQASSVGGRAVSPSLMEHARIISSKIRQLLSKPAAGATSVEANDAYWLSTRDVP
FT                   THQLYYKLTLKPPIAASSGLVAHWRLRGTVVEGTPFRQVVPGLVEYVRALVYSTKLCLP
FT                   PSTSPSVLEYWTRWNSFWVYLRFAGPTVTALAWQHQQLPMRVRELAYETQRLLLVAP"
FT   CDS_pept        complement(1281073..1281657)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26179"
FT                   /db_xref="GOA:E9ATA5"
FT                   /db_xref="GeneDB:LMXM.36.3260"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA5"
FT                   /protein_id="CBZ26179.1"
FT                   /translation="MLRSTGVSLYYRATAELDRLRGMLRGRARLERKVGLKRITFLMRT
FT                   QTRYRVEHKAHWERAIVRKNVDSAAHEHGSGWQHLRNDLARQNLMLLPHTQQQLAQYEP
FT                   LAFRAVMELCASRVAPPPPPMTAQVPEEAYATRPEDPKVAHPAARRQLKECVERMLCTG
FT                   RSEALQGEGPRTTQAWMDAWKEYDLGSAAQK"
FT   CDS_pept        complement(1282550..1282939)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3270"
FT                   /product="putative 60S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26180"
FT                   /db_xref="GOA:E9ATA6"
FT                   /db_xref="GeneDB:LMXM.36.3270"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA6"
FT                   /protein_id="CBZ26180.1"
FT                   /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLG
FT                   NFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKDLR
FT                   DWIRILATGKETYQLKYFNIQDQEE"
FT   CDS_pept        complement(1284748..1288257)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3280"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26181"
FT                   /db_xref="GOA:E9ATA7"
FT                   /db_xref="GeneDB:LMXM.36.3280"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA7"
FT                   /protein_id="CBZ26181.1"
FT                   /translation="MLRRRVCATPSLAVGPAGPSTLSSTPSPADSQQRRTLKTLDVREY
FT                   RPLGTPIEFRFYQRYANHPNRQSGVQFLTHYNTHQRFRVNKDFIDYMHWGKEQGQARLP
FT                   HRHQRVAFDFDDSLQPTRAEGDVSAWFAGQDPTMGSHPDISTSFDPNKKLFSHPEHWNK
FT                   MFSKRRPGEGDIKLNVIPSNSLLGPMVTHTDTQEMAYFKTETCGPTHGRVPGINAPFKG
FT                   EMDRKMMQAMSRPLNSSRTLTGNNGRFSNTIFINDPKRHQTLSATLAKELNREVDRATN
FT                   GLYSKLTVLTSAQSGLTDFFCGGADLKSIGFDLTMAQLHRKEAAELTKSAASGSKKVEA
FT                   KVQELLRDAERYEERADSVLRENAAVIWRAYTSPRALMTLVNGRCRGTGCGLALAAKYA
FT                   GLQDASEFVVDGPSVGLTPYSGMTRLLARPETSLKYPGLAEFVMLTGTSLFAGDALRLG
FT                   WSDLFTSLPDMPYHIKDWFDSTEHMHNDAVAWQLGHLLERCFQMKDRWHTSAMERCAMT
FT                   PIRARWVEDAFADQPSIEEILKTLSAMEKLPLTDRHNTHDPSYATPYTLASVAEGVEKL
FT                   GASRLRYTLSPWDATPPEEAVEVRQAAEIFTSYVLERRGKVNIVAHRDRQKVQAWQKQR
FT                   EREYVAYSNMKSAPHRRHVYARLEGCEGTLVDFDFTIDPASDAAAAAAEKGAGVGDNNE
FT                   LVHTASVDRLKRAVLQAMDMPADRDVDLCWYLPTLDTCPIRNDEELVDVLHSDPGFEDP
FT                   SAQLRYPPIYFLVKRNSLHLSEWAYAVKHQLLLQSPYALKATLQLLQEVRGDGSAEAVR
FT                   SLADTLATEYRYATRLLKRPDFYQVGQHVDKSPEEWDVVKEERARYVHKVHLPTRPLPD
FT                   YEMVFERNVQLDGHTFQLRPRWSPRTVQEVTAESLAPLATPLDFEKDGAVEFNVVVHAS
FT                   KADRLAGMIEDAGGFEVVTHLGEVDKDGNAKVPPLRGDAHVPTNVNFYEMARHPWEDTP
FT                   SSWRRDGFTAGSKEYFEQQYKKAEKAVYDEANRGQRNYWPSKAAVDGFTGEESNALLEE
FT                   RFFAKLRDAERGVESWARQLRKKAVEGKLDNKTEIATQQEKIYDDDYYRWFIQPGHNPN
FT                   PSGLLRGRKGADSGSNSVDKDLEVFLNQLLSGVAERGADGSAGDEGDALILPEDADEAA
FT                   DSA"
FT   CDS_pept        complement(1289231..1290061)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26182"
FT                   /db_xref="GeneDB:LMXM.36.3290"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA8"
FT                   /protein_id="CBZ26182.1"
FT                   /translation="MVSYLEGQVTRDGRKRAPRHLFGTNYRKPFPWIRVGLGLTVMAAA
FT                   ADMVYRRMSYVSPQEQFVRKIKIRPYGVMGTQMTLQGSLRQEGPKPDDTMVITDPCDLM
FT                   HIFTSAAGATGTSGAIYKWVGLTKAFPNDVVMAMSKVGDAKHHQYGLKDSEAGEKHVIH
FT                   VLAPDFREGIWSEREAAIELSRAYRNVLHEYVVSEGDTLRMVPLSDGLQAGPLYNQLPA
FT                   ITHSALLMGFEQLHLFDKEYVLRDEKNIELCVFMNREWNMFNNAFENLPVGPTG"
FT   CDS_pept        complement(1292272..1294737)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26183"
FT                   /db_xref="GeneDB:LMXM.36.3300"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA9"
FT                   /protein_id="CBZ26183.1"
FT                   /translation="MSRAREVSQRLTCYGGITLPNIPRIAPDEKSRQKYLSEYEKYEPE
FT                   LRRHHLGDAETTNTIGLKDVPPDFDRTVPSLLDPTAAEVEYERAREGKKAQALRKGHRG
FT                   ASARVAQAAGKESPTPTARKSISPQPSQIALADEEPQQKGTPSPLRPSTAAGTPTTAAT
FT                   ATPAASEEGARLTPVGADGPRTSDAGVVEAAPAYMPRPPSERSHPKSAGATTPMSHPRA
FT                   RTAPSSKPQQDLTRIGKRTGTSPAASARAARPKSRPRAQPERATSPATAPTTPRRLRTP
FT                   FAAHGPPTAESTARVLRVLLDPPPQYASSLHLDLSSFDLGWLRSGQAVPRHLTTIVNHF
FT                   KDNGTSPKICINSPRSVIAFLENGATPKDWDLRGSHASAPALSTLGRATQEMAAVQAEV
FT                   HEHRRAYVQAQRDTLHCTLQDSYSVLCARVPLNELVVWYRRLCEADMLADVALGEEQQS
FT                   LATAVQQLQERQRQVFETNKIRMMRQIQQAKELQERQEASVQLKLQAEAEAGELRRQKA
FT                   LEEQERRRLQQARLEAHRAERQRREEAYKQQLQARLNKAEACNAERMAARERQLQAMQQ
FT                   RREEQEAERLRRLERSTAVLEEKFAAEEQKRREKAAKLEHLRLAREARLAEERRLLMEK
FT                   QQRAAYVREEARLRSEEAEEAARREALQRQQYAEERLREFQARRHEEAAQRAVAVAAHH
FT                   ERSNEIRSQALAKEERFKATVEDKHRQSEEHHRERQSRQLTEFMWRREANWEEEEVKTY
FT                   AVLQLQRLAEFNKLYTVVDLLEKRKAANAVMRHRELICEKVMRARDELRAGRDTLKQEI
FT                   DRSSQETWR"
FT   CDS_pept        complement(1296121..1297344)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3310"
FT                   /product="putative actin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26184"
FT                   /db_xref="GeneDB:LMXM.36.3310"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB0"
FT                   /protein_id="CBZ26184.1"
FT                   /translation="MTGISASIQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTRR
FT                   PRPTLLQHPFDIAIGDAAYNDSGLLSLTYPVREGHVYDYNALEKLLFYALVKEARVTPD
FT                   TSPFLFLEPADQSRLDRERLCELLFESFNIPLAGLLTNTAATLYSSGRTRGLAIDSGAG
FT                   RTCVAAVDEGYTLAHSVRSSSIAGEALTDELFAALRAAGYPLSTPADRDVVEAAKEALC
FT                   RVSADAKDEEVRQVGTHSHPDPADGFILPDQERIFLLEHAYKVPEALFDNTYLTYTTAM
FT                   SAGRPTTPTGYSQSNPIVTKALRGWVDMLRDAAAAAPRFLEQTLYENVVLGGGSTLFPG
FT                   TEQRVQREIADIAPKGVRATCVAFPERGTAAWMGASIWGCSSVFPDTCLSKATYDDQGS
FT                   SVVHLYTQ"
FT   CDS_pept        complement(1298604..1299068)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26185"
FT                   /db_xref="GOA:E9ATB1"
FT                   /db_xref="GeneDB:LMXM.36.3320"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB1"
FT                   /protein_id="CBZ26185.1"
FT                   /translation="MLRRSAGRYMKPFLHAFSPGARASEKGMLYRNSYMNAHAQVASIQ
FT                   STHRTRRERTIFLFLLLPDQVFMTIIVFAVGCMAVGVLFRQQPFSTNLNKDRWLSGGMN
FT                   PHEQYERNATMSQIFEMHKEAIDNTRAELTRPQVLSAPNGYHSPSGVYAP"
FT   CDS_pept        complement(1300346..1301572)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26186"
FT                   /db_xref="GeneDB:LMXM.36.3330"
FT                   /db_xref="InterPro:IPR040193"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB2"
FT                   /protein_id="CBZ26186.1"
FT                   /translation="MSTYSNSQARLNRIAPQLRPAGVHGDWTEATTAELLSSYNPNGIV
FT                   TPDHIRSFHHRGCDVGEQRRHWGLAKDAPVDPNMRHGVKGKETGGADACLRPEIYADKM
FT                   TALLDAQRETQYLSNRRKPLGHAPVPRDPVPVPFGGFGITQKKGDSTQSVLAGYRSVDV
FT                   LHPAGEQLTRNYDWEKAGIDPTQHRFGKPSARSDSTAAATLFNDSATQLVSKLSKDYET
FT                   TVARELGKSKSYGLDDPAEWDEEKRGSVTKFGATGTAASYFQTEQPTVRELLSSWAQTA
FT                   SGSRTDKDASGKAGQQGLTGSADAAVANKADTSVAVPVDSGLSLTGPLKDEVRAHQLLY
FT                   PCHYVSLGVESKYFAGGRPLEDIRRLCHKCDFGMSDADIDAVFALVAKGSSTCSIEEFK
FT                   NAARANGYM"
FT   CDS_pept        complement(1302833..1310422)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3340"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26187"
FT                   /db_xref="GOA:E9ATB3"
FT                   /db_xref="GeneDB:LMXM.36.3340"
FT                   /db_xref="InterPro:IPR027272"
FT                   /db_xref="InterPro:IPR031334"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB3"
FT                   /protein_id="CBZ26187.1"
FT                   /translation="MSSSHEVITPDGGPAPISRWRVATLHILFFVLATISTVSLRAPVW
FT                   LIGALVYCSKHRKALIGQRLFPSRLWQVLLASLVTSTFCSLVANTVTTLQQNTAWVQKA
FT                   VWRTLYPLWVLLGVQQWDAADYVNTIVCPGATVVVLGIYLLILKRTLAGRVLSRNRATR
FT                   AVQGRSVPWSLLPRWTGAMLAARRPAAGLLLSLFSWAAAWTAEPSLVGLCLEGFTFVFV
FT                   AAFLYVEHRIRKPQRSAVGSGTGAQRHIPHAFGTAVAVALVCVCLTQNGAFFFFTNAHG
FT                   DWCRLLGMGPAALDTIAGLRYALQMVGMAGVFLGAAFMHHGTESSESAFPESGADAAVP
FT                   AGEEVTRLLATGDQPVLSTSVPNASFRSMSASYEGLLNRHRRTPQVFAIACITALLAYA
FT                   VYYPSLVSAAVWLLHLCCCAGGLVQSPMAPPSAHRIAIACVLTVLCCTILVQYVFQALA
FT                   GNPRTTAWGQWSPARPAYPDDGCAVAAQVVAEHLIALLFGVYVSVAGVGDTGSGGNIAD
FT                   EGAEPATPSQSSLVNRVGFSTEANAHFTDSVQVTWLRAQLSDAAADRKRLLYLFQVAVG
FT                   RSPRTIELDAICATAAQQSGASSPIASRGGLTVEEVTQLLVSGPFYTYAVILCMFVLGT
FT                   SSASMDLLHATCLVVSLGVSVIGGNAMLYRRLRTVPPVCVAVVVGVQLCYGIFAAGDEK
FT                   RQQQKQQRQHIPTGTQPPFIKASMGDYVIITSLTWEDCAPYLFAQFVLMWCSRYTPKWL
FT                   TNWTHIAQCLAFRCSWARFIHTVHRVAGVVVLAWIALLLPRSASVTVLILLLFTVTLLH
FT                   HLRLHRLAYVWRRFLVVGYCGVVLMCMLTAEFEPAQPRLWQLLRALGCPPGSERRCAQD
FT                   IGLPADSAMWLTPLSIPWWLIIVLATATARPHPLPSSLPSSLAAAPTTGAPEASTGRFW
FT                   RALLWWPKVLSDVLSFAVLAAMVHTALQRPSILAALYLVGPGLGVFPCWTLGVAAVHTA
FT                   LQCVYQLWFSPGWLDAQTRLGVSPAQLLGLWRPSSAMSAGANLPSTLVVAAAPLLVGVA
FT                   QSLQLQCALVARRRERNTAALPRPGRMWCRVWRTCATHLYMLLLWVLLYLTQKIALGWG
FT                   VGLLVMAVWISAEVRNCGVLQRRRLLFSAFGSATAALMALAYLLHWLHTVFPWWSALAM
FT                   YPYLFGGSTNKDKTKTELDSVCCAAAAACVVLRVSSGAPRENESEHLLRHIHSPSFLDW
FT                   VWRHSGELRENHEDIAALLSEMPPDEIHYFFRDVAGVFHCDEEAAEGTDTSPLSTSPAP
FT                   PHKGSVVVSVARRVPLVACGSVAIGSATTWPPCVLRAVLLLAGLCLAARHHRLHWSFWR
FT                   WWRLTVVLYALLPLVALVAACPCVRDAIPKLPPWVGLLIGWSLDASHVDGNALVFSHRH
FT                   VMLFVCLWLQSCVYNCPQSCTALLRQQGEERLLSEARHAALQRQLLSRMANATEKVVRV
FT                   DREVCSYLNALRTGDDMVFTCQTCTRGGSDYVEEGGDDHGSDAERVRVSMPSPPSMTPV
FT                   LEPEEVNEVLDDAGELPMPPLTLPAVDGRSNAPPPSPDQAQPPLLRWWRQRCVRWLRRI
FT                   CDKLAAYTYHPSEYRLSAVATDSSTSTLWLLSQYALRTAVQVVLRHTPFALLGCSVANA
FT                   LLTGCLWELIGLCYVVQVALAYHPHPPRVVYKAFGVFLGTGMLLKEAASMWAFYGHTNS
FT                   SLITVLSWVLLPLKGQNRGSRSSHQVWANVPQSRGALRYDTLWMDLVTMGVLVLHDRVS
FT                   IIHGVHVERDQQQSTVRDSSPVTVMPEDPASSARGESLSNSITAATTASPSASFLLLTP
FT                   IAHGISISSAFRALVADYCQNLLTVSGVGEDWYISYTSVDSVALLMVAVYYSRIAGKNN
FT                   GTLQDNVQNNLLPGPMALLICVSVLQLVMDRMLYVQRSMRLKALANGVCALSYTLFYWW
FT                   WRNAVTVSDHATGNVYLALKIVALVLSVMQVCRGFPVHRRRHIFATHLGSLLSYSFTVY
FT                   RSLPFLWELRTLVDWTVLRTSLSLQEYLTVEDIYVYVYQCRDRYLEKHRRNEKLGDPVA
FT                   PFSKWAFGVSRLVLALLALLGPLLYYSTYNPSTMANSATQLNFQLSFFGAYDFFATTVH
FT                   DNVTTPEGWWTWIERTRPTLGSYDLMAVGKTVQLMEFTSCSSSLWMASPQAVRQVLAGL
FT                   RAAASNASSAYMLQALEVSRSVSSTDAAVAASLVNHWPIPWDTAQDLVTILEQETSDTR
FT                   EAAVADSQNSSSSVVGSASLPFFYSPFVFNRASRIDGLPTNLRFPHRNHHNCTLELNHD
FT                   RDVALNSVVRYWCLHCAPLFPGGNIPSENSSSAAEWRCLTTGEGCDDFNYEDATDGSGS
FT                   STVRAPLAAQMHSRVAAKQVSIYMVIISDTVVMGISLLKGVGIVALYTTFVLTLGRLLR
FT                   SVLTNQTSTLLYSNMANPAALENLVRCMEMAREYGDLRLEHAIYLELLDLLRSAERLFR
FT                   VTGSLRCMYGDAGHEELLGLGQVRRRNSRRNPSVEAHEGEAGEGHGEGHGDSGVPAAVS
FT                   HPAHGG"
FT   CDS_pept        complement(1311587..1312174)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26188"
FT                   /db_xref="GeneDB:LMXM.36.3350"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB4"
FT                   /protein_id="CBZ26188.1"
FT                   /translation="MLRLTQALLRVQSHQKKRAQHPNAGTRYGRVYNRGFVRYGFGGFG
FT                   MSVYTPKKDRTFKVMPVSPPPPATTAVEQRDDLADNRSLSTTTRTLSPTFRMFALEDGG
FT                   VFVSHPSHAQIMRWNQRVHTEEGKAANSTVMDEYVNSRIQAIIADNTIENTSLSQWRKA
FT                   HMWNVIKSHGKLQRRWGMPDFVTGARSTLYNN"
FT   CDS_pept        complement(1313991..1314662)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26189"
FT                   /db_xref="GeneDB:LMXM.36.3360"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB5"
FT                   /protein_id="CBZ26189.1"
FT                   /translation="MASQPGDALGKIDYWVQYIDCALKHPRPLPAGKHAHRQSLETIPE
FT                   VAELYHCIYKLYSEEESSVWFREPVNALAQEIFTYYDVVKSPMSLRHILDNIVKGDTYS
FT                   TALQVMEDVELIWKNCITFNGANSLLATEAGKCRSALDRIRRAYQDDQRITVEEAERLF
FT                   RVISSMQEQQLIDNIAEYLRRDDPTSIDETGAVNFDMLKRKHFRNLERIVDNYSKSRTR
FT                   S"
FT   CDS_pept        complement(1315747..1316055)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26190"
FT                   /db_xref="GeneDB:LMXM.36.3370"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB6"
FT                   /protein_id="CBZ26190.1"
FT                   /translation="MGLKRLAKAAKITSKHMLLLNRREPYKPVTSDRVMIENRRRLDDF
FT                   EAKNAEGIVFVPDTALPPWQKSIATNLKQQATQMNFRGFRVRVADKQDEPGFPTHFR"
FT   CDS_pept        complement(1317144..1317560)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26191"
FT                   /db_xref="GeneDB:LMXM.36.3380"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB7"
FT                   /protein_id="CBZ26191.1"
FT                   /translation="MFRRSSSVMRRAVSAFLKEPGQAKTFQETLAVCKAENRDLASMLS
FT                   SDFLLLQSKLFKYRIARLGEEVRYVMKHPLGSLPSVDMVPVHLVALPLVFFAGMCIGRG
FT                   SSCPLVQPPTAKMEVAAAAAATADADAAAQKERK"
FT   CDS_pept        complement(1318495..1318707)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3390"
FT                   /product="putative ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26192"
FT                   /db_xref="GOA:E9ATB8"
FT                   /db_xref="GeneDB:LMXM.36.3390"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB8"
FT                   /protein_id="CBZ26192.1"
FT                   /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNAR
FT                   RVRKHNQKAALKKRRERIAAFAAKN"
FT   CDS_pept        complement(1319835..1320047)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3400"
FT                   /product="putative ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26193"
FT                   /db_xref="GOA:E9ATB8"
FT                   /db_xref="GeneDB:LMXM.36.3400"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATB8"
FT                   /protein_id="CBZ26193.1"
FT                   /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNAR
FT                   RVRKHNQKAALKKRRERIAAFAAKN"
FT   CDS_pept        complement(1320546..1321682)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3410"
FT                   /product="short chain dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26194"
FT                   /db_xref="GOA:E9ATC0"
FT                   /db_xref="GeneDB:LMXM.36.3410"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC0"
FT                   /protein_id="CBZ26194.1"
FT                   /translation="MDLCTPSSPRLPLPFPLYQLSLSVTSHLQHPPHILTHIRACAWLY
FT                   GHHFHCFNDAAAEKHNSKSASSSSRPGMSRVALAALLSLAAALLSRHVYRRVNRHRLQA
FT                   GAVALITGGGSGLGMELAKIFAVSHCEIVLVGRNEEALKTAAQVCREAGAPRVEYIQAD
FT                   ISKAEGTDRVRSEYTRLYKGTGRSLAPPLKYLVLNAGAGAIAPFTTEPAFEQICRDMMN
FT                   INYFANVRLLQAFLPQLTQNHSSSSPSRIVVMSSLAGVLPSILRSAYTASKHAIQGFMN
FT                   ALRGETAVRITLCCPGYVDTDFHSRVLTNDGKPLGGNQRRGVSPAVCAHQCMDGVLCDD
FT                   AEIVMTTSGKLAYRLRPFLTGIIDVLVKRKSLQSLEHH"
FT   CDS_pept        complement(1322254..1323339)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3420"
FT                   /product="vacuolar protein sorting-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26195"
FT                   /db_xref="GOA:E9ATC1"
FT                   /db_xref="GeneDB:LMXM.36.3420"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR028934"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC1"
FT                   /protein_id="CBZ26195.1"
FT                   /translation="MLRDELPPEKGQQSFSLLSRILRSIDGCKLEIVLDDKPEEDKIKV
FT                   VDIYDKVSERFPLYSWREPVKGRVVVTPTGSSYSHQGVVVELIGVASTFREVESRVVFL
FT                   RQERQFEPDTLNQSTPFEFIFSAPKEHESYHGIYAKVKYCVQATVKQRIKSASVKEEVW
FT                   VHRVDAALSESQPDASAHMNYFRETCFGPESIAMNVGVDNVLHIEFRYDKKIFHLAERV
FT                   LGKVEYKVADMDIAYGEVGLVRKEFLAPGQAGETMESETLQKFEVMDGTPIVEEVVPIR
FT                   LYLKSVPRLTPTYMNVENLFSVRYFLNLVLVSQEGKRYFKQQEIQLYRRTGQERPATSS
FT                   SPGPPVKPASGDVDTKGGWSA"
FT   CDS_pept        complement(1324664..1327045)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26196"
FT                   /db_xref="GeneDB:LMXM.36.3430"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC2"
FT                   /protein_id="CBZ26196.1"
FT                   /translation="MSGKASEGAVAITPGDWKAQYERDFNAQKSSGPIIFSEAERRKNR
FT                   ELFSRLRDILPFDDAYKVSDCDLMYRFLIGKHWNVASTEKGMREYARLRKSDGLNNIIG
FT                   ERLHPAICSALSPMYKDEPCPIYGLDKEGLPVLWLSPDPDKFMAAMKEFTSEQLLRFQL
FT                   RSMEMSRHVCLQRRVDRCTYVIDLGGITLSSVNKATLAFLKGVMNLLQVAYPEIMRRLL
FT                   IFNTGWAVSAAWKVLRPLVDVRVQDKIKFESGPPTLAALQQYIEADQVHPSFGGTGSAN
FT                   VLGPIIDAEVSRIRGDVEGRVSPEPAAAAAASVVHRPSLELRQNASFLSRDALTLYSVE
FT                   STTPLSTASPSPSCNPSLAAGGHAEERERVVIGMPSAVTAWLVKTSTTSGPLNVLDVSL
FT                   SVASSSGEYACCKEEPSPTPPADDATKCFYSGVASPSSRDLSAGDTAASSRESVPIHAT
FT                   KAIEPTAQQQTELPIVAISLTYGADGSISGYCGRQWVGCFQQGLLYAPTTDDDGSAFPG
FT                   RFPSLLPSSQSSVAGVCAGRSVGVPTGELLNEAGHPLHNFLIVCDAQRRARFLVRESRL
FT                   RKRLTIYNVVGDAEVHTEKNNRHYVEGERAKLGVVVPHSNATSCGGKEDWMLYGEDVTR
FT                   RSSRNPTLPLQQLFSKTKRAVLSAKKRRSGDSLDKPRNSRWTASIFAALHFRTHSPSKR
FT                   KSKSTSSTASGSANVPPPSLPDQPENGCDTVTDDRAQLLAECKGQTVRFYKLLTKNSLP
FT                   DLFALAVAITHSWSNEMDSCKGKAVASTETRYFSDDDVMP"
FT   CDS_pept        complement(1329960..1330613)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3440"
FT                   /product="SNF7-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26197"
FT                   /db_xref="GOA:E9ATC3"
FT                   /db_xref="GeneDB:LMXM.36.3440"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC3"
FT                   /protein_id="CBZ26197.1"
FT                   /translation="MPIFGNVFHRTTPEEEVRMWTRSLRSEQRKIELQITKIRREEAKV
FT                   KLSMKQAAKQNDQVVMRMLAKEMIRSRKAVNRMYASKAQMNSVSMQLQNQVSQMKMSGS
FT                   LKKSGEIMKEMNSLVKVKEIQQSMMAMSKEMARAGLIEEIMNDTIDEALDDDISDTELE
FT                   DEVNKVVMDVVHGQMDGARVGASRIPAQQQQQQEAAEEEDEDELMEKFNALRNS"
FT   CDS_pept        complement(1331708..1332565)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3450"
FT                   /product="glycosyl transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26198"
FT                   /db_xref="GOA:E9ATC4"
FT                   /db_xref="GeneDB:LMXM.36.3450"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC4"
FT                   /protein_id="CBZ26198.1"
FT                   /translation="MRTSLLWRLQMASRPFSLERIFVINLDRRPDRWTAIQAVCARAGF
FT                   PAERTERVPAVEGSRLDVNAVHRCRFVSALGLRRLKEPPEHHIWGMDLNKAALGCALSH
FT                   IHLWARIAALGKVSNVSAEAPAAALPKQCFLVLEDDSTLAESDDSGSSSPAASPSHPFL
FT                   NQLQRRMNSVPPDWELVYVSGLDTARQCPHMQVAKGVARVPQYHRTTNAYLVTPQGARR
FT                   LLATCVPLTFQLDTVMTMNVGYPPGVVGVAGAQTLPHVLDPVCYTLQPPLMQQAAQLGT
FT                   DIQH"
FT   CDS_pept        complement(1333572..1334174)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26199"
FT                   /db_xref="GeneDB:LMXM.36.3460"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC5"
FT                   /protein_id="CBZ26199.1"
FT                   /translation="MLRLCGRHLGSVKSASHVYELRTYVVAPEKYDSFHQLSMKYMPQR
FT                   PRIGICQGCWTVQLGGVNQYIQIWRYENLKHRYDCRKQLEQDHEWLRTYVKPADDMMIS
FT                   KSNTLLRLIYREGNASTQSYKYLMQVSPHKEVELSGPSAILAATFQVVVGEEEGKYIHL
FT                   VKGHKLDDVIPVTPTLGCSSKIMGPVRWSSTMNCLWR"
FT   CDS_pept        complement(1336385..1339423)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3470"
FT                   /product="2-oxoglutarate dehydrogenase E1
FT                   component,putative"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26200"
FT                   /db_xref="GOA:E9ATC6"
FT                   /db_xref="GeneDB:LMXM.36.3470"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC6"
FT                   /protein_id="CBZ26200.1"
FT                   /translation="MMRRLMPVRGVVSCVSAVAPTIAFPRVSHAALTTGRRHAAEVVPE
FT                   RQLLFDNDSFLSGTSAMYMDELYQQWKRDPASVDASWAELFSRSDLGNYDHALLDTPIC
FT                   VLPTDSSDETVVKQSLADCGRLIRMIHTFEDRGHLMAQTDPLNYMDTDVTERTPSRRYK
FT                   EMVRLDLAYFGFSDKDLDRVVRVGFQNQMGGIYDTSSPPMTIRQLHELLMERYCGQIGF
FT                   ELVHLTDGDAKRFVRSQIELKDGSSVLHRPMSREERLRIWDTVASAVFFEDFFKRKYST
FT                   QKRFGCDGAETMVAGLRALLEKSSEFGVQTINLGMAHRGRLNVLCHVIGKPFEVILKEF
FT                   VGVTGQELHPFQIQSDVKYHLGYRGQLKLNSGKVMETEMLYNPSHLEAVNPFVQGYTRA
FT                   MQVSLGEKGREKVLPIEIHGDAAFAGQGVAFETMCISEVGEQDTGGTVHVVCNNQIGFT
FT                   TDPKSSRSSAYCTDLGRVYNCPILHVNGDYPEEVVRVFEFAAEYRARFHKSVVIDLVCY
FT                   RRFGHNENDDPSITQPLMYERVRATPDVFKRYTDALIAQGIVTPQQSTQKAIDEKARYG
FT                   SYQEAAAQVNYAEYLKKSIPDKWKCMKYSDELGNVTQHPTAITQETVNKVLKTLKTYPE
FT                   GFQLHPKLKVVLDRRNETIETGEGIEWGTAEALAFGSLLLEGHQVRVTGEDVERGTFAQ
FT                   RHAVIHDQSQERTYVPLAHISDTQGRMIINNSPLSEYGMLGYAAGYSLYDPTSLVIWEA
FT                   QYGDFANGATIVFDQFLSAGESKWNQQQSCIVTLPHGYDGKGAEHSSGRLERFLQMSSE
FT                   DVTTPAYSKEERAHRINWEITYPSTPAQYFHLLRRHQKRNFRKALIIFFSKKYLRAPNV
FT                   STLEEFTSGEFQPVIPDLSVPASQARRLVMCTGQIYHYLNKYRETKGVKDVALVRVEEL
FT                   SPFPVAEVQQLLAEYEKAELMWAQEEPKNMGSWAHVEPRIDEYTKGERELRYAGRTITA
FT                   APSTGYKSKHDKEQEIICEMVFQ"
FT   CDS_pept        complement(1340913..1341542)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26201"
FT                   /db_xref="GeneDB:LMXM.36.3480"
FT                   /db_xref="InterPro:IPR026714"
FT                   /db_xref="InterPro:IPR028124"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC7"
FT                   /protein_id="CBZ26201.1"
FT                   /translation="MTSFKDCLREVREAATEHLEGCRGGDTEKALQHIPREEALTTISL
FT                   VAIRLLEQELQKRGADNDASQHELHAQLKACRKALKSHSARSAAGDEGASDKKRRRTEE
FT                   STEAPTFSSSSHGTATADRSGTSKSIELGQYASSNAFDQNEQKRMKFARLMGGAKLTAQ
FT                   EKGSAGGHSRHNTFAASNVELKRMNANLESQFESAISHKGKKGLGA"
FT   CDS_pept        complement(1342446..1343465)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26202"
FT                   /db_xref="GOA:E9ATC8"
FT                   /db_xref="GeneDB:LMXM.36.3490"
FT                   /db_xref="InterPro:IPR021298"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC8"
FT                   /protein_id="CBZ26202.1"
FT                   /translation="MVFVVVKGTNYPDEFTVERALTDALSSSEETPRGAADVNSPPHAC
FT                   ASLPSTGTIVPGIAHILNKRHHVRLMLMSAQELATLWPQHQHRCDGTASTEPRENQEPE
FT                   EVLGRYQALIDGLYARLKDAKDPVLADEFDNAERELRALTATLYSSLCTHADGPEAAVQ
FT                   QLYTKHEDPDLDEDTRLVVYHCRALLDPEWKANERVEEDEAALWFCGKPMEATLAKYCG
FT                   RNEKSKVIVKVAPRKGPAPSCEPRMRYEDQRALYRAMCQRREAYKQLEDSELRDRVVQQ
FT                   SWSTGRLLLGAAAASSSHSEGKRMMTSLGSGTSSPATLCTDGLRPIFPCKEERELPIS"
FT   CDS_pept        complement(1344234..1346696)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26203"
FT                   /db_xref="GeneDB:LMXM.36.3500"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATC9"
FT                   /protein_id="CBZ26203.1"
FT                   /translation="MTDPFLEAGNPLELEVTRLTQENRELRQENARLRARISLTATPSA
FT                   TASNAVSEQSSLRRAVDTAAVPVGASPAAKPLDKPGGALSQRSTRAAGASTPKQHQEQA
FT                   VSTARIEEAVQRVKKELRGEVEKYQKAAEMKASQMEQLKQQFELFVTTTCEREAAYELV
FT                   YMQLFRELEEQRALARTAQAQLEEQRLEAVEMRTSLQAAAAAAAASFKCSTLASVSPSP
FT                   PSKSEDVAVPSSSSAARPAKKCRIGKSAKHADDGDKSNATETQTTQEDVVEVQQEVTVT
FT                   VPNATPEPRQLRIVQGGAALRSDSKASRLKRPRASSATSVSSATRSTRTRQSAVALAQL
FT                   HMPTSPVFASASVSAGDGAVEVAVTSSSGMFATASPPGASASSPARRTTSDALGDLWTL
FT                   LARHTEATHGFLPLWQHLARLRGSDRLAALRVMISLLLHLLGPADATMPLVLPAPLSTS
FT                   VAAPPTSITVLATAIRLLEVQLESEAQQQRGATVSRADATAQQCSALFHSLFYRICVAT
FT                   LRRWQTAEVGADAVDNWATALVHLYGFQPALSKLAQYTNSTIAYERAHLAHSWVTYTAQ
FT                   AIFAQCFTSSSTSSAEVAVARWRELCDSIGWSPHSLPLERLETAAARCVARTRVGLGPF
FT                   IAACAEEALLSLRLVVLYRGFDHMERIAALLEMPGVLPMVITKEIYAELVSLAVMDRAP
FT                   FRTADAIQHALRLLREYVQEVSPERCTSAEHFVSVPRLSHLLAALALLRVESTNTAATA
FT                   RGTEADSVICEAVQASRQTALRWLQAQKVALNMVRQSAALARDRQLLLRDTALGQRLLR
FT                   DASATVHT"
FT   CDS_pept        complement(1347727..1348227)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26204"
FT                   /db_xref="GeneDB:LMXM.36.3510"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD0"
FT                   /protein_id="CBZ26204.1"
FT                   /translation="MLSSTGAAAAAAKPSAGPLNVALATVTVNEDPNIEVLLASKRIQK
FT                   LTRATDALIARDFVLREEEAILDDLEAYIISLESEVRKAEFQTEELRSRSSLLRSGKRC
FT                   AIAGENAELSALWNEYGSDMAHLVKRHSLRLAVLEKALATASTRNPESPVPKPLPPPPV
FT                   AKT"
FT   CDS_pept        complement(1349392..1350171)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26205"
FT                   /db_xref="GeneDB:LMXM.36.3520"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD1"
FT                   /protein_id="CBZ26205.1"
FT                   /translation="MTVAGAAHGGDSHAHDGHRGHDGAATAPYEKIKAPSMASEDYLDN
FT                   LPAFDTKKPMPKPRSAVERFTRVLQMQFGQDPDMPTLGYNTERKYHSLLDYLASPITPL
FT                   RPRTYVDSHTRPNPCPEEYWWASWRWPRTKYVNAKVPPPVDGKYTDYYHYLAFKNWLER
FT                   ERDVYVAHANLVHEMTSRCLVKEGQYNAAKNCRHLYHKGFAMSRMEEFNQAMLYMAMTG
FT                   NAAIRETPYPENFVEEKRKIYDDWLYRTRMRKPGDAA"
FT   CDS_pept        complement(1352798..>1353040)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3530"
FT                   /product="putative polyubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3530"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26206"
FT                   /db_xref="GeneDB:LMXM.36.3530"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD2"
FT                   /protein_id="CBZ26206.1"
FT                   /translation="KTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
FT                   EEGRTLSDYNIQKESTLHLVLRLRGGCQVGFSVTL"
FT   gap             1353043..1353142
FT                   /estimated_length=unknown
FT   CDS_pept        complement(<1353144..1353155)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26207"
FT                   /db_xref="GeneDB:LMXM.36.3540"
FT                   /protein_id="CBZ26207.1"
FT                   /translation="MSTS"
FT   CDS_pept        complement(1354278..1357853)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26208"
FT                   /db_xref="GeneDB:LMXM.36.3550"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD4"
FT                   /protein_id="CBZ26208.1"
FT                   /translation="MQLQSCAPEHFSPPFFSSPSSSVACEPGCSLDALERLVHFTGAGA
FT                   DACFYTVHPSQAEGTDSAALNPTAEGLRYWLNPSVRTRPTTATCEITNLGPPFFASTST
FT                   SVLRISATPLFVDGRCFPTRCVVSLATSAQRLDGVSLRPVVVTEWNLTASGAAGVCTTT
FT                   VPLRTFYHLAVLISSSTPATGVEAVRLYLHLRFMGCSDGSDTHRIAAVRLRYEQLGTAA
FT                   EVLPQLLQRQQRTAARVMLPPSLYNVEDHCEGPVTRAGAPLEEVVGVTTSRSACSSGGK
FT                   GVGDNVGNGRFIGAKERRTPTRPLPSTRMWSEGSEDAAGEAQQQLLRSPPQRSATRPRA
FT                   ERSPSTDRSSSSWIEAVDPTEGRDVPKLVCVDRALRIPPPPPKSATAAGSAPPPLGGPW
FT                   PPRKVRTIVLAPSISPSLCSSSAGTSPRGPPSPLPSPPPATDADFSANAHLSTSLAGTA
FT                   RCRETESCDREGFEDAVHALMPLTQQNVQGRLLESTKFDKRTSSPVSTAGTSSQRRHCH
FT                   ESSSVLRQIPLAEAQEVSQAVAENRPDPHPRPFAPQSLYAHSDPAVLWAATSLLGTLPW
FT                   TLAGQYQSRNSTPAASVASSRAPSCDGSAQAMSKDSAKGAPCWQMRQPDPSKSFLDPGS
FT                   YAHRRNTRQPQQQSWKRTPLGALDPNSSSHLPERTTVPAKADSAAVTRTYSTEFTTAFF
FT                   PHWRRDERAHVSPQLHPPHLFATASLSPSHSEPFSRPSILPPATTHALLQRPTSAFVPR
FT                   LLLRSGQRSHEAHAASSTQRGGGAIITTSSRSSGSSTANTATAASAPPPPSQNRSLWSK
FT                   AAASAGVSSSLDVKPRRSATADVHERRRLSTAVFPMSSSAVLSVMPSSCLRSNATAAPE
FT                   ASTESAAEMKSQNSTASQRSFRSSTAPPSSCRPQHVSSPAGAAVAECMEDTVSVASGSS
FT                   APLPPSSLPPHQSCALFHSPAPTHSSRSSSSSSSSSRPRATPALPLQEAHDSNRNRSRP
FT                   RQRSFTRPDGGHGSNSSSAFRQCVVQGLAVWKHHASRRGVGRRWLRIERLPPSSSTSAA
FT                   VCFRITLDKVHPPMLARASMLLGRSSNSSGNNSVHASNPSCEVCIRWADTVEVWCGLRA
FT                   YNSGVIHQSKVHRAECCLVIRCNAQLVTAVELESTEAVDTVRRLLSDRQLTPHANRQRA
FT                   VVAGTEASSASARERARKVSVPANM"
FT   CDS_pept        complement(1358839..1360017)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26209"
FT                   /db_xref="GeneDB:LMXM.36.3560"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD5"
FT                   /protein_id="CBZ26209.1"
FT                   /translation="MRNKEAADYYRALPQNELSKEDMWRRINEASADRAEATGTAIGSA
FT                   EVDYIKLEDELRDFDLFHYRIGEMGYPDQAMRRDYYALWNLAMSLNKARWSMLEVHSQH
FT                   GMKSTGAGMKLIFWKESVGAIMEKRKMCTGQFTDSHPVLRPFAAAVERNPHMTKAFVRG
FT                   FTDARLRVIQQPGNVQQLFDHFDKFYGYFFNSLLEVTHIKDEATEHLMTHIGRATGLTN
FT                   HCVMFWKKYARLGFTMLPADLCADNHVNLGLLKNIPLASRDRAVRKVLFDVMCIVKDEM
FT                   LHAQKCAKDVPPKAWPIVMECLYANYYLGFLQRRDFNVSAMFADHNIENAGFTWYRLKK
FT                   RWEWERYQSIERLVDESAPLPYINTSFAHRGSHYKMASGVGSGAPQTQRKRS"
FT   CDS_pept        complement(1364416..1366233)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3570"
FT                   /product="putative signal recognition particle receptor
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26210"
FT                   /db_xref="GOA:E9ATD6"
FT                   /db_xref="GeneDB:LMXM.36.3570"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD6"
FT                   /protein_id="CBZ26210.1"
FT                   /translation="MIDTLSIVSDSGVVLWQCTTHETGRRTMVNKLIQEVLLEDRAGHA
FT                   QYNVDDYQLRWTLENDARFFVVAVYPKFFKPHYMHVFLRDIATTFAKKYGKQTAQQDFF
FT                   FNTQGSSKQVPAANLMEFSAEYAALLAKFNASEEAASRHGVEGEDRDEAACSGSSSAAG
FT                   EASNSVSAQEDDADDDVYGDSPQQPATQNAGKVIVTKDGRRLTIGGGPGKSNASGASEA
FT                   AASSGSAKKRGKKPTRWDNPGAVHDPMVEKQLHEKKATEAELQAQASIQRETYIKRLPN
FT                   GAIAPVKEREWEGQSRGRLATWLRSYVGTREVDAEDLKNIIPDLREKLIAKNVAVEVAE
FT                   HVCKSVEASLAGKRLGTFDSLYKTVEDAMMASLRRILQPKREVNLLRDVAAAKAAGKPY
FT                   SIVLCGVNGVGKSTSLAKITYWLQQNGNSVLLAAGDTFRHGAVEQLGVHGRCLGVPVFQ
FT                   LGYGTDPSAVAAAAMAQANKQHIDVVMVDTAGRMQDHESRMRALAKLIHDNQPDLVLFV
FT                   GEALVGNNGIDQLRKFNQCLVDFAPVGSRSRGIDGIVLTKFDTIDDKVGAALSMVYELG
FT                   QPIVFVGVGQTYQDLKVIEPEVVVSALMK"
FT   CDS_pept        complement(1367164..1368567)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26211"
FT                   /db_xref="GeneDB:LMXM.36.3580"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD7"
FT                   /protein_id="CBZ26211.1"
FT                   /translation="MHFSQYPLRLTDLERQKLQLIVAALKVSEYTDDVDDFMRPYGKEG
FT                   RMEVAMREFIDIVVGLAIASDAIPRSVKNSFLAGEVKVATVVPLLEDLFEIMRRHKRLN
FT                   PFSHRGEFGKLMMMLQDVQKQSIQRALAIQSTLVIPVRTVEAALSSIHCETLADDEVVR
FT                   TDYLKRKGAEKQAGMQSLIERYGKGDGHRKEVIEHCLRSIDDVYSFIQFNTRPLRTLRR
FT                   WLSRDFESLPSDDVYSISIRHGRGGACFTHSHATHCQYVAESLLLWENVQKNILNLWEA
FT                   AEDDMLVEGQGQYVVSNTGQGFHRMCSAPRSYGVMSRLVRDTEQRMGGWVGIKVIHLGD
FT                   RDVPNPLVFIDKYTVIPRLVKPVVQTLHALRYVFHEEDEEEEGQPQVAHEYDNYPGLRN
FT                   LLRSKYHSYAELMMMILSDFFKHAFDGSGDDGGSCIDGRLTSAWNWCHQLHKKKYYDAF
FT                   VLTGFAGFD"
FT   CDS_pept        complement(1371047..1372048)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3590"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3590"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26212"
FT                   /db_xref="GOA:E9ATD8"
FT                   /db_xref="GeneDB:LMXM.36.3590"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD8"
FT                   /protein_id="CBZ26212.1"
FT                   /translation="MAAPFDKTKNVAQSIDQLIGQTPALYLNKLNNTKAKIVLKMECEN
FT                   PMASVKDRLGFSIYDKAEAEGKLIPGKSIVVESSSGNTGVSLAHLGVIRGYKVIITMPE
FT                   SMSLERRCLLRIFGAEVILTPAALGMKGAVAMAKKIVAANPNAVLADQFATKYNALIHE
FT                   ETTGPEIWEQTSHNVDCFVAGVGTGGTLTGVARALRKVGSHARIVAVEPTESPVLSGGK
FT                   PGPHKIQGIGPGFVPDVLDRCLIDEVFCVAGDDAIEMTLKLTRSDGVFCGFSGGANVYA
FT                   ALKIAERPEMEGKTIVTIIPSFGERYLSTALYRSVRDEVSSLPVVDASELQD"
FT   CDS_pept        complement(1372714..1374138)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26213"
FT                   /db_xref="GeneDB:LMXM.36.3600"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATD9"
FT                   /protein_id="CBZ26213.1"
FT                   /translation="MSVEKTFEKFCAMSALQQRRDGLLVPSETSHSFSYYQWLEVAKAK
FT                   YAESQPPASSSQGQQRPPAKRAKAEDGVSDSGNALADGLAQQLAASLKSQTASANSPAA
FT                   LRHAAQEDFPMPQASADMLAFLALAEAAIRLTLWTPEDERLAQLAACLRPNLRTLEERR
FT                   IIRFYYGCFPSLQVLMDLLSWRIIVHRWERLAPEMRQVAVDGVLTLCDCLDSVATEALR
FT                   SAVQELPVSAVSSSSADTLELTTLDTLVRHASAAVPFQFATCRDLTPLYPEPVGVLHVP
FT                   GAPAASSESVLRDEQQSQPADEKRVDDDAEVQLGELLGVTCTPTRTVCASAEEESPTRR
FT                   TQAAPVVAPPFRSILKTAQRTSGGARPFTGVTQTRHGIPMRTASGHIACMSQYHARYAD
FT                   PAKHASSECPYCATCHLMEIIFRGNKRNCVWAHWPTPRKIRLHLKQFPKVMKLAQERFA
FT                   AMQRGVQLAATDELPL"
FT   CDS_pept        complement(1376455..1378086)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3610"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26214"
FT                   /db_xref="GeneDB:LMXM.36.3610"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE0"
FT                   /protein_id="CBZ26214.1"
FT                   /translation="MECTDTLLLIASYLTKRELMALSGVSHLCWKIVSDSFISYEEKRY
FT                   LVWPCLKDNYVELAPPSQILALGVLEREQRLLVLVRSGTDTSNIDEMECYLYTQLVDDN
FT                   GDLVEHQKELPACFAFPSSLVHFSGNRFLLCKTREGDLHVFDCLIEAMIEVPVGTDGFY
FT                   ASPDGDHFLLDYNRHVFFCTASVHIACWWEMTRVDPKQHGGTYSAASNQLPSALVATHL
FT                   RAQIVPLPDPFSSCSESTSGSTLAHMDTTHPALPLHFYLGTSSAAWRTFWMGSSSALCA
FT                   NEDGVRLLKTSNCPEMVAERLTSLSSSCSDFVDSSCGDVYGSPCEDRDEYAVMNCREVR
FT                   LHTVSYWPKRRPTTELRAIDLNAIVPSCVTIKSVRIAVSRVTYLVYMQHQDLDRMLLLS
FT                   SDLTLTRWISIGRPSCYVLWRQQVSLVTASLSDGAGDNFHPLVEAVEGGLGCVYTFGMR
FT                   LPEVSSTAAADPFVTTVKVTSAVDGGVGPAGAGCFLMLPQSFTGVEVLSWMAFGVVSSS
FT                   LLWTVSALCYNGWWLHLQLLIRGRVA"
FT   CDS_pept        complement(1379921..1380232)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26215"
FT                   /db_xref="GOA:E9ATE1"
FT                   /db_xref="GeneDB:LMXM.36.3620"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE1"
FT                   /protein_id="CBZ26215.1"
FT                   /translation="MQQSLIPGHNNNRHLTYEEVENNIGGLPVTDNRIQDLFDSLDVDH
FT                   SGAVSVEVVKRFYMGLEHYGVDLSDKELDEMVRKHAATHEESLNYEEFACFVLSLAQW"
FT   CDS_pept        complement(1382802..1383695)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3630"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26216"
FT                   /db_xref="GOA:E9ATE2"
FT                   /db_xref="GeneDB:LMXM.36.3630"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE2"
FT                   /protein_id="CBZ26216.1"
FT                   /translation="MHRVFLVGSSEAMATTTSTDSNVNCNHGVWNSATLTCDCDAGWNT
FT                   DWLNQDVLGGNYDYCNSQASTQPPSNSTDGTTFFLADKSILVIIVALAVALAALCGIVA
FT                   FCCYRKRRRRAKEEAKGAEALAAAANEKARRQEELQLQQMQMQAQEEAALQQQLLAAQL
FT                   EAQRQNQALLNHLVNMSTMSAAPNSQFSASSRHHRRHWHEMLPRHQGEVDYACDANYEA
FT                   GNSFSETFDGWGSPESFVQCPSSYRRGAPLSTTDGYDNYSEILPSYYPATTTEAPQREA
FT                   QSPPPYAQLSFLHPPF"
FT   CDS_pept        complement(1384170..1384535)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26217"
FT                   /db_xref="GeneDB:LMXM.36.3640"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE3"
FT                   /protein_id="CBZ26217.1"
FT                   /translation="MALVISDEATREAERILACSNSFEILELNPSNCTKEMVLKQYETK
FT                   ASLFKGLFRNKLAMQAKAKLGNAKVRLADTQLREKEIAALKVLQIDAHKDYAELQALEV
FT                   RTRVLEMRAATVQGEVA"
FT   CDS_pept        complement(1385031..1386212)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26218"
FT                   /db_xref="GeneDB:LMXM.36.3650"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE4"
FT                   /protein_id="CBZ26218.1"
FT                   /translation="MQEIIDTVNRYTLRSAAFRDKPTPGSAARQFLCSLLLHRQLDSIR
FT                   LSSIAHYMFSTEALIAVSRDGIQTISCEGNTLWPICTIPNGLTSEISGVAVTPEGTLVC
FT                   SSNGICYLEGGSLGVTEDCVSSSYAQNVLCISCTPDGKYIATGGGTAMVTVWTSDLKPL
FT                   HHFAGHTDWVRFVKFARGRSPALQLFSTGDDGVICQWDVLAGSLISRVDYSLGESIQLF
FT                   EVSYYSGLIAISSGTSLIALYRPRSDNTTRAVGEDVLRLEPMALITGAHDYTPTAGKFT
FT                   DDSQWLASASEDETIALTYVPDPQTCFVCKEFVTRRRCFSFMNIFNSICILAAPPVSSV
FT                   IVIAACSSDGTVVQWVVDPRTNRASYTKKLQLHLGSFLGMDLIPGDDLNNLLW"
FT   CDS_pept        complement(1386687..1387280)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3653"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26219"
FT                   /db_xref="GeneDB:LMXM.36.3653"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE5"
FT                   /protein_id="CBZ26219.1"
FT                   /translation="MLCTGPRRAVFHNAPSVYPFTKPFHDTPYDQDRGRFDKTKNILRE
FT                   NKWPAWMDHGADGTGFGIGLNRTHPLSKLRGNLRRNPSEVPRVLNMMIQGVWHKSGNKL
FT                   YFRGGKPPNPSTHPYLTGEPCPVYGWKITDPGVIREFNLPQPEKDKTRYKPYVALQERK
FT                   IMGMQAPMKEQSVVPTSAESTDSKPLMKRLFFWK"
FT   CDS_pept        complement(1388184..1389941)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3657"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26220"
FT                   /db_xref="GeneDB:LMXM.36.3657"
FT                   /db_xref="InterPro:IPR011677"
FT                   /db_xref="InterPro:IPR040354"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE6"
FT                   /protein_id="CBZ26220.1"
FT                   /translation="MLQGLLCLLLLTTSAFAYPIVVVPVDWANVPTSTPDARNLNSPYL
FT                   GECVCDVTRGICDSFCCCDEDCDASARAAFSYCLPEKYSSPYLDYCYPKDRATSLKRIN
FT                   RKDATYIEKKLQGYNAVCVIRTNHPSELYRYFRVPTDVRQPLLPTTPTEPVTVSQPYGV
FT                   GDPLKMVKYVVISGSPSYRRVAPFQLPTTMSDGSCSAIGRNVGFLDSIKGTSCTLNGAQ
FT                   ICLLFPVAKYQNLFLQATLRYNSSVPEFVPVTLNLHDSSGVLLDSLDPTFVPATSTYAT
FT                   ISDAKTCNNAIIDLEAHFSYSSNESGKLIEAVLNVTLGSVGLMQYVALSFEAAFTSENA
FT                   TVPRNIFAATPGYLSGDKIRSGTLVNQGEKSAILERESGFVVPAGGRLCGSNQWKRASF
FT                   LHSIISSGCLVLMNESELQDICSTGTGHLLAALINVTVDGIPTILDQIGVTNDALTNDT
FT                   TSWISISGLSNALTPSSGTYNAYSRQCSNITVGLHYQFVVARAGAEYNPQDIIVGAFAS
FT                   PIIGTFQIWNETNFNGDALSYQQLTFKVSFSRYDPNSQATIMHRIVAPPILPPLDDSIF
FT                   YPFRSSHPV"
FT   gap             1390342..1390441
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1390704..1391537)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3660"
FT                   /product="nudix hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26221"
FT                   /db_xref="GOA:E9ATE7"
FT                   /db_xref="GeneDB:LMXM.36.3660"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE7"
FT                   /protein_id="CBZ26221.1"
FT                   /translation="MTLISFPLHPPGALLTVSSPPFPPPHKSLRPQRFKAPSQFHIQLQ
FT                   VLSVLRATQTMKHTYVRTGLEVVSGLKFTRLCALSYTASGDGAHPGNKWEMVQRTTRST
FT                   PVSAFERSPAPIPVDAVEICAVVRRSSERFIVVVAQYRPPVDSVCLEFPAGLVDENENA
FT                   GQAAIREMHEETGFVVDEAGIVSISPPLSTEPGLTDSCCVLVRLDVDGERAENQKPKQR
FT                   LDDGEDIEVLMIPISEPKSALNALSDVVKRYAEKGQRAIVDAKLYTFMEALAWGV"
FT   CDS_pept        1392199..1393218
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26222"
FT                   /db_xref="GeneDB:LMXM.36.3670"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE8"
FT                   /protein_id="CBZ26222.1"
FT                   /translation="MITLATLSFFFCSSAHHQKQRNLVCVMKATSGRAPLLRMLDDCQV
FT                   LSFQRRWHLIKGDRKQNEELKKVEFAPTFEHDQIVKGAESGPSAGSSTTGDEPTEPLSE
FT                   GLTNTMGETPYRVSWYDFQTVSPAKRFTYWVYRRLRDLPPEWQEYYRRMVYQEISASRY
FT                   VNQTWDCFMMVVDGYRKAKWVLRKYGVKVDESLIPRPYNNFWEETTHEERVWAHRRSHQ
FT                   MKELQALQRDDDEAVFGASMMNRNEVSYTSIKNLQTGMQGGTPLHAHDLPAPKESELRM
FT                   SRQDEEMSSALMSSIEDDKLWNPVLRSRLHTQRQRAEAELYGFEDEDDDEAAAEIQRK"
FT   CDS_pept        1393415..1394056
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3675"
FT                   /product="putative calmodulin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3675"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26223"
FT                   /db_xref="GOA:E9ATE9"
FT                   /db_xref="GeneDB:LMXM.36.3675"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATE9"
FT                   /protein_id="CBZ26223.1"
FT                   /translation="MAGKSSTLFTISKKKMQRFRLFSFLLRLLALFVCRTKPHTFSHIN
FT                   KGHPVCTFFFLRKMADLLSLQQITELKEAFSAFDVDCDGSITVDDLEQVFSSIGHKVSK
FT                   KRLQSILCEADLDSNGVIDFPEFLTLVATKLNDPEEKELEMRRAFRMYDLGNTGFITVS
FT                   NLRFVMGRLGCFLTSQQAFDMISEADADGDGKLSFDDFRRVMTEGWGATP"
FT   CDS_pept        1394625..1397558
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3680"
FT                   /product="mitogen activated kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3680"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26224"
FT                   /db_xref="GOA:E9ATF0"
FT                   /db_xref="GeneDB:LMXM.36.3680"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF0"
FT                   /protein_id="CBZ26224.1"
FT                   /translation="MSCASARTPIEKYDIHDAFLALSVLRKLPEYTRELEESSSEMLYR
FT                   IIYRSIYAARWYYRRYSRYREFVHLLSTYTECIAVKSFNPAHRVAELLAAHTSQLHTPQ
FT                   LWQRLPLPLVASLLLAVIFCIATVILISIGEDCCRKGDVAALILSCVSVVCLCALFPLI
FT                   YASLKWRGYRGPERFVDWMVRMACDNAQNQNSYYNPLSDRIELTEQAIVEDTDAFLVET
FT                   DTAHRNRSAIAMLLTEATEDEGSVVLRSRGLPPAMIGLNPIYRHMIIIMTDFDGKVVMW
FT                   SDGAATCFGFSARDVEGNNINSLLYGERSVELYATMTEAAVKNLDLSEKVLTMAHMSLG
FT                   TLSISATVVVSREAKSNRSVGFTLIGSVRSDELSQTQTVLHSFFVTELSQLSVKDSQFR
FT                   QIVDCLRWKNLRDLSALARDWRSAHIRQLLSEVIKGRQRYVSVEVDPKVTELPPILCDT
FT                   AGVTAVLNRTFELFCEKISVRVEQKRTTSAVYQLIVVYRHDMSGLNRNTLMGITRSAND
FT                   LGGIVVDSPGTLKLLLPFMVKDEVIQALKPQGAAAQKPIGHDPLIVLLLEKNAVHRHNI
FT                   SASIWSCGHSLRLIENVRKALQAIEGSTDLGCAIVDVDVKGFDRVIEALLAKHIYIIET
FT                   SEALDGGAKRGDALLKKPISNEALHKELERATYKCEEAKRAGVELLKRREVFGKVRNSP
FT                   WTQGRLLGRGGCAAVYEATSTLTGGKMAVKIIRVSGNFEERIDEFMNEIGILCQLTHPN
FT                   IIHYFYCERTETTLNLFMAMADQGTVADLIKRCPQLPENHVATIMKQLLQAVNYLHECG
FT                   IIHRDIKPGNMLISQGQLKLSDFGTATTNVREGTVGTISYMAPEVVDGKPSGKESDIWS
FT                   IGCVVCECLQIKRSGDGLLGYGAPEEYPSDVSAQAIDFIKACMQRNPSERATTGTLLLH
FT                   DFIVHLDQEVSQLAEVLAETSPNDEGAKPPKARSSFSDSTVISWSFD"
FT   CDS_pept        1398274..1401504
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3690"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26225"
FT                   /db_xref="GeneDB:LMXM.36.3690"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF1"
FT                   /protein_id="CBZ26225.1"
FT                   /translation="MVVGQSGSTAQGSSPRLSTSLQEAFLRYDPKERRCSANGPAVEEA
FT                   RPMLGSRYFNMDHLALWKPSLLASLGETCRRAVYVNEYHALLCSRRLVLVNNKGRYIVF
FT                   PPFCDTLKDAYVERVSKTCTLVLAAVASGVHVALVRDSDSRKADTLQSTFCPTASAVAC
FT                   IHHFGKNFYGLCCENCSVEGLAITLDNTDSLHPELHANVLPSRYGWVQAAYDYLSPKRY
FT                   VHSLFDRHRGYLLMLSNRNVSLWMYSDETDLQLECSAALPQEAVVAIVPPLQDEYGETQ
FT                   VAVLITSSGGRVPVHLRTTAGKRGTLRSLSVGELRGLPSGVTNTVISLACACDSSLLLA
FT                   DQLTSSLLLVTRCEPFCEAPVSSTTHVVTQHFLGKPICGVGVERSVCDGGSFLTFVVYC
FT                   GDSMIVRLGRMPRGQLLQRQFAASVTSGIDAVSKLEPQARVVLLLDAVLSGLPISYLSQ
FT                   SLEPLLRPWTVTVCGVRLSDGARGIIQHTMRGLSELSRLCLSFHYWRLTEELAQSRSRL
FT                   EKSSTILTEVLNRGGWLDCPTRQRLEWDDDVLVRADGKLTDISAVDAQAEVLQLLLSSA
FT                   KHATTIAWLYDLLLQTGTTYRFPGRLEDLLWRSDPVAVQVSLCMDLLARHNKDITDKLL
FT                   QKEHVLPQRCRLAATLLSLVLDKALEPVMTYTRRHILDIVQYDLLSYTTDLLESSFPTS
FT                   QPRIRLLVYRYPHDHSVSSDILSMVETISSTGDLYHTLVTILGDAACDSELSSVLLDWM
FT                   ECHTLADHRILTFANVVVDMGLCVDPAHTLTGRFFSSIKQQANGNVQQAALRFADLARS
FT                   NLSVPLDGRLLAIEHAITAVPSDDNRLIQFLLLLQQQLASLIAEHLAVGKDLVFARGTV
FT                   EADLGALREHYVNENSLFELAGRYKVLGGCSIQLDLLKIHSDSPELLIANALTGVLTFL
FT                   KAVGLSAPQAVQRVLREYLGTFQAPLPLFPFVEFLAFDGQSPALAMDELEKVGVPLPTI
FT                   FDTFMSLLDGHRNPLFQIGDTVLALGQLVPKISPTVQHICAAHLLECSRSMLAGEQRAI
FT                   ALTEEDVHTIKHIGDDMRKLSQGSQTAF"
FT   CDS_pept        1402898..1403482
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3700"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26226"
FT                   /db_xref="GeneDB:LMXM.36.3700"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF2"
FT                   /protein_id="CBZ26226.1"
FT                   /translation="MLRLCLALRSASVQRKPHLFRIDLTSKHTPGHLYLADRAVKSTAA
FT                   DPCFVCLDNAMACQTADSNAAVVLRSCMTKGRELFQYGRMRFQGMSAALVFRHNHLVFQ
FT                   GIGDASVQALEMSLQHKDIFALLGGISPQENIPEWARAVEKAIAEGDVEYVAEEMLLQL
FT                   RCATDGCTSIVAKISKFSAGLPEPPSYSHAL"
FT   CDS_pept        1411272..1412627
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3710"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26227"
FT                   /db_xref="GeneDB:LMXM.36.3710"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF3"
FT                   /protein_id="CBZ26227.1"
FT                   /translation="MPPKKRSSRRLTLNAGEEYTLIGDGAVQITLQSGLLDVAGVMLDA
FT                   NRPYTFYLHTDRQTITLFTLEGAACMLSSDNRVDTQRGVARAGKLVQMTRRTILAAKRT
FT                   KVLVIGRSRSGKTLAAHTLCNLLMRYGNDKKSVFLMDLNAESNCLFAPGCVSCIQVSEA
FT                   PLWPGLTASPKLLPLSLYTGAAVRPSASNVNSLLHYYDQLHETVMGYIQELSGAAAAAQ
FT                   QQSPSPYAPSLNETQSHVVVDAPAPLADLQEGVWYKKLIEVLCPSHVVIVSSREDGEER
FT                   WSTFLQEDVQRVLPDCEFLFTDPVAHLCERSSSRELLREYFTGTPFYSLGCSKVVVPLK
FT                   SLTFVEEAGEGLAPGSADGVLMRVVHPDASFQALVCALSHAELLEEAPLAPIAGLVTIV
FT                   YVDEKNEEVAMLIPAAEEPLLRRLIIVPQSRYRDTLRMTNAQVTTMEEYVAV"
FT   CDS_pept        1413665..1415548
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3720"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26228"
FT                   /db_xref="GOA:E9ATF4"
FT                   /db_xref="GeneDB:LMXM.36.3720"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034095"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF4"
FT                   /protein_id="CBZ26228.1"
FT                   /translation="MRASVRVRDTHKIGWRTRAKRAVERAIHKYVPDPRDNPLTELPMN
FT                   SEAYSKTHQQQEGSVRIGIRPGQSIEDYMAERDRKWLDQQRLIFEQRVKEDHLPTTKDG
FT                   LPFVGAGSREHYMNIDSANKLVHTPEPKDYEIDEETVLLRRQLQVENEAEYRKFVAEAK
FT                   RSDIAAQETRKRRLPHPSDPNYDPFKLTPGYRPQDSTALAQWLKRQRESGKSASGLSLQ
FT                   TKEGQERFYNEEKMATQYNANPFANRIETPRGMSTMRVTAYSPDSVFINDREVIGSCIV
FT                   TEKGYYHWNVGSFEEVNERTLAVLLHMYPVPDVVFLGTGRNLHFIDEDLRIAFQKRGTV
FT                   IHCLTTPQACGHFGVQLSVSRRSALAIINPIPTNGYGVECFGDFVENDMFSLSDTQLGI
FT                   SPMRQFSPSLFRQNKVAEKYRATQGTGIGPQYHQLSDGRLVRPGTSHTKLLPMLEPGET
FT                   VDWEKLPSYYHWYPKEELHDYIENTTWREIKGRPTGEPLEKRLRKAISGGTFEKDETPE
FT                   PDLMPWNSATIPITKFPHERNDDEIVVVDPKTGRIIGMERETYERWKRMMEERRAGLPE
FT                   SDPVEYDQERYVTNKDGVVFDLSKMKYRPIFEGRWNARRQQSTGRTNPIMT"
FT   CDS_pept        1416635..1417180
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3730"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26229"
FT                   /db_xref="GOA:E9ATF5"
FT                   /db_xref="GeneDB:LMXM.36.3730"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF5"
FT                   /protein_id="CBZ26229.1"
FT                   /translation="MLVIEGTNGPLFSVAKSAAAIAYLSTHYPQCKKRGSGWQLSVEEV
FT                   SLLQSQLRRTDGVHFASADTKEQFEVLRKRYARDCVVYAALTIDHGYRLRHGSQFGANY
FT                   IGYQDVGTHGECLLFTGPLAELEQVRAVRIARSVGKRAMLVTLQEGDSGCSPTVTVTDL
FT                   MADSFTDLRRPHKSCRNE"
FT   CDS_pept        1418006..1418512
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3740"
FT                   /product="putative 60S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3740"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26230"
FT                   /db_xref="GOA:E9ATF6"
FT                   /db_xref="GeneDB:LMXM.36.3740"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR038562"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF6"
FT                   /protein_id="CBZ26230.1"
FT                   /translation="MSCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRSKRSQGIHT
FT                   PWVLGHKRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQRIV
FT                   KQALKEHNKMKLSHKRTANKKKSKQSKKEAITKKISTKTVSKKKAPAKKVTTTRQPVGS
FT                   KLVKK"
FT   CDS_pept        1419247..1419507
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3750"
FT                   /product="putative 40S ribosomal protein S27-1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3750"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26231"
FT                   /db_xref="GOA:E9ATF7"
FT                   /db_xref="GeneDB:LMXM.36.3750"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF7"
FT                   /protein_id="CBZ26231.1"
FT                   /translation="MGFFDADLSYPTVRTERMKHKRRRLVQGPNSYFMDVSCPRCRQVT
FT                   VVYSHATTSVECKGCSKKLCRPTGGKALLVEGCGYRRKPDH"
FT   CDS_pept        1420192..1420836
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3760"
FT                   /product="putative 60S ribosomal protein L10a"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3760"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26232"
FT                   /db_xref="GOA:E9ARK0"
FT                   /db_xref="GeneDB:LMXM.36.3760"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E9ARK0"
FT                   /protein_id="CBZ26232.1"
FT                   /translation="MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKR
FT                   FSGSLKLPNMCRPRMTVCLLCDLVHEDIAKKDGVPTMNQEELKKLNKNKKLVKKMCNQY
FT                   DAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTEKVVELRSTVKFQLKKVLCLG
FT                   TCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY"
FT   CDS_pept        1421782..1422093
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3770"
FT                   /product="putative basic transcription factor 3a"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3770"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26233"
FT                   /db_xref="GeneDB:LMXM.36.3770"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATF9"
FT                   /protein_id="CBZ26233.1"
FT                   /translation="MPITQEQLKRRAEMVRTGGKGSMRRTTKAHHKSTGDDKKVQVTLR
FT                   RLGVTPFSDIDEAVFYRQDGSAYYFSKPKVQASMQTQCFVVSGDYDVKSAEEVDAKKD"
FT   CDS_pept        1423865..1424815
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3780"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26234"
FT                   /db_xref="GeneDB:LMXM.36.3780"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG0"
FT                   /protein_id="CBZ26234.1"
FT                   /translation="MDAIKTYTYKSGAVYEGTFDGNMRSGRGHWTHPQGERYEGEYKDN
FT                   KQNGLGVYIFSETGKKYLGNWEAGQMNGEGLYFFNLDCTAYYFGNYTKDKKDGDGHYMY
FT                   ETGVMTTQKWNMGALLKEEETPPSEIVECAVKIKELMDAVRAVAPKELGDMPPPSEVRT
FT                   FQFPSGATYTGQYFGTKKHGRGYWLHPEGDSYEGQFDNNHHSGWGVYVIGRSGKKYVGH
FT                   WRNGKMNGIGVYFFNPQETEYYVGLYRDDVKNGRGMYHFAESGASMVQMWENGVLRQEM
FT                   EADKATEKAYEAAIRRIVEVVKPYAPNYEPVTFGF"
FT   CDS_pept        1427302..1430196
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3790"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26235"
FT                   /db_xref="GeneDB:LMXM.36.3790"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG1"
FT                   /protein_id="CBZ26235.1"
FT                   /translation="MSESILLGKAELLAWAASVTGISPCDKYGDLKDGLIYLALTRQLF
FT                   PGEIDNAIVRLQRRGARDAAKNWSLLTSCLRRHGIPTHLCSQQAVERGHTRYCFNLLVL
FT                   FYFLVRLARGHQFAVDFAQPVDPQLAAFLQSPESVLAVERRVDMGLSECSSNNVGVSAI
FT                   DEDEAGGQADSGAPRSVTRLSSPPSGATAPTTATGVAPLRLPLRSTALLADTSSHHLAP
FT                   PPRWMWAHEQSSARAFQDAGGWRAPRRCNNRGTEDSKHSPRGAFDSTLVHGVARAPVTS
FT                   GGELVTATLLPPASLSRPSPSTACAPHLYIQNQLLREELQHVKAVSQLLLTQQRGSEAA
FT                   VEMRASAALQVQLAKAELDHLHAVRQLEVTLTAGPVQNGGANAAPSPQQWAALVHRAEA
FT                   AETTSVQLYREYHESQQVYDTTLQQLRQVFCSIADIAAAALSSVPSNSDSAHAVAYEET
FT                   VTAAMLAQLTGVPAMLKDAFCAQMRALLLTLSSLRSTNARLQMDAASVPHHSGPGDASR
FT                   DCASSFSALYASSSLPFERESLKTVCAEALSACHGANPVVQRALRRLTSLVDMVSSALD
FT                   AAQQDRDRWEQRCRRAETAAAQADAGSQEASAEGEAQRQQDLAAPTVASSTCIDELSRL
FT                   SPERCARAAQIHQESQRLCSQVQEILAMAFSTAGTHEVQWASDELVALLGAYVKERASK
FT                   PAMDEALAEQAETIAALRADLRQQRETRKRAEAQLSDAERRRQVLEHKCAALQTQLRSA
FT                   TEKLGTQRNDSQAHAATLRRALLEKTSTPLSAALASTPLAKPSTAATRGTQEHIAASGA
FT                   APLTDASRHAASTPYRSTAHSLYSSPHLPGALHSPSTSDDDMNDAEERRLIDHHHRFHS
FT                   DLHNQHVSPSPSPSASASLPSSRATTAEADVPKALTTERVVARASLAAPTASPARSTRS
FT                   STDHPAAASGSSLLLSAAELERRKQAILRKYDVA"
FT   CDS_pept        1431253..1432386
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3800"
FT                   /product="aminomethyltransferase, mitochondrial
FT                   precursor,putative"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3800"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26236"
FT                   /db_xref="GOA:E9ATG2"
FT                   /db_xref="GeneDB:LMXM.36.3800"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG2"
FT                   /protein_id="CBZ26236.1"
FT                   /translation="MSASLKKTALHSFHLAQQAKMNAFSGYHMPISYGRLGVLKEHFYT
FT                   RQVAGIFDLSHVGQYEVRGADREKFMEHVTPVDLQRTQVGYGALSMLTNAQGGIKDDCI
FT                   VTKMADHLFLVLNAGCKGKDVAHMESVLREGAMKGADVQLVLLDRSLIALQGPQAAAIL
FT                   SEFMDDVPDMGFMQCRQKVNIKGMEVQVTRCGYTGEDGFEISVSNTDAVALVELLMSRR
FT                   AEMAGLGARDSLRLEAGLNLYGHELTEDTNPVAARFMWTISKRRMAEGGFIGYEPIKYF
FT                   RDNASKGAVPRLRVGLVSTGPVAREKTAIEVGGKQVGEVTSGCPSPCLKKNIAIGYLDR
FT                   ELAKDGVKVDLVVRDRRVAAEVVTPRFVPARYYRKPQ"
FT   CDS_pept        1435314..1436447
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3810"
FT                   /product="aminomethyltransferase, mitochondrial
FT                   precursor,putative"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3810"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26237"
FT                   /db_xref="GOA:E9ATG3"
FT                   /db_xref="GeneDB:LMXM.36.3810"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG3"
FT                   /protein_id="CBZ26237.1"
FT                   /translation="MSASLKKTALHSFHLAQQAKMNAFSGYHMPISYGRLGVLKEHFYT
FT                   RQVAGIFDVSHMGQYEVRGADREKFMEHVTPVDLQRTQVGHGALSMLTNAQGGIKDDCI
FT                   VTKMADHLFLVLNAGCKEKDVAHMESVLREGAMKGADVQLVLLDRSLIALQGPQAAEIL
FT                   SEFMDDVPDMGFMQCRQKVNIKGMEVQVTRCGYTGEDGFEISVSNTDAVALVELLMSRR
FT                   AEMAGLGARDSLRLEAGLNLYGHELTEDTNPVAARFMWTISKRRMAEGGFIGYEPIKYF
FT                   RDNASKGAVPRLRVGLVSTGPVAREKTAIEVGGKQVGEVTSGCPSPCLKKNIAIGYLDR
FT                   ELAKDGVKVDLVVRDRRVAAEVVTPPFVPARYYRKPK"
FT   CDS_pept        1438830..1439225
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3820"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26238"
FT                   /db_xref="GeneDB:LMXM.36.3820"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG4"
FT                   /protein_id="CBZ26238.1"
FT                   /translation="MSAKSPSQNRGLSPPSPSPDALHQLRCENAMLKKEKQFLMQAVAS
FT                   GPSTSARVNSVRYNADAVEAKLMMAYRMASEMHDAESCKTVELQMQQRVAEMLAKVDKL
FT                   RELLENVQKDVEEVLVATGGWDRQVAT"
FT   CDS_pept        1440899..1441837
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3830"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26239"
FT                   /db_xref="GeneDB:LMXM.36.3830"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG5"
FT                   /protein_id="CBZ26239.1"
FT                   /translation="MGCCCCYPSDFRVARQASSPLHRRSSSVEHRSFEQNVFHRPKQPA
FT                   KTRYICDLCGVEVDPTLFDGHQEVCRTNHLRTILAKNAALLSHANIQPSSSAKFHDDAA
FT                   SGDKELCLVCMDRPRSYAFLPCGHISCCQECTKSLDQCPLCRQPREGLCHVSPNVTAQY
FT                   ECKHCHELIAPTLFDGHREVCGLRQRQTQREAEEAAAAAAAAAVAVGVPVEAAENSAVW
FT                   QNSTNSMPSRSPPQPAIATPPGPMLPTATAPARNPARSLSHVCLECGKMYGQLVVCAPC
FT                   GHRVLCYTCAEKRTTCPVCLSEIHDIVVAFD"
FT   CDS_pept        1445693..1447579
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3840"
FT                   /product="putative glycyl tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3840"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26240"
FT                   /db_xref="GOA:E9ATG6"
FT                   /db_xref="GeneDB:LMXM.36.3840"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG6"
FT                   /protein_id="CBZ26240.1"
FT                   /translation="MPAASSLPGKLEGFVRTEFEDTCRRRFFYGLAFDPYGGTAGLYDL
FT                   GPTMCAMKSNMLHFWRQHFVIEESMCEVDTTCLTPEEVFKASGHVTRFNDVMVRDTVTG
FT                   ECIRADKFLEEWSEAQIEKDGITAEQKDEFLHLLHDAAGMNLSQIKAVLEKHAIKSPKG
FT                   NPLSDPFPFNLMFATHIGPEGDRLGYMRPELAQGIILNFKRLMDSGNAQRMPFAGACIG
FT                   TAFRNEIAPRSALIRVREFTLAEIEHFVNPNNKNHEKFDRVRDVEIWAWPRNLQASNED
FT                   PIRMTIGEGVEAKVIDNQTLGYFMGRVALFLTAVGVRFYRFRQHQSTEMAHYAQDCWDA
FT                   ELLTSYGWIECVGIADRSAYDLTQHSNASKKDLCAREEYDEPCMERQLLRQLTKGLIGK
FT                   TFGKKAGEVMAYLNSAPAEACEAIRAAHAVGQPATVTLPSGEEVSITAQMVSFEEKDVK
FT                   VTGYSYTPSVIEPSFGIGRILYCLLEQSYWVRRDDGGKNDKRAVFSFSPLLAPQKVALL
FT                   PLMVKPELLATISEIRQELVLRGISVRVDDSSVTIGKKYARVDELGIPFAITCDFEGDG
FT                   SVTLRERDTASQVRVPKSEVASVVVELCNPLQPLIWESVKAKYPAQAASAEK"
FT   CDS_pept        1450008..1450685
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3850"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26241"
FT                   /db_xref="GOA:E9ATG7"
FT                   /db_xref="GeneDB:LMXM.36.3850"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG7"
FT                   /protein_id="CBZ26241.1"
FT                   /translation="MFNRLFGREKQVQPSRSSGGGNTTTAKTMEDMDAAIELLEKREAA
FT                   LEKRMEGELAKAKQLYAKKNTQGALQCMKRKKMYEEQLVNIGAQKQNLETLKFTVQNQS
FT                   MNHEVLRAQIRAKDELKRSNKQMKAEKIEDNMDDLMEEMDKANQVSEALRQPLDNNFVD
FT                   EDELMNELEMELDGMNLEETQVADAKLPEMPAVPNQTLPAQPVKTKTQEDEDALAALEA
FT                   ELA"
FT   gap             1453496..1453595
FT                   /estimated_length=unknown
FT   gap             1455225..1455324
FT                   /estimated_length=unknown
FT   CDS_pept        1455679..1456560
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3860"
FT                   /product="similar to leishmania major. l411.4-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3860"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26242"
FT                   /db_xref="GOA:E9ATG8"
FT                   /db_xref="GeneDB:LMXM.36.3860"
FT                   /db_xref="InterPro:IPR018928"
FT                   /db_xref="InterPro:IPR040326"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG8"
FT                   /protein_id="CBZ26242.1"
FT                   /translation="MLLPAPLVSISGNQCDKVGISPDYFYSLSSATQCNAQKGTCVRHQ
FT                   LADYRAADLEQIAQGVGGRYIATSLGTFTRQRMGEQEFLLDAVERTGGAMLRWTVNADG
FT                   LAFQPLPVNGVLDAIKFGSSTGILYVTVRNNNTYGGLYYVAVGQCQGARASHCDSDGVT
FT                   HECVRTAFVAGANTSSLLQFSMVNDPSEEVGSIASCIVVFRDAAAALLASTNVSWTVEH
FT                   TPTTPAPNAPKAEQCRRCAFSDLRCLFSTVCEWQMLVWTAVAVAVAWAPYAILAYWRIA
FT                   WHVGAKFLACLN"
FT   CDS_pept        1457791..1460319
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3870"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26243"
FT                   /db_xref="GeneDB:LMXM.36.3870"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATG9"
FT                   /protein_id="CBZ26243.1"
FT                   /translation="MGRPSFMERYFAQCQAHRTSPHPAFVAGLREGVMDINFAEIPLAD
FT                   IRLFAYALLDVSPAARGARSSAVPSRNSSGQLSRRDATSNTSPSSRPRTAGASSRTQFT
FT                   KLHFSYNATVPAAQLPCGAVSPPASTPWFTQNESTLRRLPEAVAQAVKENVTTLSSFSW
FT                   CGMLVTSMAVQGRAPLQQQRGIGRVPPSLTRVLPLCHRLTSLRLDGVPLSHAQFMQLTM
FT                   PSPESSAASADGGMTWPALEEASFVGCGLTDACKNGLVHLIRSTMPTASGSAWQRSLRG
FT                   GHASPDDRLLPRPAGDTVSLRHSAARGLKGLDVSQNPLGDGTARAVANAVPGSALRYLN
FT                   VSSTSITWMGGSLLASRPVLEDTAMELLDMSNTGVSEVFAHGGSAAEAKILTESSAAAG
FT                   FRVLARGMGQLLILRESDRSPKQSWLIHTTTAIAPQSSPAPAPESPHVESLTKPTNPLA
FT                   SVIEMEAEKVAPPATPTTPLPSSNTGDQHSARQSVHNSAAAPGPAVSPYGPWWPMFASW
FT                   YAARDIPIPTSSADAAAPVSSAAGLAKGYVPVPVPFPMLAPIPIPYTAPHGADLAFAGA
FT                   TAAATAAAAASPHASGAMAENSTPSPEQRVSTPPADDPIDAAAETSEPLPSPTSPGEKH
FT                   EKECGESLTGGLAHSPDAASTASQSAAVTASASGDLVHRASEAAGDRKFLLALISRLEA
FT                   HESDVTERLEAQYQRTTTQLTSLEKDMRFRLQQLADADRKERTAAADRQTALLEALAAL
FT                   RTEPASVSAEGMTETMLLQLMHLIEEGMEKVQAAFGEEGAVGMNSVRAGGRKVSPLLRS
FT                   SEAATPVGATTITDRDLVKTANQRLKELGW"
FT   CDS_pept        1460934..1462004
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3880"
FT                   /product="putative eukaryotic translation initiation factor
FT                   3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3880"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26244"
FT                   /db_xref="GOA:E9ATH0"
FT                   /db_xref="GeneDB:LMXM.36.3880"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH0"
FT                   /protein_id="CBZ26244.1"
FT                   /translation="MTAAVDLEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTNCSACCW
FT                   QVKTGKLLGSYTTVGQVEGRTYDAAMVALDVNRESTLLATASAGEEVLLWSVESGALLG
FT                   SVSRSLSSGASVGFSHDDMMMMVATKGRSSTNSAIQVYNVPFTVPKAGEDIAPVKTPFT
FT                   TFSTYETPDTITWAAWGPTNETIYYSEGGYMNILDVEANKVIRSRQIHEDENEVINRFS
FT                   WDPNYLTLATASTDKTSHLIDFRDLATIQVYRSDVPVNDVSISPSADHVILGGGMDAAS
FT                   VTTQGGQSIFEVKFFHKVHGHQLGQLRCHFGTINAMSFHPDGHGFASASYDGLIKMYRF
FT                   GDSYDSTPGAQPLWTL"
FT   CDS_pept        1463501..1464688
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3890"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26245"
FT                   /db_xref="GOA:E9ATH1"
FT                   /db_xref="GeneDB:LMXM.36.3890"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="InterPro:IPR036561"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH1"
FT                   /protein_id="CBZ26245.1"
FT                   /translation="MWCLQKVPRGSSLVRSSPARVGMLRRFRALQEASAQCSLTVVAHG
FT                   RRSLSTEELVDEETQWTREMSSKYGSGNYQLFRALYKDLCDEVRREYYTKPPPPPPATR
FT                   TTGASPSLVAAEVAPEVCRGADSGANDISSGATKQSSVADGAGATSSSTQGGGMPAASE
FT                   HEDSTGEAAHAARETAATPPPSQPEETYGDGSWSVQHRPEDNVIVFHRGAVKEGRLATV
FT                   HAWAHIELKDPPRLNAVLTFADWIPIEVCVERNGIVIHFSMASNEGGMHMRNVRVYAPK
FT                   SAEERAALLDPSDDGEYARKNFYYDGPCLWHLELDMLNELYDVMQDHGVTLDWIRWAAS
FT                   WVFYLEYVNYVRWNLGMLEELIPSSLRGPEEDFLLPAEKALLAEPVEDWLRAHSI"
FT   CDS_pept        1465587..1466414
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3900"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26246"
FT                   /db_xref="GeneDB:LMXM.36.3900"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH2"
FT                   /protein_id="CBZ26246.1"
FT                   /translation="MLGEDLDIGFYAEDAYAAYVTDLATSLHLVPRCRNARGATLDVVF
FT                   TGPFLDVSAYEEAVRQGKLLPYAALPWSVAEERGVQGVSGATLSVTLHGWIEKLNAARK
FT                   VQLMEPLFPAADLCATVAETCVMSDGGNSAPCALASASPPHRAASAGTANENGTHPPLK
FT                   PSRFRILGNLDFFLHLSSRDLSTAESSVPVDSPSAYERDQENSNFAGDPEDATRAAHAC
FT                   RDALEQRDDITLARNAVNTVIKFAQMAEEHPGEVGSVFVDAKERVEYIQFSAH"
FT   CDS_pept        1467337..1468650
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3910"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /EC_number="1.16.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3910"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26247"
FT                   /db_xref="GOA:E9ATH3"
FT                   /db_xref="GeneDB:LMXM.36.3910"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH3"
FT                   /protein_id="CBZ26247.1"
FT                   /translation="MADYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKGA
FT                   KIAGCLHMTVQTAVLIETLKALGAELRWSSCNIFSTQDNAAAAIAKAGVPVFAWKGETD
FT                   EEYEWCITQTVKGFSGDGLPNMILDDGGDLTNLVIDHHPELVPKIFGISEETTTGVKNL
FT                   YKRLSKGNLPISAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKTCCVCGYGD
FT                   VGKGCAAALRAFGARVVVTEVDPINALQACMEGYQVALVDDVMADAHIFVTTTGNDDII
FT                   TSDHFPHMRDDAIVCNIGHFDTEIQVGWLEANAKEHVEIKPQVDRYTMENGRHIILLAK
FT                   GRLVNLGCANGHPSFVMSNSFTNQVLAQIELWSNRDNNKYPRGDNAGVFFLPKSLDEKV
FT                   AALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY"
FT   CDS_pept        1471424..1471825
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3920"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26248"
FT                   /db_xref="GOA:E9ATH4"
FT                   /db_xref="GeneDB:LMXM.36.3920"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH4"
FT                   /protein_id="CBZ26248.1"
FT                   /translation="MVFVIAAAAAIFVLAAGAVLLYGAASILAGGFFRLALGALLVGMS
FT                   LSIVFSTTANLLLVTFSRYDLEPRPPIVFLRSFLAAMGQPTLTGVIGLSLVTLVSLAAS
FT                   KVRVMVEEMDILIRSHAAYAARSDRTAAP"
FT   CDS_pept        1472771..1477099
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3930"
FT                   /product="putative telomerase reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3930"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26249"
FT                   /db_xref="GOA:E9ATH5"
FT                   /db_xref="GeneDB:LMXM.36.3930"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH5"
FT                   /protein_id="CBZ26249.1"
FT                   /translation="MSASFPSIPGFAGPLSLKAFLEEYFGLHLTFAAETASPSPRAAAT
FT                   AETPSAAGFRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPATPDPGCAAPP
FT                   TGLGRLRQLLAHQTAVSTAHDTCVTRCNPSDRQNPFCLSSSSTGKNGNARGPWCASASW
FT                   LLYTSTSHRPFTDALLRHPWWASFSACLGPAAMGFIEMYCPIVLQLEAMAGGVQVIGPA
FT                   LKHVALETSFSATAQLSEIKGLPPRGSASVSSRGVKRGVDTGECSAPLPLQKQRRVEAV
FT                   ASPPKAGRRLQREVAPSHRPCRDDSFSSPVNRAAMPATWAAALTRTDVPRTRLYSVRVS
FT                   DSDCTGDGGGALPLPAGFLEAQWLRRHPHSLHRVLQAALPKRAAYGASTRHYCAGTGER
FT                   GTGCTSVEDISMWHVAHVFRWLVLQPSQSSADASQTTSPKFDLPSYLRRLLSTVVDQCS
FT                   RLDLRGAALKHTGYLEEAFRRQQQGVEPWDVQRLSTPVDVVVSYLRTLLSTLRWAPLKE
FT                   ANNGLFWGRDAAGSERVLDALMRAVRGWLIAGRQAVVPVSRFLDGVPVAQVPWLNGFYT
FT                   TTPSLPFSDATSSAARHARRERSQVQQRVWLQFVLFLTQDILPFLLRASFTITWSSKNT
FT                   HKLLFFPAFVWRRLVRREVRRTRSCRAPRSQMPLAEERTRSVGAERAALFSAPSACGGA
FT                   VAAAFPSPHSAASNASAAISAPRDVWRAVRTGGALTHRGARATLATRGGGASCLYAGVR
FT                   FRPDRRKLRPIAVVRSASLRSLKEMARGSPSPYSHASAIVRLLRRLGCSDADGQLPAAT
FT                   ATLLRQVQARSRHNRRTGVHRSAHPLPPHLPHKAALQDALRCLVSGVEEQRVRDGLPRL
FT                   SNLSHQDEYAELRSFCEEVRGRHAVPCEGPTETTPAVSSASPPGATACFAPYVTLVRSD
FT                   ASRCYDNLPQERVLAAVRSLVKHDAYRVLRFTVIHAVDSEATCKGGCLLRRTFTTRTIP
FT                   CAEAECGFLTRIPRGHIYWEEEGRTPAGPHTSAAVSRTTDASSRCGANLISGAAVRALL
FT                   SEHIRHHLVVVSGGSLFEQRVGILQGSPVAMLLCDRLFSNVVDTALSSILSEHAERSLL
FT                   LRRVDDVLVATTSPAAAERCLRAMQRGWPSVGYLSNPSKLTLSKACGSLVPWCGLLLHD
FT                   TTLEVSVEWRRIGVLLGSLRVGDPHYVHRGDYEPLYLTQRFLAVLQLRVAPTALCGRMN
FT                   SKTRQLQTFYEVGLLWSRVVLEKVQEALPVARNRCVTVLLLRPLAVCVGRLCRLLSRHQ
FT                   RFLAARQSACDVSAAEVRACVLTALHRTVQAKLRVLQARTVRAMTAQRGPSLKGRRKTF
FT                   CSKKASSVGRKGCERRRRGRNRRSTRVCLRSFWWLTAAEVESQWRRSLGALHRAAPRPG
FT                   EACGSTASSPSPAASASLLMEDGPLSMHARALSATRLSQT"
FT   CDS_pept        1478215..1481496
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3940"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3940"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26250"
FT                   /db_xref="GeneDB:LMXM.36.3940"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH6"
FT                   /protein_id="CBZ26250.1"
FT                   /translation="MSEAGGYSTLLELCTHMNAAAPAPSRHASHSDAPSTQRLSSSPEA
FT                   EASTIMTGAGSVNSKPSGSVVASAASVASLPHFHFLPTKRAPRFTSLALGSEVEPRRVD
FT                   ENFDLRAKEGVTAFSAPFNLTSRRATLPFAAAATCHSVGGATASEGSLRLALPTPVGDS
FT                   KTINGQNPTYSVTHSRVTLSPAMVVDDAHQQWRLDGLTSPDRGVAGEDAAEDAAGAGQG
FT                   SPFLSDNLMSPVGAVRDDGGAGQLIDVASTQHSFISEVDAFLGAMEMSDEEDCSLDLAA
FT                   TRRPHALSSTDSVAAAMADVCALGNDIDSSPPSCGCACMRGCPDPNCVSHMLDITVTLN
FT                   MAQTGVPRKASASAASAQFTYQRLSSSTPGIGTSATTILTTAALTPPTPHTGDDVHPPK
FT                   SFPDAGQGAAPFLHSDREDTRVGGEGVFDVTADPTAAVCIQAKPPSTADDAVTVQHDAS
FT                   GSDERGAPCPGVSGVGVGTCTEHDARLSFTIPINRVQPRTPLVTDTISEVYTSSFATVT
FT                   TSKSTQESSSSTQMLSSREGVSIATSVSAPRSLLQHNSCGRSTTTPKLGSPLQLTEELQ
FT                   GQKQEPRRPSFSPRDTFDIDKDSSAQVSGGAPTAAVTDLSSSPLPFSWLSPESPSSLPF
FT                   VRSQRSQHRGTVAAFEEVELLPEEEAVLKRPETRDKEKITTIDAVPPPHLLRGPDRAAE
FT                   ECRDLSDAVPTPPATDSSRGARAHSESPGDDANSVDSAGAFFPTLQSKLSKWMTWVGRK
FT                   YHGVLRVTSDAAGEEQSLQQQQQPLESPPRRSCAPQRKSNDDSSGHRVSFPPWDSAEAV
FT                   DNGSAAFYDARSLNGEPSHLSFALSLSTSQANSSYDGERSRHPGVQEALCGLTTPWCGG
FT                   GNNCWYSMGWQMEPRRTRRATNGSMRLRRSITTSPLSPSIRDGLFPTSSGERLCDSTTP
FT                   PDLSLSAESLTTTFDVLKTQIFSGGALQRLSRSLGGPLNSSASGTSMSGDHHSLSLPSS
FT                   RDYHSHVSHSNTSAIADDRYRDTLYRLFRHPPSSLIGDITECYEAYKAMTTSSNGHHVL
FT                   NWGELGLLLQPEDYIDYRALFPPYHFVTFEDFVDFVEVLSVRYHR"
FT   CDS_pept        1485347..1486099
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3950"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26251"
FT                   /db_xref="GeneDB:LMXM.36.3950"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH7"
FT                   /protein_id="CBZ26251.1"
FT                   /translation="MEMVRGQVEQVNRRQRKLNEMLEAFKEEGLLGGSGIGLQDERQID
FT                   ALVKRLRARLHTDEASELETLKTNNNNLKHSLDEVTLAMEKKNSEMEVLRANYARKLAR
FT                   SDVENDAVRAKVEAALHASSLDVERMKRELSHRIDIACASIRTPRYNTSMEALRELVQQ
FT                   VQVEVQQHHDELTRLVVSIGAKDTFLRHESETMHSNLPSAYRTELRKMEKDQLLNLLDV
FT                   LSFQEGVVDTVGKAIYIITEAQHKTAVV"
FT   CDS_pept        1487606..1490653
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3960"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3960"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26252"
FT                   /db_xref="GeneDB:LMXM.36.3960"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH8"
FT                   /protein_id="CBZ26252.1"
FT                   /translation="MPRNQCRVPLEQQSHVSGASQTTPAPGDGAHENTPKVAPMPSASA
FT                   LAARAKHRGRGRPRTYPRKTSSAHSLHPHHAPDEPESGDHDDALTAAALPPAVSNQTSI
FT                   IAATANSTRVANQHEVAQSAETFGAGAAVSAELPLPLPLSPLGVPFSSSRVTTASSLVT
FT                   AIPADTAQGGEETATFSSRPPLHSSTRIKTAVPAGIAAGEADRATLGAQPLLPSMAACM
FT                   AACFGWRLKRCSVGEGAQIMFVLQHRAIPVVRVTIESTGGAFAQACGVSSGTNAGAVRV
FT                   NGTLMSLPQCAAHLQELTHALFTLSDTTRSAPLTDHAPAAEESDSEGEEDGKSVSSPTV
FT                   QAPPLLSPSEQAKAAERRVRKRARSRSPLRHADWTASVPRATELLPCVTVPSLTEGPAG
FT                   AGRDGEEASKKRSQPHPPPLNSSDVTLSPTPPRPPPVSLAAPDVEVEAESSLLATTPPR
FT                   TSEQEKDVDTQPLSALSTLATAMEGGELSTPFPRAPPTPRTNTGKPSVASRRSASSADK
FT                   GAAARESPTPSTVFASPTMRQRRTLAPTTAAGAAGPASPITGEHHAPLASLTPPHAALR
FT                   TATFTMPLAFHHTPATPLAASGAPEEFDVARCNTGSNGGHQTVWCDSAGWSTDSSRLWL
FT                   AHTHAVSRAFQCMPVPPCRVPATTKATQPLGGEGAKGHGASAAASASSTVPLMDSAAAA
FT                   ALVRMTLRWRWLERSTMWTAMEDSLRMAVGSGHLHGDALEAGVQALQASEEEQRRYDGV
FT                   DADPGEDCSDLGPSCGRTALDVGQVGHGAERQQTRSFPACPPRALLPVSGRAVVEAQHR
FT                   ITDSEEKGGEEDAHGPRYVACAGGIPSADRIVIDHTYSTRGSYVMASPVTAEGTTATPC
FT                   RLLALQRNPQEDLHYHVYKRFMPTDMRLAMEAEEALTVGPGGIVPLHGGSAELSPAYTL
FT                   RREQSGGEGDDNEDEEERDDGADDADEKKAYDSSNASQAALRAPAAPNMADASKSGPFA
FT                   DMDYVLRHRPSIRRIPMPDVESRYGP"
FT   CDS_pept        1491822..1495823
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3970"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26253"
FT                   /db_xref="GeneDB:LMXM.36.3970"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATH9"
FT                   /protein_id="CBZ26253.1"
FT                   /translation="MTSQERITQARHVMLLSNDAPVLNRCAKEEAHLKHRLAQSTATCA
FT                   LMVQRSHAAAAREERSRESRLQAQFTALLSGTPGVVMPPFVTSSSIEDFTNASERARAY
FT                   AAAAPNDRCVPDPTTRTDAALRSSLRLKSSSTVAADESASPAASLPCTLGFPEAYESSG
FT                   FKSAIHWASVAHDETFLTAYGPRRIREEAQARAIAGAGGSLAAREAKPHRLMTAVACYL
FT                   LNQVLCADAAVSELWREKLRQPIFDAIFSSQSIAMGHERSRAQRSGSLGDAAVANAILH
FT                   KTLASDSSLVSGTATHADPTTSFPPRTNAYTTRHDFASLRLWTEEVTLEHLEKASVCQR
FT                   VLNLQNAVARRQKAVHLFQRRAHQAELQAVFTVWRTYTQQRRANRGALERYLVKRNHRH
FT                   VEETIFLRWRRFTLRSKVEAVQRRLLNIAADRDCAARKHSTALHGLQDQLASERRQHVQ
FT                   ETFERDTLHAQVLESHAVEIEALQLMLQMERLKTSQAGKWAMRWERVAKTFRPAKPCPA
FT                   VPRPIWTLARTLLSTEEELAATILKRSRDQRVPLQIPYSMIQQARRRVEQLLLTWVNAI
FT                   MEASPQASTWVTVEAFTQGCSSHPRGILVSKKQSPSRKAAARRFGTTAGAVAAGKDGST
FT                   CEFSIYTLMCLVRELRRCYAMAGLIEKAEGWGTPDGARVADCYQELTHLFAAQSCGGLY
FT                   PPLLVHCPTSPLWFTPEGVFGGPVSHMEGSKRQKREQHTTFTWLLASLLVGHIQIMWMS
FT                   PLGDMGVPPGRLPMKCTATLRCRHEAEITKLAHISFPRRRAAPPAGSTAAPRGTSVVAP
FT                   NTLLPKKRSDASPAASFSGRAAAKASMASASAAAEDVEGAGVVTTVMTLEALLRARFKA
FT                   THDSTGSDSSRTLAGRDLMAAAEDSLSDIEAFLGMVPAQVQSLKGGAGANGTEDEDEDE
FT                   DDDDEDRWINGLLHRLFEAQDAEAQQRRTKGLQHSEFLKDGAEDGHARPAETTPASALG
FT                   HDEEGKGGSRDNDAAAAADTASAIYGDLSKSTVALTGDQLRLLRSLPGRSHAFDTLRPI
FT                   AVARPEAAPVVVGVSMDNSSTASYASAAPLYSFLLNTLDDTVARQQWSGLARIVTSLVV
FT                   RFHVLDESEDAARRAAVLTPEEEEESEEWKSSSVSRQSPVERARGSTPPPTARLPPVSS
FT                   GCAPFVAAASKGGDGAAGMASPRSGGRIAARLVPAAPPQWPQPPPFPPTTHTAQRAAEP
FT                   GVPVFSRPRPHYMHGATATAAQPSATAVTSINLGEELRRRGAYQTNSARNSFSSPINFP
FT                   AQGAQSCEPSSFAVPPISSEASEPMVPPPSEEVHPSVIPSAALFPSQGD"
FT   CDS_pept        1499923..1501014
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3980"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26254"
FT                   /db_xref="GOA:E9ATI0"
FT                   /db_xref="GeneDB:LMXM.36.3980"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI0"
FT                   /protein_id="CBZ26254.1"
FT                   /translation="MATTSSAAASETAVRTAWFDAIEATAAMTSTEPLQSAAEYTADSY
FT                   LPPLSLAGGQADFFTQLRELDRGFAEAAPSLFLPQMTLEEACHAKPSFYQTFRGEREVT
FT                   ETTFQPLPLKRRDEAGLEADGSAMNGRHSSRRRRQEAPAQPRGAAPLYGGFLGQEAMSP
FT                   RTAVQRKPDFMPIILVPSAATAPLQLMNIKQFLEHGAYVDPATLYVDRETGVVNIRDSK
FT                   PRSVIVKPGSFHDPHKYHVAFRQFRVVDDQDEVDDWSHVCGCIVEGKLWQLKGWYPHEQ
FT                   PQSRDPSRLFSRIRAFLAYFEEDKVPPQCREWNVQSLALTRNLLKDQVHIALASQFWEQ
FT                   LYTFLDEHPMFSRYTIPLTDERL"
FT   CDS_pept        1503293..1503973
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3990"
FT                   /product="hs1vu complex proteolytic subunit-like,hs1vu
FT                   complex proteolytic subunit-like, threonine peptidase, Clan
FT                   T(1), family T1B"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3990"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26255"
FT                   /db_xref="GOA:E9ATI1"
FT                   /db_xref="GeneDB:LMXM.36.3990"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI1"
FT                   /protein_id="CBZ26255.1"
FT                   /translation="MFRRLATRSTSFVTGAAVQARHTTILSVRKGNKVILIGDRQVTLG
FT                   ERIVAKSSACKLRKLNDNVVIGFAGSTADAFALMEKLENKLNDFPEQLSRAAVELAKDW
FT                   RTDRALRRLEASLIVCSKEETLEIDGQGNVITPEADGIIAIGSGGTYAKAAARALIDVD
FT                   GYDAERIARKAMRIATDIDVFSNSNWDVEILTREEGAVKKEEAEKAEKAEKAEKAENEA
FT                   QAKE"
FT   CDS_pept        1505667..1507886
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_3991"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_3991"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26256"
FT                   /db_xref="GOA:E9ATI2"
FT                   /db_xref="GeneDB:LMXM.36.3991"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI2"
FT                   /protein_id="CBZ26256.1"
FT                   /translation="MGRIDSSCVAATVTSSKVGASPSCPVTATSTDTSDEAASRTAAPH
FT                   VRAQRGGRGRPPQMHNGLTAGMCDNQQQHAAGVWKLMTRSQSASTTPPPLVIGDGTGNE
FT                   DRAQPPHAGVRWTKHSWGKGNNCPAGSAYESFVGALLHRPPPTPPFPGVRLPVWCRSVS
FT                   ATGYPLSEDGLTNELLDFFHYLQLTSQEEAARERLLGYVQACVAELWGPCKTGSEAERT
FT                   AQVMLYGSYALGLSLPSSDIDLALTFPAEEEVDVATIEVEVRSGDRALAASATSTKRHA
FT                   LHLERLHHLAQQLRNSATFPELEVEVYDQCRVPRIHLRDTTRGCVSCDISSSFVSARVA
FT                   RIVARQRLWLQDSPLAAFLVRVTKAAVKQWGLHEVFWGGVASTALYCLVLRFLAQMEQL
FT                   CQHAQVEENLSPPCYEEAAIAHTATQLSSLPCASPLSSPQLSMPHPTSESFAAPTPVPA
FT                   GTASTACGVNRLSAATAIPSYVPSWAVNSRKYDVSKSWFLCDMDKDNALCPIGVTAFSF
FT                   SHRDTMANACDEDREADDEVDGYTQAGLTRSSGAATTATTPTSRTAASTPMAAASEAHE
FT                   GGIATASAALAPPVNADSAALREGGFPSAEGLTRIARSRYGASPARLLLKLWRFLSADA
FT                   FVSGYQVADVFGDDAVWCDSGEENDSAALPKQLPLMTSLELATFAGMASTDLSAASFRI
FT                   PELQALFRYSSTSLENMLRYQRYPQRTVPTMLSTIFVDPRLLTSS"
FT   CDS_pept        1509041..1509625
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4000"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26257"
FT                   /db_xref="GOA:E9ATI3"
FT                   /db_xref="GeneDB:LMXM.36.4000"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI3"
FT                   /protein_id="CBZ26257.1"
FT                   /translation="MPIHQYEGWSYERLRRQRNRAHFLLEDPYRYVTVLLISKPGSPGE
FT                   LKCIDSPCYHAAGPLGEGDIVEIEDLLCLRCPWHRYLVNIENGEEILLKVDPTSEQGAG
FT                   MVGRHAALPTYPMHLADPSAEGVTVVRGEKVQRVHRVWLEEATGILSIEVAEEAVIRQH
FT                   PVKSDKPASNVKNGGICMQIFDIKSRGLDKL"
FT   CDS_pept        1511063..1512640
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26258"
FT                   /db_xref="GeneDB:LMXM.36.4010"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI4"
FT                   /protein_id="CBZ26258.1"
FT                   /translation="MDNLSNQLMSRIAEISLSDAQIRSYGRWLTAAMGAYYVVNAWQKD
FT                   IPTDVQAAITGHMVQGYDRSTITTRLEQRHTRQLLQKITGLNELRQQLRSETDKEAKLR
FT                   GWQRVFRLTLISIAATTYTHSLTISLLSIKNMVRVLVFLLSRRESAALSKSRSGPISTL
FT                   RAWWTGGRRAGLTGIMMESMMVKMAEQVSQQASPFVNAELEEEAVTEEIRQLPVPPPLD
FT                   GRTAFAQAQQQQEMLEAAHGESLSQVEQAFSVRAVLEVAVPRIVACAAAAVDSAIAARP
FT                   AHLFNVSGIVRAVDLCSLLRDIALGMEGRACVSEWVRRPHPSLMPMSRACSRASTSPWT
FT                   SLPKHLETIKGRAQLDEDEELLDEPDQSATSSEDIIEFPHGSNTLLRPDGRPVRRRGGD
FT                   RSEDKIIDGLLGRRLTAEEEALQEEAIRRDHLLKRQMAGFFTELSHSASFGELCITYAA
FT                   ELLAAQFKEACDIKRVKTYDAATDTAKMAMVIAALDSCRLAALEEECEVKSYMRLFCEE
FT                   TIRSTCAR"
FT   CDS_pept        1513537..1514367
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4020"
FT                   /product="golgi SNARE protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26259"
FT                   /db_xref="GOA:E9ATI5"
FT                   /db_xref="GeneDB:LMXM.36.4020"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI5"
FT                   /protein_id="CBZ26259.1"
FT                   /translation="MNPEVRQVAMWERLRNEARQTDQLIDQQLRKLEVLALFDEEKIIE
FT                   SAAASSSMKGVATSSSVAPAVPGSSSSLLHCSGTSPPPASTMSFEDLESQYRGADRDID
FT                   EFLRRLEQIVLSMEEACRELGPTSAAARHTERFRGILTEKQQARRRLATEFRQRKGRYE
FT                   LAASRLPGDARRRGGPVDDDGRGGVRILMDEQVAIQHTLNRVNGLLEQAEGTRDRLRMQ
FT                   RDRFNQIGDKVLHIAEHIPFVQNLVRRIDVRRRREVVVLGTVISSLMFMFFFFL"
FT   CDS_pept        1516710..1520510
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4030"
FT                   /product="putative zinc carboxypeptidase"
FT                   /product="metallo-peptidase, Clan MC, Family M14"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26260"
FT                   /db_xref="GOA:E9ATI6"
FT                   /db_xref="GeneDB:LMXM.36.4030"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR040626"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI6"
FT                   /protein_id="CBZ26260.1"
FT                   /translation="MAAVLLPTQQLLENGYYLASDSSANSSFSDTPHSARRISRGSSFS
FT                   LRTTAQRLDLNSSGAVGGGRSATVATDVSPSGIDCLPNSRDPNSYSGGNHIEDDSDIIF
FT                   EEENDFDNFDGEDEEQAVLTYMDSWVDENLPGQPSSSNRAPLPPSARRGSSSVAGAGDG
FT                   TSSGPGAFSMSVEVGDTNYDIGEDPPSYTPVSSPPQVHRRGALSRRTPARSVCSSAAAD
FT                   WHPPTTVRRPTSGSKASGAPLFQAAVVPAKITAVTAGPRMLSRQHSTANAATSSRPTPL
FT                   TAAAVHMPLTAASSPHFASLSPHLQLSSTNEEELRERECKQLSLYEAFFFNPTRSMWLV
FT                   DDHVLAKVLEYVRIMGYEHPALKRDRLKGQPSLWSSSSAIPSPIVSTKPKKKAAGVRNA
FT                   NSRVPQNIHTSSSSAAAEAVAEALAQPDSADVSPTLLTAAGDSAESAAFATKQFCLKAG
FT                   KPRCARQYVNRSTAVAASHLFLTFSEAMRWIAEQEYVIGTVLLCCARFVGDPNADGAAV
FT                   LGDGVTDTAPWHPRRAMLQRRKPCIPLRFHPIHFAASLVCSRFPQWGGMSAFTRAWETQ
FT                   IRLVLGSASPSHQRLFKLPDDALLLSSDCEAGNLHRVERAGEPYSFLVWLEPDFGSDKR
FT                   IWFRFSVAGAKEGRRLRFRLMNAAPHVKLYRQNGMMPVWRDGLSQPNWGPVDSCSFRTT
FT                   NRDLDGEVSFSINPRNSTETIQIAFCAPYTYADLLCHVCHWHALVKTSGCDMRFEERVL
FT                   CRSPDGRKLHLLIVTSRVGGAPASAATEDKSTANAGISGGRGHTGVGADGVAAAGAGSS
FT                   SGWMSPGVASPTTTIPPGKGKGGAAKEAVRGPYANFASGKKVVLVSGRVHPGEVTASHG
FT                   VHGLISFLLSSDVRAIQLREYFIFFIVPMLNPDGVSRGHSRMDQFGNNLNRCYNDPDAE
FT                   TQPTVLALRRVFEHLQHTYRERFIMYLDFHSHASQSSGFMFGNNLPVSVQHWNLFFPRL
FT                   VELHARHVFAFALCRFGRVHMTSKNGASRVLFGSSLIHSYTVELPHFTDRRLYADDHKA
FT                   MNNGGNVLFEVTSPPRHQTSGQAGSVNVKEDGAQGAENGSEEKWRGFNRTHARAVHSVA
FT                   GARGLDRRPNMLLAGRAQACRSNCESSSAQARDDSSPRKSSGTAAESQGHTNSTGVGKH
FT                   RSGESSATQAGGTRAASFLRPISTPSILCQSAEVGQACLLALRDYCSIGARPSPELTMF
FT                   GGMDGLLRDSKRQVKLDSSRKCKKPQSIATYSGINPIYRQY"
FT   CDS_pept        1521652..1522944
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26261"
FT                   /db_xref="GeneDB:LMXM.36.4040"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI7"
FT                   /protein_id="CBZ26261.1"
FT                   /translation="MSTSPDPSLAQMCEAAQQQDEAQRLMPEEENHAPQAEEGASEQSS
FT                   QEEEASSTSSDEDEEAEEAEDGVEDDEDATFQFATDEEAEAQRQVGLAAYNEGRYEDAL
FT                   DVQYRVVRHFSNKYGSTSAKCGKYFLDYGLSQLRLLQGQTTVDDILQPRDEDALMTCYV
FT                   NLEVARVCFQKLEDEVGEEDVEVELALAEVHNALAQLSVEKEDYDAALREYEAELLQYR
FT                   CLQDAAPEEEKLTVVPAGRVIGVLYGIADCFLKESDFEGAEERLRATLDEIKLYPGGTI
FT                   AASLVAELEDLLADAVEMKGGKFQEIQNAIKQQFAAEAEQIPTPQEFFSVDKDGKHPFL
FT                   SAVPGGAGDEVAENSYLSMPMSANGQALATNEHSNSLSVSLFPPQGSRSGTPTGPLQHA
FT                   TVRKKQKRTGDDSLSNAQPENKRVRAESASA"
FT   CDS_pept        1524149..1525453
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26262"
FT                   /db_xref="GOA:E9ATI8"
FT                   /db_xref="GeneDB:LMXM.36.4050"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI8"
FT                   /protein_id="CBZ26262.1"
FT                   /translation="MSSDAAATSEAEGDMLRSTGRRLVYGFLHDSHCHLRRMSPGARAA
FT                   SVSNPIAGVDCACIKCDDARSSVTGLVVCGTHPSIDWDAVAQVSTMHAATLIGFGVHPW
FT                   FVPNRVGDESPASSIFQEYSSGEACCYRSRSSAEANENLAASGAAAQSLSAILRLLEAR
FT                   LQQHPLAIVAEIGLDKVRGPPESVQVEAFAAQLRLAAAYRRPVSVHCVRHYGRLLQVLR
FT                   DLPAEHTPPAIILHAFTGSLEVAKSLLSLKSKRRTPAADGSVTPAQDAAATADSGTGAQ
FT                   RKTKRAGTTSDTVRIKDLIFFGVGVSTSFTVKNFSTQTLPFLVDARRVLLETDEHYSGI
FT                   EAPTAASAGEFPAEVETQSSVRGGCRACLWVDPQEHVAKLTGVMERIHASMLQNSDFVQ
FT                   KAEASSMSVEAVLQDTLVHAYTAAFRSVSEKTGTS"
FT   CDS_pept        1526215..1528287
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26263"
FT                   /db_xref="GeneDB:LMXM.36.4060"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATI9"
FT                   /protein_id="CBZ26263.1"
FT                   /translation="MFFWGSYNFQEPQLSENPDRPPLRYPGYLPPSLAVLRRSAPANQN
FT                   ATAASSSLQSDAASVQEALRSITALRMQVHHIACGAKHLVAAVSLVPAVEAAPAGHSEA
FT                   VIALYGMGNNEYGQLGHHVANYATTLTHLRLEDLMEGTVVSVACGARHTIVCTSTGCVY
FT                   VTGDNSFHQLGLPGQMVKPLPRGGTYAPSFTQLKSLAHVKAVYASGNASFALDRRGQVY
FT                   SWGESKYGHLGHNDNGERLDTQTLKTVSIDVATPQLVRWFERHRISIVEVAVGRSHMVC
FT                   RSEEDVYTCGEPFFGKLGQGDIDPRLEPTRVKFPPRKQVERLLNIAAGDDHTLVLKENP
FT                   LIGTVVYFFGKLNNGDGQLQPTIVQLPTTAVRSVMAGRGTFCAAITQEGQLYVWGKHAY
FT                   TKVYNGTSAAASRTQPSKVHLLESYSIGGAVSGGTFMVAYAAAGTFVRPVSDPAAAGSG
FT                   KVEVKEESGTVSAEAVAATTAARSWDVVVPHDARVGRNGLGDPEEDYEEGLRALLRQYL
FT                   GPALGNAYVAQLPAAPPRTAAPVYQFDHIAVKDLSRGQKVRLWMTNIYALGTIVDELAD
FT                   QPPGASSSQACEASTSSDAAATVAPSAPFQHNKGSQAGAPTQSGAAAEEDDDNHSPSSL
FT                   KGKRVKVEWQRDDWDDEVVTLYSEDETLNEENVNRWQPFWFEQNPDGEYVVPKSK"
FT   CDS_pept        1530347..1531390
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4070"
FT                   /product="phosphoglycerate mutase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26264"
FT                   /db_xref="GeneDB:LMXM.36.4070"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ0"
FT                   /protein_id="CBZ26264.1"
FT                   /translation="MSFTFCRFFCSVGIGFAASPLLRGAAVALCETVKPAAPPGMGSAA
FT                   HISANSLVNHLFDEDPLPTKEELQYIKTWGVPWVEDWDRPGNRGIRADRSASHQRQIVM
FT                   IRHGQYGNEGINDDKIHRLTPLGERQARETGVYLRRLFEESDKRKKLNAIYRQARRAHK
FT                   QAKSDGASEEQLTQLERKMDEARLALCGAGGIFVDAMPMAVHVSDMTRAKQTADLILEA
FT                   FPEDVRLRKDVDPQLRERIPCAVQPARSFTPSAEDMHIAETVFERYFHRPLESGTSVEI
FT                   IVGHANMIRYLTMRALQLPPEAWLRTSLPHCSVTTITIRGTGHVSLVGMGSYGHLPPDM
FT                   VTVSNVK"
FT   gap             1533866..1533965
FT                   /estimated_length=unknown
FT   CDS_pept        1536620..1538206
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26265"
FT                   /db_xref="GeneDB:LMXM.36.4080"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ1"
FT                   /protein_id="CBZ26265.1"
FT                   /translation="MEADTHFIFQYSTREGHSWLKRDVMSRNYSLITPAYGCGLVNAVL
FT                   SALEDAAAHAPVEIDATVKIQAAFRMYQQRKAFLMLRQHACLIQRVYRGYATRKRLDGE
FT                   RATVRRMAYLQTVFDMFATRIQACYRGYQSRKTRSNYYAQQAYLNVVTARSSEVLVQAL
FT                   STQAEQDALRNAEAKRVHNLSYARRTAHMHYMVSTCSVPSVYQLSPASSTAKQSTQNTS
FT                   KTCKAVRSHGGECGVVSPVPPAVKSAGEGSDDCAADDEKLMTRAATYVSGQKLEEDIRH
FT                   HARAARLERNAVKAKASHSPGVLTVPATASSPSPDKTIVAGPEAEGAPMSATSQVSGPR
FT                   LPALTPSQSAQRSRPVNSTAPAATVTVPWEVSSAHPPQKPLTPRAPPLTGPSFSQTAPP
FT                   ATSSRTTRTHRTPRKAQQAAEDDNFHATGTAAVPTAGPAPSAASIDPSVSRAAVSSFHR
FT                   RFAVKRHDCLEHQLSISNGVVSDGNSSHALSSALLSAKEDAAVQRSVGHKVMQALHGDV
FT                   IFKVSARQGLQ"
FT   CDS_pept        1539375..1540673
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26266"
FT                   /db_xref="GeneDB:LMXM.36.4090"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ2"
FT                   /protein_id="CBZ26266.1"
FT                   /translation="MRCISTRSYESADPLTDCTVAVQQLMSKRSLLPPSPTADELLQLL
FT                   QESGHPCTSSTAPDSDMGVLGWPPASFSASSIKCKCPTSSRVASSFAAAGAHSVLGEML
FT                   QFFAESVTHLFTTGVADPSVRAFPSEWDRRLHAPAAASLRQHHLYELQGFSALFTYMWG
FT                   QVATSLPLLREQQGEEKALVESTERSMVSPNSEATRSTRSSSAKSPAAQQPPSPLLLST
FT                   SAATAHQPQPFHRTARKGGSGGLQSGNSSGHVRPLLPLAPAALHLPNAEIESVHCRGKR
FT                   QKDGLNSAVPSRLAAQPPTLAVLQHALTAQARARGPFLPSIPPEGLLPSSGARRLEGPH
FT                   PENSGAANDYAKHSLASAASDSKATASHPTSAQILSVEQAMQLDRQRELQRKLGVRRVR
FT                   NYAAEDDMRNYLDNYQANMRSVLEGDDVAEDGT"
FT   CDS_pept        1542571..1546989
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4100"
FT                   /product="glycosyl hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26267"
FT                   /db_xref="GOA:E9ATJ3"
FT                   /db_xref="GeneDB:LMXM.36.4100"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ3"
FT                   /protein_id="CBZ26267.1"
FT                   /translation="MAKRPFGSHGVRYWRTRRLLLRIPLALAVLVGVSLVVVLWLSAYE
FT                   NTGVTEILSERHFFPPAKHGAKDEGKEVHAYGESAFRRPSSVSTTTRTPAEETPNGVDA
FT                   VWFSPNTRNSLDRNTSWLQSVFTSAGRVRVALPFGVHADTGAFVAQKPRLFAFIASWST
FT                   YGRALMARGAQGNDTAAVSDIDEELQIFARRRVVPVKHVEVRLLRQRRSRSTWANETET
FT                   TLPIVGILPRESTTLVSAEELLVKSAVDQEGLAPLVAAVQPGSDNKESTVVGIDTRLRV
FT                   SAAKRFGGGANHDAGDSTSLLPFPLLELSSVPRRRATSPDSATPASPDTSPATALLKWR
FT                   TSRTTAPASSEALEITLDIAHPSRSSLNAPLRAEEDEKMRPGARDDTYAAALEATVCSA
FT                   RLVRLYGFSPSFSPAQTHGGSADVSAAVAAGGLNLIPLNMSEEVELMVGGEMQLLSGGA
FT                   RLSGLVPLVYLELSDKSAAGAQQGAAIAGRQTVGLLWLHPGSFFVSTLTLTDPTGDHKP
FT                   LRTCVRLRGTAGATGLYLLPGPTAVEVLRQYYTLTGFPTLPPRFLLGYHHGLRGAVATT
FT                   QQAAEELSEAFRSSGAPLDSVWITDPAVAAGDTPFTWNHTRFPDPLALQSNLWYRGRRY
FT                   VVLRSVPTVPITTRSPLLLEGRRGGLFVSLSAADTAGWPVLSVDGVPSHVVDFFNPTAR
FT                   KWYGGMLKYRRYVGSSNHTFINLQHSAPTVLSNAAPAKVREELLCLPPGVRASGEQLPM
FT                   DVGHYGGVHHRQVHQLLTVQFARATHDGMLRRTRYHRRALTFAESYFVGTQRYAVVRVE
FT                   TRPRCASAVRSDSAAILTEAWRALQTAVHQCTQLGVLGIPFSGANLADGLASRLLLLQL
FT                   AKSASTTATLTAPLAGVAGEGGGDGAVGVNDELTAPPASSPGAMEEMEQLLVRWYQAGV
FT                   FFGAMYADESAPAVETTGTGVVVSLRSSSTGPWWMRLPVAAATRQAINANLHVRYAFLP
FT                   YLYTAAYHASEEGAIFLAPLAFTSSEASPLSQETTMPTCYAAGSALIVCPVTQPVHPPR
FT                   DTSRSNGTRSADCKGFFDLWTGVWHSTVSSGARHASWWEGAAQYSAQNRALASKELGWL
FT                   ATNDAVSLQDLPVAASLAPVLLRSGHIVATQNVFSPRVNGTHVGDDKIVGDAHALHSTH
FT                   VGANWTLTVALPPLPAAEGAVATSPVLLAEGDVFWDEGSHNSQHQPPTMKPGSSVLPDM
FT                   PYIPSNVHHCALHVKCLYEAAEPSEGTARLTVEVTQTSESCAEALAELVSHWNAEPQGF
FT                   AERLANAKADRDARLHRLQVEQNEQEDKGMRGGRGGAKDSPDASTFTGEDLRGLHLPNA
FT                   QDEATRNKLWTSYLLQRLRFLFQCEEDAARLSPKSSTSRAMAVVVERRSRTGGTPGAQA
FT                   DEDSAVRASVRASHDMSDAHAVLVHLISDVQDEGAGGSVFGARKVVLPDGFVSVRVPPH
FT                   HTWRFTFSLMN"
FT   CDS_pept        1548265..1551333
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26268"
FT                   /db_xref="GeneDB:LMXM.36.4110"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ4"
FT                   /protein_id="CBZ26268.1"
FT                   /translation="MSFRAILRHLARPTAHGCAQAAPLSSSPKKDQQQMAPLLQFPQFH
FT                   PIPFPQDKFLSIKSRSLETYTKVRGDVLQRCADLCAQLQRRQKQAGQSGRETASVAGPV
FT                   GEEASASPAAGISPELPAHPLTPHQAEELLLLTKKVEDLVHYQGFLLTDELVWRMFHLC
FT                   IQCGAPQLAVDGWLQKHVIAEKRGPPFPLFILEDLAATLRASLLPRLPESGACLTCSSV
FT                   LLAASAGSADENFSIAFEDGLAAAQRFLRRHLLHAGWPTSDAVTTELLSAAQTYTAHLL
FT                   AEHVWPVWQALEAMNLTFTDLRAKNIEDEEEQEAANDERGSEKKPDGCSSHMSEGEQGR
FT                   CAAWLPDAATQTVAVRTALMSVTPLYSFYAPPSSAPPPSVAEGQRDSSKSAKTASTRAH
FT                   ALLCNDPPFFPNETAAIVAPLRALLDTWLVLAQCAAEAKDVPLLKALLRTVCLGFLARP
FT                   AATSGDERDAGETEDGAQLSPVCVNEDAWCQYAAPDTEQTKDAAHQRAAELQARAMVRE
FT                   FVNGSLSVLQYGLLCAEQEAALWQLHDTFALISAVAASLRNLQGPQKKRGSHSATADDA
FT                   RLHRMSAVSLAQPAPAEEADCLLRLALPCALVSSFARGQHAAGDEEHASATAAMYAFVC
FT                   DALAHPAETTAHPYAEAGLYAALATGDEALLTQTVTADMARNNSGATLHLLHARALHAY
FT                   RRAATRLATTHEGGEEKAPEDDAWDAWTATLRQKVSQATSGSGDADIPQAQLVETCLTV
FT                   LTLGVARRQAQGAAAYVQCVQQLTATSVAEEGDDTQDDGHNSYGNAEAEKQRREAIKVG
FT                   WAQLYDGATACAQDMLNLVEQLLDASSSADATASCLSPLSLSTLAVLTRVGIYVEEEAQ
FT                   ARAASASTTSEDLSKPAGVSPSPLPLTISLDRVVARVVRDTCIHLRCASTASPTGVAPT
FT                   ATSSVVGNWVQWVLLTLMARRAWTDVLAVLRALDGEASGGGSAANAAGTSSTLLCSTTV
FT                   DPSVFAALYARAMEDGAASVCAFLRPRRERLFF"
FT   CDS_pept        1551867..1552421
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26269"
FT                   /db_xref="GeneDB:LMXM.36.4120"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ5"
FT                   /protein_id="CBZ26269.1"
FT                   /translation="MRRTRLVCTATPEKFSILGTTHPKPKRNGMGRNNKMRSKPSDNVA
FT                   WYDKGPVEWLPRPVRLTYDQLDQLRDWMMRETIAGRTEEFNKIRHLHREWSQHPLMPVL
FT                   GDVEPKFPLNLYKQNHRAKKRFLVRWHKANSPTYWMWMPRGPAVATPLHRSSPSQFPEH
FT                   WKALARNSSSSGGSGSSSVAQ"
FT   CDS_pept        1553170..1553883
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4130"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26270"
FT                   /db_xref="GOA:E9ATJ6"
FT                   /db_xref="GeneDB:LMXM.36.4130"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ6"
FT                   /protein_id="CBZ26270.1"
FT                   /translation="MGMLDRRAKDKRSCGGRTVNALCTVFSLRIALGIIYFILVVLLCI
FT                   MQDIPLFSTPTIRIMNIEASHIVGAKTFIADTWFKVDQSIYGANVTGHIDVKLWVTKMN
FT                   MDVEIPYGFLPQNISQVYHVQDVPCAEFRNFFRCMQIFSLLSIFTGFIVWVFTVSNFFT
FT                   RMFLPLLWLFLWVTIAFTATTVAMMFRVLCDGACYGEVDEIPPFTSLAMPMDGFALAFI
FT                   CLQTYLVTSLMTVFL"
FT   CDS_pept        1557002..1557601
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4140"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26271"
FT                   /db_xref="GOA:E9ATJ7"
FT                   /db_xref="GeneDB:LMXM.36.4140"
FT                   /db_xref="InterPro:IPR009944"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ7"
FT                   /protein_id="CBZ26271.1"
FT                   /translation="MLIIRFVLLVLILVFFVISLVGTVPLPLYSNKITNYNQDGKVEVS
FT                   LWNIVVGKVTVTGENSTNVPTSKPVRINYADCEEFRATFRAMQAFAIGGTVFGFYALLV
FT                   SCLQCFCRLKVKLPLFLFLFMAMLCELCLVFIGGVAYSKEFCKNLDKNSSSITVIFKGA
FT                   GYKFDTAFILQVVALTGYAICTIITPFTQQLWCGKC"
FT   CDS_pept        1561358..1561927
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4145"
FT                   /product="transcription factor S-II-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4145"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26272"
FT                   /db_xref="GOA:E9ATJ8"
FT                   /db_xref="GeneDB:LMXM.36.4145"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ8"
FT                   /protein_id="CBZ26272.1"
FT                   /translation="MSTFSGAAKLQTPPQQRQVHYISDNVYSLGTLSCAVCGQSFPIHT
FT                   NAYQRSTCGWCGTLHEPGTHSALQQHLRTMRRASDGVKMSSKVCCLDTSAALFFTEKEV
FT                   TAAVEYIRQTLGDTSLLGTAPGAVGGAKRAGITEVDNRIIEDAFCETCGVHRPCKTFAR
FT                   QTRSADEGQTIFFQCTKCSSEWQQNS"
FT   CDS_pept        1562835..1564685
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26273"
FT                   /db_xref="GeneDB:LMXM.36.4150"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATJ9"
FT                   /protein_id="CBZ26273.1"
FT                   /translation="MPKSATHASSTASPAAANAASAKEASSTLADLAATTAPVDCVLQI
FT                   GQPSFSTQLDFIKVNRAVASLERAVERLELLSLLDAAGPTTGTERSHQIANSTRTALSA
FT                   TAVAAASTASFYPHNSSRGPAVLSGISHDASVATALKVAEVLAVTQQQRGYGRASVLEL
FT                   LAEQRVLERRYGELLTQAQPTVLLHPGEPQLHPKCFAHVPDPSKAALQQELALVSNRLR
FT                   DTNRLLCTQLQDNPQDRDNWAKVCNGRQELTALLREVIKELTVGYKEALQAQQLRQQQR
FT                   QSNALLDGSLRRSTAQTTVGEDAHFSHVAFSGARVSGAARNDRRSSSTVGGGAVSTESG
FT                   SRASIFLKCFGGTLQRPHASRVVQQGPRIPLSSSYQQFAVKILQEEASQRWADDVLAKE
FT                   RALNQNVKQLQVDLVRERELKDKEVAERLARISALKVELRKLKTALQQRSEAAKACGEA
FT                   ATENLQREGTAEVRDVRKAIQQDEQLLSIGATTHEAFSAYLRERTAEMDLLAGEWEAKT
FT                   LHELKKKEAAKIDAEGSRQACAQRLTDLEHERDAQQELKGQRDSAQKTEEDARRRAEEQ
FT                   RDAEYAAASVLEAALKAMMTRQTISKLQKSSKKKKKKAAS"
FT   CDS_pept        1565673..1566677
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26274"
FT                   /db_xref="GeneDB:LMXM.36.4160"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK0"
FT                   /protein_id="CBZ26274.1"
FT                   /translation="MSKDKRPRLAKKAGEVSNGKRKRVTSLPTAAPDHRAPRMQRAESA
FT                   PAAPKSIEDVARLFIGVGRSSSSGGEACAGTESISLHMKKAKGSMKRLREGAENGTVGK
FT                   NSPMKRQKRSTTGALPSATTNNAMAFERKAGRQPKVAGCYEVDEVDEEDVELSKAVQAQ
FT                   TLSFLQHLNSKSSKAFWGLRDVAQGKLSATTATTAMSSSSPLPSSSRTKAAKGNAERAK
FT                   RLADDGEELWRVGGPYIPSDQADDTDESERERGHTNDFESQSSTSSSEPSWVTDSSEEE
FT                   DGGGSYAEGYDEAEIAPVAAGATNRRSAAEPPKRGGGGGRLFQGGGDGVWDED"
FT   CDS_pept        1567500..1568522
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4170"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26275"
FT                   /db_xref="GOA:E9ATK1"
FT                   /db_xref="GeneDB:LMXM.36.4170"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK1"
FT                   /protein_id="CBZ26275.1"
FT                   /translation="MSSPSSFKKLQVVSLSKDFRSSTSVVEAHLPEEVPEGMVRVSVKY
FT                   AGVNASDVNFTNGSYLKNAQPPFDCGFEAAGTVVQIGAGVANVKVGDHVVLMQYGCFAE
FT                   FLDAPAETCIPVPELKPEYSVLPVSALTAAVALGEVGRVKKGDVALVTAAAGGTGQIAV
FT                   QLLKHVYGCTVIGTCSSEEKAEFLKSIGCDHVINYKMESLDGRLHELCPKGVDVVYECV
FT                   GGQTFNDAVRHVAVHGRVVIIGSISSYKSGEVVPFSDPSGTSVTMLLLVKSASLNGFFL
FT                   PQFHDVIPKYMANLLQYLKAGQVKLFVDKKAFHGLSSVADAVDHLYSGANYGKVLVEIQ
FT                   "
FT   CDS_pept        1570836..1572236
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4180"
FT                   /product="UDP-N-acetylglucosamine--dolichyl-phosphaten-ac
FT                   et ylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.15"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26276"
FT                   /db_xref="GOA:E9ATK2"
FT                   /db_xref="GeneDB:LMXM.36.4180"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK2"
FT                   /protein_id="CBZ26276.1"
FT                   /translation="MTLGLVESSRSAAFAVAAHAPVLGLILLGSIVAYVGTLRYIPNVA
FT                   RTLLDRNIFGIDINKSTEEQRQKFAAKRRAGQTEEKEFQKQAIPESLGILVGAVYLSVV
FT                   VVLTVCLRFLGAAGEGLDNPYASLPGPLMTITVMLLLGFVDDVLDVKWRHKIILTALGS
FT                   LPLIMTYDGSLSVLMPCAFGRFGLSTMNVMKEWRLGLAAPQGEPTTTFRATALSTWFSF
FT                   TVNHRSYVKVTESGAALIYLGPVYLVYLSMLCIFCTNSINILAGVNGVEVGQSIVIAVA
FT                   SVVYNLFQMRLDRQLTPDFSSLDAAAADARDMTSDHQLRALLLLGPFIGVSLALWRYNR
FT                   YPARVFVGDSYTYFAGTVLAVSSITGVYSKTLLLFFAPQVFNFLISLPQLFSIVPCPRH
FT                   RVPTWNPRTNLLSNSHNYTILNVILYLFGDMHEAKLTWAILKCQVIACVLGFVVRYVLS
FT                   AFLYDEVR"
FT   CDS_pept        1573294..1574325
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4190"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26277"
FT                   /db_xref="GOA:E9ATK3"
FT                   /db_xref="GeneDB:LMXM.36.4190"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK3"
FT                   /protein_id="CBZ26277.1"
FT                   /translation="MSSSTRDGAGGGGGSSSSGGVALAVGSLADEWAFNNYHVSSFMAM
FT                   EVPATIVPRFVMDRVDCLGGSYGPFAPNYPIDVPLWLALYLRQTNTCAIQPPDYLRVEY
FT                   LRDIIERERTNDQGFESLPFYFYEIAKKLTERCGGSSGGGGGSDDGDTIPHVVEVIRLV
FT                   NEIHAMRQQKLKNLMAVFEAEGSPMFIPGVLLTNIVCHELHFLRASFGIVLQQAASMER
FT                   QRQQLIRLPPVSAATPGRLSSTVGRTTLASGMSTARTTTTLSSTGTPGVATTAMDLASK
FT                   MGSGSFIHEGVANSQGSALTAATSMTTAMAVTSDGGSQPTATADVTPLTQPAVKKRRTL
FT                   RQT"
FT   CDS_pept        1576126..1578555
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26278"
FT                   /db_xref="GeneDB:LMXM.36.4200"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK4"
FT                   /protein_id="CBZ26278.1"
FT                   /translation="MSHKRRSSKEMKPEVVLLLRHQSRYPGDLLEGVVILDIPFPSDIL
FT                   ALEVRLCGVERSILGGLFLTDKNPEARKTTYYEQFITLRGVDHDLLDSKRSLRNCRRIA
FT                   EAQGLRTGLNSVSRQLSLPEGDVVPELSASVIQSASEAAIHLIPGTYSYPFSLVLPDNL
FT                   PASCELYRGHDGRCVLHYHTVASLMMTSGKIYTSEAQLRINPLPVQVQRWYQLHEDEQQ
FT                   LCGAAVDSGGAYDNETESRLGVLSRLMSSAGTTREDKMEWGSEIANQRRIRHYRQFPED
FT                   QLMLEAAVYAETAGKRAERKKRRACERAARERGSLLVAADTMAVTNGSARILQNQRELE
FT                   EAEKRSLDSEDGAADAANELDDDADNKVYDFGPEVSSPRAVASIRGEKEYGNGEFYSNS
FT                   GGANVGSRRALENRGKKKQHHHSHERDAIDSSANTAMVENNVDKLTFTPPGGELPAPMA
FT                   VRRVNQAEAVSHETAHGSTEEGREWKQPRGTHPHRLRSRFQPPPWNQEFSIHLRSGFLR
FT                   TGKVKVLLSLRSPLVTVGVGKVGATVLIDNSDGSGTISRVKYSLVTQCYIRTKTEVYNF
FT                   QADTVETSSDVNVEKGKVVKLPEVELPVPNSTPLTILTEGMGAFTFLSVRLYVDTALKT
FT                   FSRSVATEVVLVSAQDLLNCSRRLLRWTCFFRRRNGEDARDFTLRPPTINLSEKNSKLR
FT                   VIDAGNRGAVRVQLGPSLQSDDADTSVMAASAVSRSMRILRTSRRSSKAAPPIDVRLLA
FT                   KTLNYEEALFVPRDDEDGSSFPRHVDPLAGLNPFVAPVSDVISNLAEGDNYETLCR"
FT   CDS_pept        1580944..1583898
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26279"
FT                   /db_xref="GOA:E9ATK5"
FT                   /db_xref="GeneDB:LMXM.36.4210"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK5"
FT                   /protein_id="CBZ26279.1"
FT                   /translation="MESFDPFRVVGSICGPVPVCPTLLYGTPVLMVATGRTFQLYKGKE
FT                   LAMMRGGPTFQDSVRAVAQVGKYRAVAEGPRLHVYVHHKPLWSSHHEAATKPSITLLLA
FT                   QDDLLFSVGDDKRIVVWELKTGTVLQAMLVENSETVTCLTFLTGYTNKMLLATAEGTLQ
FT                   LWNFRSGACLWYSLRSSGSSSGQASCATAGGVAAITALACSRYKDIIAYGTTEGKVVAC
FT                   NVATDEVITTFDHSESCAVASLLFRTDKDGLLVSGTSRGEVVIWDLENRCMDGTLTRSK
FT                   QVRSEMEALERPHVDVVHSLVMFNLPEYTSLLITGGADNALMQFRFDTVDGLGVLVRER
FT                   RGHMGSCTNAIFYNTDLLVTAGNDRALRVTHVFSDRASWELSQGKLGKRGREKNLGREA
FT                   VKLPPATALAAATTRNYQWSSLVSLHAASALACGWRMDTRAMEFKLSGIQTSAHTARAL
FT                   ALSDCGNYAVVGYSSGNVAVLSLQNRSVRHLFDADLGADRAHDSSVECVEVACGNTVVV
FT                   TAGLDGVIKMWDLWTGKLKAAIPTGQPMTKSCMHEASSLFIVVQHFTIRVYHANPDVGL
FT                   TEEELRTPVRELEGHNSPITALALAPDTYRYVASTSGDGALLVWDLAAAACVGQYRFAS
FT                   PALSLSFHPDALFLVTTHAGERGAYLWVNNIRYGYVPEVVLSPKAKAVETLPWLHFPTA
FT                   HGAAEGTVENSANGSVPRTSAAAALTEAEEEERAAAEAEAREAAVAEANLFDASQDIAL
FT                   ARRRQTEAQQAALDAIATEGMQLAGVPQRLWFNLTVLDQIKEKSQPLLPPKKKDVPFFL
FT                   PTTQELRPTFLVMVSDNRKSDTGNAKGRLIHADMEELTPVQEMLVNEKHDALMDYLLSL
FT                   KTAQAIDLELKRAVDYANGSSYTVAELARMQACVKGLLSFITTWLRRNKNVDFVQGLLA
FT                   DVVRSHGALLTRFGDALVSALEELAEVQNTLRYSVDHLVSYPACLAGTFSGSIF"
FT   CDS_pept        1585117..1586865
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26280"
FT                   /db_xref="GeneDB:LMXM.36.4220"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK6"
FT                   /protein_id="CBZ26280.1"
FT                   /translation="MEDACLFQPQINPRSRRLARHAPTLRERQEQDAQRRSAGREDHRG
FT                   QPQRGTPTPSPGTEAFAADTESDTVEAVWSLWRGVAIREARETEAALVRRVHSVNDDGS
FT                   LPQRRPRVVYVTAVLGMLNALGITSPRYDALIAKFLKAMTVEGGASEATKRDETVDAAR
FT                   FMYVFSTVWRAAVTHNTPRSPSAAQQCGNSPNGATMRHTYAKKVPRRGAPPSRMKAAPA
FT                   AEVGSSGGSDSAVSSRSSSSPSVACSSSEGGEGAAHSGTESASPLTSCGSGDERRSNTA
FT                   ESDADFLRTNISDASSSIPDSSEKPQTDVRSQELSPMSMEPAAGLDPSPEPRNPGEPVI
FT                   ITPARSSVTPRTHHCSPFAAASRFGSASVSHSRRMNSSSRVIPSDSHLLSSTTSRELKR
FT                   ATKRVPGGLMRECTFKPVINPVYEQSPLSFSSTAIVQKRKPASTARSTFQPSTQQFHQA
FT                   RDSLACWTKQPVKDSGGYRGEAAANPLATGVETAVRRMIAARQQRQGSQSAVRAPVAHP
FT                   RKPLLYVDVDLPQGQRDRLALYTGDDVQDVAQRFSILHGLSESLCQRLATALTAELCAL
FT                   STGQAA"
FT   CDS_pept        1587954..1591193
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26281"
FT                   /db_xref="GeneDB:LMXM.36.4230"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK7"
FT                   /protein_id="CBZ26281.1"
FT                   /translation="MSESLFKEALQSLSKKGVAHIKCAGADLHDHQLQLLITAIENSPS
FT                   KPEIIDVSNNNITAAGVAYLMRYLPTASVEAVDLRNNQIDEDGALTFFPLFEKKTSVKL
FT                   LDLRNNSCSAATASRLYYLSKTEKCTDDVRSALLTGSAQHISFSGMTYCELEKELLRFL
FT                   LHIEGLQSVDFSGMDLGVAGMITVGTFLKDTQVAAVSFQNCRLTNDSVLSFFQAADLAN
FT                   QRYPNSFDFSSNVGLTNDLVRKLIPTTFDQSHCITNFVLTKCSVTPTYVRLVQKECELN
FT                   QENLSIKHAVVALRNNSSAAQEINLQWDGPVPMCMKYLADYIADSLVIQHLNISNSLID
FT                   DAGLELLSVALQKNTSIKVIELANCCITATGIQKLFAVLEKGASLVEEVNIANNNLDEG
FT                   SVQFITAALRANPRLKILNINVNPAISAASIQEIAGLAMVNRAPPRIRSVLPLIENNSK
FT                   DVVVLDFSGKDVTLDDDSVWLLAQALRLNSTVRRLNLSHNSFGDTGASFLAGYLADNRT
FT                   IVELNLSSCMIGNRGAQNLCEALATNGGLQSLDLSNNMMDTDSLSALPLVLRENTALRE
FT                   FKLERTRVAPEFVEQVKMTCSLNRECAAVKRVFYRLNDGDASLTKIELSNPDEERVIDD
FT                   QTVSTICAVLRNNTSVEVIDLSGNRIGRMGCSALAATLSECTCKVRKIILSKNPIDDDA
FT                   AAELATCFPKVNMLREVILYDTNITKIGMEALAKGLEENTSIVWIGITDDDTADGNTSL
FT                   LMRNLALNSGPAALKRISLSIDAGVAVDDVDLSRPVDCSIDDSLCKFLCASLARCPTLR
FT                   SLKLSHNTISSASVPYILEMVDMCPLLASLDLSDNQIDECGAQQIIACLERVSHLRSVN
FT                   FTGNLFSTESLEHIAQLAALNMGSEVLKRLYLTATRGEELPSDIDLNGTTNSYMLTDEE
FT                   VLVLAGLLQNSSSVKSLDLGSNSFGDEGCVAIAEVLRFNHTIEALNLAGNPIGSKSGEA
FT                   LHFALKINPQLQHLDLEKTAIPRDVLESISSLLHVNQTPYRAVIDMRGVKLHEVNDETQ
FT                   FRSTDYYVSQTVTLEDDAIEGCRRLEVKLIE"
FT   CDS_pept        1592022..1594130
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26282"
FT                   /db_xref="GeneDB:LMXM.36.4240"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK8"
FT                   /protein_id="CBZ26282.1"
FT                   /translation="MPSTVEQSLPPLFVLQEHADPVLSCRFYPSEVYQRDESSWFLSGD
FT                   AGGLVVLWNLSTRRKMISFSALTEAHRQLCGISQHGRNRGTPTGGLVPEDEVLLEQAGT
FT                   RAFGPHSQSILSVGFIPLSLSSPQPIAVAENRGVVDSLVRGSDAEVSSGTVCPAVVDHA
FT                   VKGTSDWTHPGRPRFRLSRRAPTRSVSCEQASSLSMGNVLDSGAPGFAFTPSSTICFYT
FT                   HCRDQRVYIWCLERQCTDAPASSPPTRVPQLVVVLTAPQHGFCPVESISKTAGPFTRTY
FT                   LAVPHESGGEVTVWELSWRQPNSTRLTSTRELEEKGASNRPRSSSGNANVLEEEKEDVN
FT                   TSGMNPMDALIARAAAEERRQAKMKQKSTRVSGQSDFDHPSPSAAFPDSVISRGERASI
FT                   LCYVDPAATTTSSNFSVRRLCTFSACPTFKGGTIMRLTMCHDAQHLTVAFESGHIVLAR
FT                   YRNADVTDMADQPGGSCHAGGSLSVAQVRNVTRAFADSALVCWWSGRRMLACSSEGGMH
FT                   CYDMSATEEGLLEAHLVWSATLRKGIGSVFLQRNLVVAGCWDSTLRLYDARDGRLVSIL
FT                   SYQRETINEVRTAPPSIARVATFGFDVRQPRLYAGLPGTLSTKITACIASNSTAVTQGN
FT                   LPQYSESPSRETYVAGTPAPNSSLESLAAEEQLVYLFASASKDCTVALWRVDLGLVVEQ
FT                   MAREAIPA"
FT   gap             1598168..1598267
FT                   /estimated_length=unknown
FT   CDS_pept        1598367..1600790
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4250"
FT                   /product="protein kinase-like protein"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26283"
FT                   /db_xref="GOA:E9ATK9"
FT                   /db_xref="GeneDB:LMXM.36.4250"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATK9"
FT                   /protein_id="CBZ26283.1"
FT                   /translation="MMKSYRPPAAFQQGRYIPNKVLGTGTYGQVIQCHDTVTGKDVAVK
FT                   VAQSDAAYRRSALNEISALLCLKENEDSVNILDSFEDAGHVCIVSELLDRNLFEVLRHR
FT                   GFGPLSLREVRQVALRVLRALASLHNSGYIHCDIKPENIMLRRSTPVSSNSSSPMLGSF
FT                   TSENASSGSSNKSGEQNNFPNALAPGQEALKLDTNTNAHNQLWRNTNSIDSLIGNTHSA
FT                   AFQDSNLNMGFSPRTGNRLGGYSQQQHGRRGSGDTTAAISGAGMRHSGSFDALFGMSAA
FT                   AVGASGTGNNTRNDVRVNRNALGNKGSESQERTQLNPDANPYCRTCLIDFGAVRRFNEN
FT                   TYYDVQSLWYRAPEVLCGLPYTTAIDSWSVGCVLFELFTGKPLFPGESLQHQLSLIVQH
FT                   VGHPSQAALTLGCLATQFQLPMVFVSHDARREHVRQWILSSRELGLQRWRKHQMQKLQE
FT                   AHIAGNQQLWSHRTADVPSAKSEEDALLTATPYGESDVDGTSEELKLLVDLICDLLNPD
FT                   ESQRLSCTQALHHSFLNNVSKRCSAAPCPYTATPAACFPTVSAAPAPVPCIMATTTTGQ
FT                   SVMMTASPLSVPMGCSPASPFVMHPVHSAPAATVPFTVAPVESMVGVEMEVSTLGVSSR
FT                   HQPAQAFSTYPAVTTSTVYTTNSTGQVMQCAVPVFTQVAHQVAPSVGHAFLPLGMTAQN
FT                   PASGIYCSPTTTASQQQYPSSGMSISPTFSPGGALVHAHVPLGFTPTTASNPSAVTAPA
FT                   ASVQPLGASAYVLASAGTVPCIRDYHSEMASAGISPYVLCHFQPQHACATVMSP"
FT   gap             1608381..1608480
FT                   /estimated_length=unknown
FT   gap             1609668..1609767
FT                   /estimated_length=unknown
FT   gap             1614376..1614475
FT                   /estimated_length=unknown
FT   CDS_pept        1615591..1616886
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26284"
FT                   /db_xref="GeneDB:LMXM.36.4260"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL0"
FT                   /protein_id="CBZ26284.1"
FT                   /translation="MSSTATLSADPDASSSCASSHVSTPDTMSVLVPYKRPAQESSVAT
FT                   GGASRQQRFPKSTYGGKNIRTSGSTLGSSVSPHGAGAASRGDQSRRGDGVPDDALSSYS
FT                   LQPAAPLDRPRDEEFDAVERRARMALESIATQDEDLEPRMGDHIEVLQSYRTACEARAM
FT                   YREAYLVQQVLRNLRLEEESRHVRGITEQQMEERRILEEAHRQEFREFHHSWNARIDAF
FT                   EEEQLEAELALLERQNEELIRFQEELRNFQPRLLRYSRSLLESRLKQQTLAKQRDYVGA
FT                   QAQKAHAEAIEVEDIERFEAARMSLFERREYAARHRHQQELYALRSKVESRRLYLERYR
FT                   KQELDVLLQRYINARRSMESQQNIVRNKTGTLLLKHACNMKTDNSGTAVLVESAGSGTF
FT                   GTVVQRRQAYELRASQGPPDGASALVHNVNAM"
FT   CDS_pept        join(1618312..1620137,1620238..1623199)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26285"
FT                   /db_xref="GeneDB:LMXM.36.4270"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL1"
FT                   /protein_id="CBZ26285.1"
FT                   /translation="MLGTLFFDESRVSTAFRARVRQQAGASHELSATRHGLSNTSLPVS
FT                   ATHDGVARLHDGGGLVPAHGCTFSCRGEVALPSLQAALLWWLDADVNVVQLLVMNNTQS
FT                   SKAARSCQSRLLTVELPVASPENLVTCGVTRSYMGDNGVAVVWVQRGVSGDGGEEVLCP
FT                   GFAHVTVQREADNTGHSNLLLYPDDRVVQCAPLSRVSSSFFQSALACSGSAACVVAALP
FT                   DDATQHTISIVVLTDGSRVWRAELFADGTTAVSGFRDEYRRNMLRSFCDGNEEVRLLDT
FT                   RSVVADLQRLASPPASNAPSFAESGAEEGSTSPRGSTWIRRLLGSGGRAGANVVDGGDG
FT                   AASGVVDVALSAVVRKRLYAAVTAVQQSWFVALTRWNGQLEVYDTARGTLKLTQTYPIG
FT                   ILPQTILRPIDGGFSGRGAKALDGKSQLCALPPGPLAQWATLCSTTQLLHVVSCCSGGG
FT                   GRACFWSALPPLAPSSSRIVGFEASDAGEILAQHCTLSVAPPTQSSFPLACAVTSDGRK
FT                   MILVSEVGTEEDGHLLCTRTLGALTLRCDHAHEDGVATVLQVMEAGDGTGFGDLLRTGR
FT                   MHGYLCQGARMQSVVAQDNAVFVVERGPQACRLVLQACPHGSRLMSDLLQDVLLATTPI
FT                   ARLSSLPRFLSEAHLSGYTAALQRNATTTKASVCSAIRMALLPPATAAAGETAHALYRF
FT                   SRLYATHATLGELLSRITFLTTTYLGWQSTYSVAHALSSTGEDDATLSTADWVSHQLIT
FT                   ALEVLVAAYHAVPAAGADLVQLALVDDSSSQPSSNAIVAALLPTLTDTAGCDDDSVACG
FT                   WELSTLSMIQVANRLLRCGTPSMARARAVWVKQLTHRFPLLQHYQLLSLLETAAVSTQS
FT                   ERAIALCERVCQALAREAPGDLTTALLLEGLLLTDVSGPGSAFLQLSLDEVAAFLAADP
FT                   TLGPKLYAVGVLRRTISVGSLQTCMSHCVTHRYMYTTLATCVEAVERMHRCASVTASTP
FT                   TLAPFSQLRRALEELQVDALLASAFARVSGGDIASCFHDVQTALDLIARHKCLPSYAEL
FT                   LQVILSHIVEVACASQASMNALLRATTIGAAQLEESLILRWYNYIARLPTKSATEATEA
FT                   LRYRAIMGLHRYLMNRHDYAQCARLMSSLATLIRCSPLRRSASAGISVSELAGLALHAA
FT                   EMIAPSAPMPETAGGEQGETSQAAPQGASHDPALMVGSPLSLGYSWQPSASASPAPFDL
FT                   NSATLGATARGPRWLTRADIPCLRRRLYQAHCERQLWRRGCTLDCTDLWVEGAPADAYQ
FT                   AGVEKLVAALMQARLWPQAFRFACLSAVYDPCTVLAEWAVNLLRAPREYGSDDIAAAEA
FT                   AHADLTTEWTELIGYCGEISNLENQFYAYVRTVTAALTFAYSQVPTALLEAHRAADAYT
FT                   AMTTLFHVALMLRRQVEAVELGQQRNEEDGEDKEDADEFSSSSSNREAGRTAADHDAEK
FT                   RDEMSLEDIRCNVWRAWCASARIGIDMVAERQPRPAAAALYGRTVGTMRGAGDVVAEED
FT                   AAQIHSDVVVAGTVSTASSAARRTFSAFTAGALDPMAVCASELLRIPAYRASLNLVARG
FT                   EATVRQFQDLMGRPCS"
FT   gap             1620138..1620237
FT                   /estimated_length=unknown
FT   CDS_pept        1624871..1627336
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4280"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26286"
FT                   /db_xref="GOA:E9ATL2"
FT                   /db_xref="GeneDB:LMXM.36.4280"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL2"
FT                   /protein_id="CBZ26286.1"
FT                   /translation="MKRSRQDNRHLGPAAAAMRRRDVYRDGRQAEEQVNIQKLFRDAVA
FT                   MQKFHSPNQSGAGARVMIHSREELALYRQKRRAELEESVRRGFKAIGNWIRYARWEAQQ
FT                   RDFDRMRAVMERAVPVHGENANLWRDYAELEESNGFTEHARQVWSRGVTALPSSVDLWV
FT                   KYLAMEQAAGQDQRVRDVFHRWLAGDAVPPCAYALAALYEAQQRRQAGCRDILRRCVER
FT                   FNTPASWLLYGATEQQVFCDHERAVRVLETAMQALPDEDLWGLEECRVPLALAEAHIAA
FT                   GNVVQARNTFHNALEHVGDHARLLEKVLASYSRFERLYGDGAHAGQVGRLRTIQLYEER
FT                   LRKNTSDFDAYLMVYSLYRDQERESRLRTSTKMPEAVVGGNAAPASTALVTSPAAPASP
FT                   SRQVLERALQIPAHDPYSAQQRAVLVMEYARACETDGEVDAARRTLAQEIKNFPFDAAL
FT                   CPRLWVEAAAMEERQGAITQARRLLRAGSLVTKDVRLFEETIQFEERQRDAAIEAMHAA
FT                   AHETTPPSAREVEEACAPYVGELRTDYQNAIQAFPFDVQWWLRYAKLEEQHQEILRADA
FT                   LYGACICTFNEEAERVRSFAQRYDLLGHVDTAWAHRIHLHARRARALQRQASRRKGNAA
FT                   GAETARAELATLQEELLHLYATLLQDVWNAYRHEAVAWFSRYFEAGEGSGSGVLAGAAP
FT                   KTLPSSLTPATARWSEAVEAVGGYMERMSAIKAGQGAQEGATAALRAILKSMVEAERHT
FT                   IRRSLGWTEQTTQFDAVQRAREWGELLLSPLLEEWSKFELTHGGSLEAVAAAMEKPVKR
FT                   RTRLFKARP"
FT   CDS_pept        1628708..1632379
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26287"
FT                   /db_xref="GOA:E9ATL3"
FT                   /db_xref="GeneDB:LMXM.36.4290"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL3"
FT                   /protein_id="CBZ26287.1"
FT                   /translation="MERTMSELVPQHGPTPHMGLLRCQMERRGRHSLKGYKKRFWVVDE
FT                   RNGWLEVYKNDQEHVPIEVFRAADIRNVIYSDDKQNRFFMMLVQTRGPRDIKFRMGSFE
FT                   ERESWSKAITHIMDVYSAINKHKNVLGMVLRRAKTVSEALGVNISIDSGRLLAEVPEDL
FT                   LQYVAEAVDIALVSVTAIVRSFSEEGADMPRSYILYVHAITEEQSPYQQKETKYSPEGR
FT                   TMTINVCLLRVKSERVSFVVTQPDEVFRLVQSSVFRNPVIEGWIESEPKCAQACAAIQD
FT                   YLELPAGRSSWITFQWGQHVSDSAKVEAFLQRFVTATFFKRALQSVRDAVVRVERLIAD
FT                   TNAQATAKNFTGGFLGASVRDGGCSSPFSERRQMTTPGMPVQSDSIIFNNSTAAMSVAG
FT                   SGLHTRQPTTPLMINNAAGGGSDAALAIRLIRENVAGLCIQLEKRVVEKGTAPPHIVTL
FT                   HASEYEQHCRPAFLLVAKCRRVLPRKHHMTNDVLSDELYEVAYNAFLQQQLSVLRTELN
FT                   GIFHKQVKVVIMWDLLFRAAAGLKTPVNAEELPHLLRYVKDVCLSRLQHVAQVLRHARS
FT                   DVPGHVEDHSYLYNAFCSCVGTVVVNFLPYTVSSDANVFEPNLQAGVLTDTLYCTKEES
FT                   MPSLMAALGHAHRGSASKTTRVSLMGTGFHGVLLYAAEAKLGAWCESFFSDPENAIPGP
FT                   RRQLVEDEFDSDTDGASVGMLQDPDFGEAVAYERSAEIRPLTMQRVVNAIYDSQRHAPV
FT                   DLKIGSEDIIRAIHAFVSAFGDDKRPSKHDVARVLIINLQRLRQMYVRAVDDETTSLLT
FT                   FEQACQLLRDFCEYETNEQYIDAALHEVPRLGSEPASPQEEQERSYRESHEPAGAAKEE
FT                   VHADVSDSGNPLEENNVYPHSPRPCAMNEASLSVMSNGTTNGAEVTRRGNRRRSLSRRR
FT                   LQSNSKRASTIAASRTVESPSAPSAVVTPAVTCNHSEPHIRAPSTTSDAFDFASVTEVA
FT                   LTVLLPREARLARLAWRVGFVFGLENTGKSLIINSMRGIARPTVATVGLSQQVVAFDEW
FT                   VWALNELGGRESFRKNWRYYALRIDTVHFLMFVLDVLNGQALDEARQYLKEVTSHYHDV
FT                   PLLVIFNNFREGHRRFDIREFEALIHLDKLRRRHGAEVLSCVCDITVVHSKNRQLPQKL
FT                   SSTLRTLSSLLIARSKSENGGDGGAPPTPKTTTSFSASVVGGAAGAAAAGAAVVHST"
FT   CDS_pept        1635872..1638121
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4300"
FT                   /product="trypanothione synthetase-like protein"
FT                   /EC_number="6.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26288"
FT                   /db_xref="GOA:E9ATL4"
FT                   /db_xref="GeneDB:LMXM.36.4300"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL4"
FT                   /protein_id="CBZ26288.1"
FT                   /translation="MTVKTASEMSLLPYGEHQGSFRGVVACSNRDDGYFSGENNYVGTS
FT                   IYTGFRYQCVEYARRFLLLTTGCVFANCGRASEIYAMDYITHVETGALYTLHHHNNDGT
FT                   ATQKPAPGDIIIYPYHPELTPWGHVGVISFVDDNRVGIAEQNHYFGAFTSPNESYLDGE
FT                   RCVARYTTLTFDEATKTWRIEEPGSMPSAVGWLSYPDAPTREQIHSPFTPLPCAIKVRS
FT                   TPFHQDDHPFLTHYHLYDGFEIPSGCVRHAYGMRNGTAETLVGATSAAARVLRFTLHLL
FT                   FHRGRLGPAFRALPTNPLNATLPEGAGAGTEVCREVDALFKVLAEEDVVNATETTPDVL
FT                   RKAVATYFNIPLEWVMAMERDFAKGETHMAAVVSFYPNIVTDSAALETFRATRKNAGTE
FT                   AAPAAGTVPQTTANASTPVAEEPLTVSYPGTVEEFPVKNPHDEAWCLAKVNFGSARVMT
FT                   ELSQLSKVTKELTERISLMTPSMRSFISTQYRMDFAGYLKVVEAVYGPRTGFTIVVSDD
FT                   QPMDDLLRELVMTVQNLCELVEYPVRVVNEKDLTFVNGMLHATPSAASPEAGSQTTNIA
FT                   PSEAYDVDFVYALCEWPRILTCKEATHAALYRAAVDPTSDVVFAKPLWSHLCSGAMNVS
FT                   DDAERAHHTHSPRSTSVRFFDVCRRLYLLASPKQQPTTWDLEVSEYKDSCRRIHVNAET
FT                   VPMHSPAHLNADSLMINLAGSCFMGHIGGTLRSESENTDIHVGHPASLMFMFPAD"
FT   CDS_pept        1638865..1640493
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26289"
FT                   /db_xref="GeneDB:LMXM.36.4310"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL5"
FT                   /protein_id="CBZ26289.1"
FT                   /translation="MSATAEPTTGGSSFYLGTNPSPQAFAKYAKKHNIFLHPDVAFLVP
FT                   TKTMGMGLFAARPLHAGTVVISCPETSGVSPYMKEVATSPCVAALHASPAAMEDAALFD
FT                   ALVLMAELARENSLWRPWLEVCPRMAHHFFDLSSAQAAVLGVESVVEGWKGANLEASRA
FT                   VPDTTVVASATLGLAGVTGVAQALGELRVMQRWTTAQAIMAAFPDIWPAHKVSFGLFSE
FT                   ALSQVLSRNFHREELPGREGPYLLPGLDILNHSFAANTAFEVRGGGRKHATAFTVVTTR
FT                   AVQKGEQVYGCYGRIGAARFAVEFQFVTKAVLRNDLVRCSAASLATVATVRQYWKAARE
FT                   TPGCTVDSSAITAYLQRCSDGAALATGTETVTWKQAFFGGDSAADVETHRKEMERRVER
FT                   LQRLGILYDEGLYLVRPYATWEAEEAAEPAPTFRWSTPTAHEEEIAENRRVLAATVYLL
FT                   TATKSVYDDVYHRVTADWEPPESAQISAAVRDFLHIRIVAAQLQHDAACDVFGDSSRDV
FT                   VRRQLVQDVLVSEMETLRYYANLFD"
FT   CDS_pept        1642152..1648757
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26290"
FT                   /db_xref="GeneDB:LMXM.36.4320"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL6"
FT                   /protein_id="CBZ26290.1"
FT                   /translation="MGKLTIKVHKCELYRPVSSGNCTVNPRATVVVDGTYRFQTNIKKN
FT                   TFSPEFRDSFVVGNTHRLAVIEVSVYDVQEPSGLVLPGIGVLTAKRGLVREPSGIGMDE
FT                   GEGAGALAASPTGGGGSGGISSGTSSSFKARLPVLLGRCYISIERLVHYERKRRKYYLA
FT                   TPLPPSSATATTGSNVCATPASVAASAIATGASPAAMVSDVGPSFLQQVLPTGIAGTIT
FT                   ISLESDSLGEPPSELCLNEQLEAAYVRRLRRFLMCYDQPKVAMLDVMMAHVRDTTELGP
FT                   HNNSRRYSNGNGTDAVTLAPNSAHLSQSNKQDRSSATTATSGPTTPLRRGADSVTSPIG
FT                   RTSTLLMNLHDQVDSLMWNPSNNGPNRVLQLDQKGIPPRNNATPPFVAALRTRTVCLGD
FT                   RAELTADLPDERETFEGMMNRLCAEYHASEPGEFRVVLRVEGCTNINKEDWNQSLIGSD
FT                   DVFVIFRSESEEFETNMVTLQNTVVWSEANTVAMDVVNPHRFYVTVILMGRSGSKTYEI
FT                   GRCNVSAAPLSNGYVSRRNMFLCMAESVTRVAVNGVVHLLVRPVNFSLTPFDMAESVDD
FT                   FYDRLGRFFRRYDPLQLPLVDVLARARLRDHDTYMKDLVVQYGREPGTVRMLVAVESLI
FT                   SLRETADRDLSEQGVRVLLTMRSCSVRTKAFAVRQFAPTNVRENYVFDVVRETDLIRIE
FT                   VVNARDDNIVYGCADFSCLNTQRSVMNKRDLYLVGAAGTRDAYFSGIARVSLYSDEVGH
FT                   NYEVDMKLEDAFTGRLRRYVYRRIPESLHRVNLAVATVFDIESFMAQLAVEYGDEDPTY
FT                   ALYFTVVGCRQLRSGFGGINPYVVVRVGIDAYKTKTARANEEPDYFEFCEFYYDRPEDM
FT                   AITLVVMDQAGIGRDEEVGRAVILLANVQPSRQYNDWLPLLSEKKSGKVREVGTIGFKY
FT                   TVVDLNLVDRTRARLIKEQYRERSACRPSLTKRRSESRLTSLAPSGASGADLPNPSWSA
FT                   NANTSSGFAHRWSTFKRYLLQTPLMAHSTRSLSMGNSAGDESDRFEQCMSESTTLLMAG
FT                   RDASLFKPGRPVISRLPTMNLMDLGITTVEEFCTTEDSGLLSARYSETEADLSPFLEMT
FT                   YRPPTNERDTLTGSCPFISGEGRVESGDATRMQLRVRLLSCKNLFKPGRNMPNPYVLLS
FT                   TISESHRSRVQFCTTEPRFNETFLFTIEDPNIDYLTVTVLTDTPYGLRKLGHCTLSMRN
FT                   VQRGTMRTRWMSLVIHPFEPTAMECGFVYLSLGAINFGINYLPSVEAENRLREQIREYL
FT                   TLHARRQLHRLEWYVGEFSQFESILLGGWFRDSGNDTGADNTGTRVADLEVTVLGVSNL
FT                   YCSGFLAEGSCVVKAKVDGQTRAKTRPIIGAHGSFVVPESQDPLHFTVPEPMTTLVRLS
FT                   VVLNGKTGAGECYVSLADLHRDVAKERTLMLVMDSRSSHAEAVGFIRISVFCTNYGSSA
FT                   PAPTEEELALHSRLTRFFYYYIPTELAMVDVKYATTLNVTAYLNRMVEKYGPEPGEYRL
FT                   RFTVDRCRNLVFKNGNTPLHVFCIVRVGLQEFQSSIVEGHSECVFCESFDLIIGLPQQE
FT                   KVELILMRYYPSKQVELGRTQLELRALRRAEENIMELALVRNAGTKAAGVSGVLKVSSL
FT                   PVDFGRDGRMHVRTQSTFAYGLDGHSGLAQTMCLFSSPTQVVGANTVSCPRSSAPNNYD
FT                   AAKESLATERKTPVRSASRVISTSFYGNLRERSGTALPAVRGGTSASVTIVGFAGLTMR
FT                   DAQIYIRVSERDKTLLKTKPIPVEQLVALEASTVTFTIDNVAANYDKQYTLKLGLRKLL
FT                   GAEALCHADFCVLRCPAGKTVEKRLRLYDVNSQYLGICRLSITLPPVHLPALQWQHLSP
FT                   AVFEPLMDDVASLVSTYMPKDLRHLDLILCHAPDIRRLHRALRLQLAPSVVATVYVAIH
FT                   SVDLHSVTVRHSCVVTASVGHFTSEAVRRQHGASQVYPYGMSKEGISNLDFPLLRIDIS
FT                   ATGPAATLTLCVCDRGSKAKSEEVGRTVVSLRALLTPAVFDMSEKVQVPLVSVSHAANR
FT                   VHASLVGTVTFSLIPPAFESYGASVRFASSVVDGFDRAYVRYYTDRICRLLSHYDANSL
FT                   VDIHSRLYESYVSCQCWETGLPAYLSELVVRWGPELDSFEAPPALKRRDDVHHSRMAAM
FT                   EKSENMESAPYELTPNGEWQPARPEGHPSVEG"
FT   CDS_pept        1651962..1656842
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26291"
FT                   /db_xref="GeneDB:LMXM.36.4330"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL7"
FT                   /protein_id="CBZ26291.1"
FT                   /translation="MPRTRRSTSSQSRRAGTVAADPASRSLMRSPRRTGQEKGEPCYEV
FT                   AETREEVTTYIVTSNHVPVAAERLPPHQEHLPKGTGGRTQGCSGDARQEYPRLAYYGND
FT                   RATRANQSAVKVTDDSARRRPHFSALAVAPGSRYVSVANRGGPTHSSNATSNSATRRHA
FT                   TGAHPSRSSRVVKAPVDISTLEDYKTPTRRRRSGGRYAYDHGVGHTEAPRAGRGGRHGR
FT                   QGFPADVFAYDNIDVEEMEANSAAAAAAAQPYHFRVRLHECRGVFADLKASGRPPPAVY
FT                   VAVHTVEERGHSGIADKGSYNPVFCDEFMFSSTDPEHDALVCTLVAASSVNTSSGSRTQ
FT                   RDKKVAECVLSLHNLAWQVERKVWVPLVRHPCTSQAYEQGEVLVSIYSADFGYADVATE
FT                   EEEAACSAAIHDTLTRYAPQELHRLDWMTSAYVNKGPEALSQLRASYRARTIEPVTVRV
FT                   TVQRVDGLTDAAGGPTRASDIYVVLCDGQVEWRSKTVPYRRCAIINQEFNLSLANPAVD
FT                   TLRVTVFGNDRKLGEAIAGLTNVQAGKAKEVTLMLVRAAETGDASNGGQLAITLQTEKY
FT                   SSPHQMSAKQEARLRERVLAHLWCYLRDDLHRLDAIVGSIDNEEAYMQEWARTVGPEQK
FT                   PRWLKVSVREARNIIADGGLLPRCYARITAGPTTVRTGLATVRNGAVTFKDSFRVQVYD
FT                   LSHDAVEVMIVTAGDDGERERSRVCFGVATLPRQGLVVRSLHLVSAATKRAAHVQGELT
FT                   VELVAEDFGLTGALAVAAAENASFASSVHMQRLEAIMQRSSPEKLHRVPYMLDTAPPGK
FT                   AERVVEDEAKLHSGDVAVAPMTVKILGVKAFKPAVDFYVKVYLNNEPILRTGDVRGSTV
FT                   VTIDIEDNNEATVRLKDAPQALMTFKIAQHRTLRKTAVLGEAEVALANLVRGEKNVLWV
FT                   PFFQPAKKSGSGSGAESRRCSASCTSENRDNVVKLKGNRMPNSNGAAAARQQQSPGALL
FT                   ARHSATAASPVGVLGLELQSNAFPVTTVTEYKLDDECGRKGVSAQEAVTEDVTSLIAKM
FT                   RPSELPKVQPMIAQCTSLKSAHDELRAELSTRSILGTVYVNIESVDFATEAGRSQEAQG
FT                   AVAVEAVYGSERQESRKRMGFAKDALHQRQLYTQIRLDIPAKLDSAISGRNGAMSRSAA
FT                   YAKSVPALELRLVGVQGNEGASGAVLVPVGSVSSGGAFGEGNKGVYHYDAADTDSDDTE
FT                   DSYYVGGENNLHRYIRFPQNPGRLRSTRQPEEEHMERPSKMRIRQQGQQQQQHPHRNGG
FT                   STVSSYSNTYHNIPEVQHSSYREKDGKCYVGGANSIHSYTDSPGQSFRHSVASAERTPS
FT                   RHHVGLANASRSNLQAGSTSRSSTAALVPYKWSTPYRGEIGVVHLSLRALLTKPLYKIG
FT                   DKLRVPIVAPVIPAKLSYRARCSPAVNQRCIVGHVTLRLTLPAFEHIPESLRLGGHNSM
FT                   SKVVPDYVHYYERRIGAYLRSHCARDLVSFHYDLYERDVVSGCWPVSLRQWMQMLIKRC
FT                   GPETEYVGPEPSLPFVPEEWELVRQRADALRREREAALAPVKQGSKVGGDHHDDHIDIY
FT                   SSRGASPFVQSRGNSPGRRTWADRTKGRRVNGRLDGGAASAEAVDRF"
FT   CDS_pept        1659029..1660606
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4340"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26292"
FT                   /db_xref="GeneDB:LMXM.36.4340"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL8"
FT                   /protein_id="CBZ26292.1"
FT                   /translation="MSSSDAVVPEGNLHPRLMTHRPDSDSYTSSARQTSRSSRAVPTNA
FT                   ELAYAGVTAQDGVVQQLSARSEERGSLAGPREVSAQSNFSHRALRAITAGGSIDEPLRF
FT                   SEPHQRRVISDTPREQQPQQHQSQATRSTSHSGVARNSTGADSSREPIRPGRSDRSSTP
FT                   RIPSKHNDPYAHVTSVVQEYRQSRITTLGALYRVVRTHSNSSVSQGYGTRQTQSASPRS
FT                   AEARYNTAAHRRTSARPRDESQRVSSVSSRTRQNSPLPRAVEEEYLRGGVPRAALDAPH
FT                   IRYAEALYNMYNYSSFAQRHAGTSSRSSNMTEYVPDVAKRIPDRFKYVPPTEEERRLHR
FT                   EATLRALEEWRRRHWAGENSSCDDSIGMAGRGAAVEPRDRNPTKNQTCNSSQRPQLADH
FT                   EKTAAWALQKEFGNTSDSPSGQTGDSFTPSKKRSAKKARKVREAAEQHDDYSTNEGAGE
FT                   WERPKSFVGKRSGTPSSRRQNGAGSRASSRMGRKSPSESARAEGGTALNSFRRKLLFDV
FT                   VAPSVSIA"
FT   CDS_pept        1662046..1664724
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26293"
FT                   /db_xref="GeneDB:LMXM.36.4350"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATL9"
FT                   /protein_id="CBZ26293.1"
FT                   /translation="MRPAAASACSHMDNLRGSALFPQPSTPEPQRFQFRSLRWYSETQT
FT                   PTAQHDGAEPYAPEEVAYMYADEEGVSHAQRSIVGHVALWQPQDDGASPCTPRTVCQSR
FT                   TRQCAALANTHPFPASLCTAYASAAPLQQSPCSFMPSIADAPVVRRTRSLSCPSADRSV
FT                   APARCSVGYGTSSREAGQSIGRYTTVLSGVPSTGVNTCDTPSAVSAARATVPLHSPFPT
FT                   ATLSMANEHVCTLQERHDGVGDLPACGSNDVFLMHTYTTQPCATSASVPRLTRLSLSSN
FT                   GHSPAVPTNWSIGRPTTLRCRDTDSDVHCDWGAIQGEDEEDKEPVIGCATQVWRVSDEV
FT                   RMPLQCSHGTEEKEEETLLGVPISHRGDHLTNGRDLFASLPPIAWQPAPLLASFSGSQL
FT                   DVSSCAEDNAVLLSGAPVASTEEETHNDNREVTRSNAIPATGDVAATALNGSFADLEAA
FT                   PRKGYARSNSGTPPPSDLWSLNNAANSQAHDRAANGVSAGVELASHADASETNSHHLGA
FT                   SLCANIGSGCSARLGTAAEWREHMSTATPQGRGVWVDVPGQLRGSEYPASTTTAEAVAA
FT                   RLAHISIHTSPTPKRLAFEEEELVERVGGGDSPMLTPAVRIVADDAAQQRACNDASSAQ
FT                   GGGGSFDVGLQGRGAGGLSRSCMRWASAFGDSGHREPCGSRIPSGLQLLRSRKRCLSEM
FT                   QATDMQERHASTLVSGGINDARGSSNLVPDRVDCMNLATAFENLEEEDGDGDGDEDAVK
FT                   RQRREAQHRRRLQHLLPAALNTMDDLIPAPVQTLGTGVASSSSMLSSHVRSAVHWIQLA
FT                   QDQEHQPDHTSNDDPASWSQLSSISHVTPASQSTSMGLWGVPNTLSQGHHGAGVVCSVG
FT                   SGSQVLTPLQTNVTPQPSRKP"
FT   CDS_pept        1667236..1668465
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4360"
FT                   /product="proteasome regulatory ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26294"
FT                   /db_xref="GOA:E9ATM0"
FT                   /db_xref="GeneDB:LMXM.36.4360"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM0"
FT                   /protein_id="CBZ26294.1"
FT                   /translation="MLADVAVPPSSSTAPGSNTAVSDYFLQKIHELRATQKRTLDNFER
FT                   LEAQRNDLNRRVRHLKEEVQMLQESGSLVVDVVRVMGKNKVLVKAGSGQGKMVVDVDKS
FT                   VDFKDLTPNARVALRSGTSAIHYILPTKVDPLVSLMKVEKAGKESTYDEIGGLSRQVKE
FT                   IKEVIELPVKHPKLFEALGIEQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGAEL
FT                   VQKYIGEGARMVRELFVMAREHSPSIIFMDEIDSIGSSRLESGENGDSEVQRTMLELLN
FT                   QLDGFEASKNIKVIMATNRMDILDEALLRPGRIDRKIEFPAPDEAARFEILKIHSRKMN
FT                   LTRGIDLKDIAKKTSNCSGAELKAVCTEAGMFALRERRVHITHEDFVLAVAKVMHKDQD
FT                   KNVSLKKMWK"
FT   gap             1671817..1671916
FT                   /estimated_length=unknown
FT   CDS_pept        1672764..1680494
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26295"
FT                   /db_xref="GOA:E9ATM1"
FT                   /db_xref="GeneDB:LMXM.36.4370"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM1"
FT                   /protein_id="CBZ26295.1"
FT                   /translation="MAMGSLVLLTDIRSAYLAGYNAAQRSGEEILSPIRGAIDRTKTTA
FT                   VSKDARQRLEEHLRLLCTTICISGEEYVRTFPANLYVPLLTEILTAANVAQRSDGYVMN
FT                   PLSLEACASDAPSSFSIAIQSLHKEGVRSRSNKLLSSCMPSLGMQTASPVAVFALRALA
FT                   LIADMVPSGSFAFCPSRSKGTIATLALYLSDPEFLVVNEDLAEELLKCFLYVSMLTYDA
FT                   CLDAGVPARIVELLLALEPHHLRVLCVQVASNLLARARESDLEGVWAPVMAKLLESFDS
FT                   FLLEGSFRLSAPETTHQVATDVSHTPTAATAAATTVFTTPTAARSLTRRELTLLQHYME
FT                   AIAHAVDRLFVGVAAMKAHMKLLDHMIGVCVQVLQLSLNIIPATCGEWLRSVALSPILT
FT                   FYLTNPSFAVPVLLQLHVWEAVCGCMLTLVERRLVATGASGAAAGVSALESEVAGGAPD
FT                   DSAAMQGNISAHTTSSSAASSTSLPSNAQPGSGADGSSNAVADATRSSVARGGGPALTT
FT                   GPVLTTDVTTIPFIADELRLLPLLEFLLVLLPCARRGHSHTDFRHMTLPYFGWTWEDDF
FT                   HNETECNEALSRRLERVYQQTRGCRKHELFAITHGKQRVFYTDFLSKSYVSERRERHCL
FT                   HRKPLLTGYVHGTQDALLRGCTCCASEPAPRFSTWVNRNSMRLYTTDTEAGAHRGGSPS
FT                   PSSYSSSSYGDAADEENGSQAPGSAPQASAMARASSSPSLRRNSARDRGRGYDSSSSSP
FT                   SLHRRHRINTLQMPDVHASDADDGGRNRDTATRPSANRRLRGSGTTHEGSGDAAILHHG
FT                   NRLPRATSSEGDEVDVDGEDYYSSMNGHQDELQQRNPRRRRGGLGFLLCRCDRDTTASS
FT                   QGRSRQMHMGAYLPDTPPFSHYRNDSLAITVLPMEAVLESPGERLQADPSTRKSFLGKG
FT                   VLSSMLVTVVPALLSVLDNCVNPVVARHSVTLLLRCLSLSADLRAQVTGKSIELFTGSG
FT                   SGEEATVAATASEASEKSRWRHMSFRKWITGGSGSKPRRWQRAEWEATQAALQRLVPSL
FT                   REVLVSLYIADGVNIVAERQETFGYMRDDLLMADELARVGLSTDFFDFQLALPSELHTC
FT                   TADAIALLLRLLPSAKPTACAASSPQSKAVKKSRKTSSLHGPPRHPIGGDTDSGVQPWP
FT                   TQSMSSLDSSTKESAADQPTPLADPAALQRQHSPDLSTTVASLALSRTSTFQRGTSVAQ
FT                   GGQAHAKKSSSSPTQCPTLAQQQGSSDANAANSQPPPLLSPTPLSRVSTMSLSLSANES
FT                   YSASVNTVQDRLSKASPADSRGVGCTGIFTLHQSTLLVSYASQIVRRSVKACAAAQQIH
FT                   DSMNQKIFYTRVVIGSPEPGDGGALQLQSRELTLRVFPDSSCPYHSTFLACTERFFDAS
FT                   QALLVALLAAGASLPATSGATAATSRGLLTQPATAVFSPAVVAAVPSAAASRLQRSQPG
FT                   RQGTSACVTAQSAESAGTSAPVQSQAPSQSKGGKEEFSIGVELPVIPATVNAGAMQEAI
FT                   NCAMEDNMGPYRRLPPALRGLLGFYDYCKQCNIELRAAVVETPEILGEIATHLEKWLTS
FT                   RARQREDVECSNASLALSLYMSNNSLDSSSSRGVDALLASQQHLRLGSAARGKLLCLTA
FT                   DFATTIGRDLGLATLDLAPSVVMKQPCSFQKRAKRFKTFDAVRFLVWRPLSIFLDLRSP
FT                   TTAKQLQSGSLSAADAASVTWGETTEAEKSVVMVGCTELRVVTGVKLRDPMMSVLPTTT
FT                   MGVLAEAVAAQVQLPPVSVFSPSFTLKSSQQSPSPRPLRASQELQSLSESDSGIGGAGS
FT                   PCLTSQNRFEEPRLDATATATTASATEPPVSADRILFFLNDTPLFSPMTTLLDALTAFA
FT                   VSGASLRDLVERPRRSSESVDAHSSMVSATLPTLPFWTVTHVLEYVVLAEPLPAPLILG
FT                   LATTASASSAASCCCCGCDGLRPSFFCSPKHLFDAAPSSGPLALYSTLSTVMREEVESS
FT                   LAVLESNQQRLSSAVVHELYHHLKMFTLPPLLWCSGIGVAAQGGPGNRAVGTAATLSSG
FT                   AFPLPSYVLWRYPFIFSTEMRLSIFRFFISAQRSLSYEEAKHLLQNYRHLLVRHAPTEE
FT                   TLEATSGAAGDTEKTLNIVGLQWLSEEVVRRRRVTLTVQRHNILLCAEELTRLATCNVA
FT                   IDVAFEGEAGIGNGPAMEFYEMVAEELLDPKHGLWRTEAIPIDESADSSSFGAAPPPTR
FT                   SANPSPRTAAASAPQRRRPCTPLFPAAKQTPTSLHYWKLLGVLLGRLLVIGTTSSLNFH
FT                   PLLLRRLRGESLTSTAAEASQNMSQVDAALEFSLHRLEMMSAGSLAACELFFVIPVSEA
FT                   DGCVPGPVEEVPLIPGGADRQVTVDNVREYTHSLRTYYLHTVPDLALLHLRQGLQLTVN
FT                   PLYLQLFTVDELGRLLGSSLDSKVWETREQFARNVEAAHGYHIKSDVVQYLLDIVPTWS
FT                   AQMQHAFLKFVTGSSAVPYGGLTQRIKVVRRDVDVSAADLAVTPTIHSFGASAAGLVTS
FT                   SSFTGGGVNHDNSLPTVSTCFLYLKLPRYSSKAVLQDRLRFAVCEGQRFFSLT"
FT   CDS_pept        1682178..1683632
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26296"
FT                   /db_xref="GOA:E9ATM2"
FT                   /db_xref="GeneDB:LMXM.36.4380"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM2"
FT                   /protein_id="CBZ26296.1"
FT                   /translation="MMMRLHIRVAFTSLSTSRGYVSHDGGHLGTRRCASQTTSSTSFSA
FT                   SKSAPLLNASGTSSARIKPPSYLYRSFMGHSTRFAAMAPPLMRAGITQLEREPLAHSTP
FT                   GRINDHICIGMVKTLRWLADRAFRERYIHRATMLVTVAAAAPAAGSVAAYLRMFFRRSN
FT                   SNSTCTGDSTMSTTAEASSPFLVCGGSPNAGAAPPVPGARRSFAMARRSLYMSTSSATM
FT                   EGAGSTLEHSYVDELRGLLAQCESHAVHYQVLSCMAEITLLERGLVLLLQAVHFTIYLA
FT                   LFLFYPRMGFRLMAYTAEESSVVWTQMVNDVDLGKIAEPRVPQLALHYWGLEGVFTAQA
FT                   APPPKTPAPQEQEALLYKTSEGLVAEQSPVADAPISGASPYGSNNGNRAATPLSRFVDR
FT                   VSVPFEVTGPCHDSAVNRKKSEERVITPSDLDAAPEASVLTLRDVALLIRSDEMIFRDL
FT                   NHELANKLDIQPSWTQRLLAFLSGEK"
FT   CDS_pept        1684634..1687225
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4390"
FT                   /product="putative gamma-tubulin complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26297"
FT                   /db_xref="GOA:E9ATM3"
FT                   /db_xref="GeneDB:LMXM.36.4390"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM3"
FT                   /protein_id="CBZ26297.1"
FT                   /translation="MSSTTDWTRFLAALEKRGVRFDQVQYATDRQEVIRATGITDALSI
FT                   AVVETEWQRHCNGVRDASRAIPPNHQGVSASNPIPTRPLAPLLSQLAPDERGPTTSARA
FT                   SNGGMAGLPALHELSQLTRLPEELQDTVLATEVLSAAVGLGGVFLQYTPPAPGTSSGIS
FT                   PKEGFQVSPLVPASMRSLCETVLPVADAFMALRCIEKAEYSSRSLVLMALGEVVSEINT
FT                   SYAHQVSKLQLWSEGRPMPLMGVVSEILRVGHHVVRLRQMLPMDLICTALAEAAAAAPT
FT                   SSTLTSPSSGLVGPRILNHLCDQVNKYSGSCEDHELLTLLLRRSLVPYLRMLQRWMHSG
FT                   VLDDPYGEFFISEVYQPARPSPTAASHQQQRHVGQFFLDALAPSATGAGRDGELGVSGS
FT                   STASQGRFSSSRRAAAQQDVVAFDRRFSLNKSLVPVFLNTPSRIAKMVFFAGKYCCLLR
FT                   EYGAALPAFRPATFSGGAGAAAAGSRSDGPGDALLTWSGADQLQRQVQESFEISSGAVI
FT                   QLLFSPSVDLLGHLKSLKLYFLQERGDWVVDFLDSAESLLAEHPDRVKQYSMQVLLQAA
FT                   VARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTTTAAIGEGATTALPFRRSM
FT                   GGSGGEVDARGSLELLQLETDLQWPLTLVLDGKVTHRLNVIFRLLIWVKTCERRLCEVW
FT                   FTNEILGEFSAAYGLKHQFVQFLRQFQFYAAHFVLEPLWSRLVARIGQADSVFAISQAL
FT                   TDFFDGVETGLVLSSTQRFRSLAHILELTERFCSVGMHSSTATMPLIEATLHSVEDQFL
FT                   RALSELASPIGPDYPQLVPLLTWIDFSRFYDQNNVYHVQHGAASSAAGRSM"
FT   CDS_pept        1690241..1693132
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4400"
FT                   /product="ATP-dependent RNA helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26298"
FT                   /db_xref="GOA:E9ATM4"
FT                   /db_xref="GeneDB:LMXM.36.4400"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM4"
FT                   /protein_id="CBZ26298.1"
FT                   /translation="MALKKTFKQRIRKNDMKQRHQIGSGLRKRMGAARRIHNRYDSVDD
FT                   GTRPMEMIVSEIAEGTAVPSQEAVLDPRSLTDLLLRPAETPVDNNSASASANTATTSSA
FT                   VASKSNGCSAAPSRRGSWKSSALLTSVPLAAEKVLLSLPLAPDDPLALPDTRVFEEEER
FT                   QQRLAREVAARQKENKNLYRHSGQPYLFWERVGLHPALLQALRELHFTHPTPVQEEVLP
FT                   HVLASGDEGLARQMSDQADKKSKRHKRAGGAAGSAGQDVVVSAETGSGKTLVFALPLLQ
FT                   DLLTSLDRERVSAVAPTSSAETVHEKAMAQAGSDAAATRAELKAKRQKRIMHSLIISPT
FT                   RELALQIHAAIRQLTTFAPQVMVGCVVGGMAQERQQRVLNRHPHILICTPGRLWDLVQK
FT                   NEGCYLGHSVSRRLHYVVLDEADKMLQSGRFAELQTLLERIHCEVLPAGFAQDREEGAE
FT                   PGEIAVESGRWDPDTETFIPFDKEEAGATKPKAKKSVAETVTEASGAPVRTKKGKKRAR
FT                   EAMEAAAEDVSSSSKMKKAKKVAADVTPGKSRKTAKTSAKQAASLREEEEEKATDEEET
FT                   ASRYGDTNAETEYGDGRHKKDEPQPIPMPPEPAAGHRVITYVTSATLSLQTNYERRDFS
FT                   ARKSIIRTSNADVLNKVLQQLEIKLSNAQVFSLAETANVAARINETYLRCPDNSKDLYL
FT                   YYFLKTYHDDRAIVFVNAISMLRRLVKLLEVLGIAVVGLHASMQQRQRLKFIDKFKQGK
FT                   IHVLVATDVASRGLDIDGLKYVVHYQVPRTTEAYIHRCGRTARCGGTGLSVLLVNAQEH
FT                   MSFRKLMESLGRKESEVETFAMQATIVHQLHSHLRIAWQIDKLQKEIGKSRASNQWVKR
FT                   MTKEADLETDDMYDDTADAENREKQKAIRILQRELQLLGRKFTGQYGGKGAFRTSAYAL
FT                   GAKQAEQHLKERADRQTIRVASKKKNFAAKGEK"
FT   CDS_pept        1694291..1694869
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26299"
FT                   /db_xref="GeneDB:LMXM.36.4410"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM5"
FT                   /protein_id="CBZ26299.1"
FT                   /translation="MRRAGWLAVAPIAAVVGGTRVSQVLASPSWTSSSYQCSPVSAQCR
FT                   LHHAVGLLGRTRITRFDLRKHEMEKRRLRELEKAGINPTDDDDAPWIAPEEQQRLDEEE
FT                   ERRRAEMEEQRQAFMKKRAEEDAVKRQKFKEFRAKQIAMSRHRKETAAEKKEEARQHRQ
FT                   QTSRVEGTEEVNAAADGADANGASHHGTQ"
FT   CDS_pept        1695573..1695962
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4420"
FT                   /product="putative 60S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26300"
FT                   /db_xref="GOA:E9ATA6"
FT                   /db_xref="GeneDB:LMXM.36.4420"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATA6"
FT                   /protein_id="CBZ26300.1"
FT                   /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLG
FT                   NFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKDLR
FT                   DWIRILATGKETYQLKYFNIQDQEE"
FT   CDS_pept        1697167..1698276
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4430"
FT                   /product="asparaginase-like protein"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26301"
FT                   /db_xref="GOA:E9ATM7"
FT                   /db_xref="GeneDB:LMXM.36.4430"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM7"
FT                   /protein_id="CBZ26301.1"
FT                   /translation="MLYINSGLVGPKAMSGELFPEEDTSGAKVLLINMRSHQSDLLDQT
FT                   ERSNVDRRRFFLDILHCNEDLHRPGVPSFDVMQLGKLKLSADHTHEDWIELAQLIKKEY
FT                   HNYRGFVVESGSDNMVTTSTAVSFLLENLGKPVIFTGSLIPGHRIYTDMTRNIILALAF
FT                   ASCSQICEVCILFDEMLYRANRTIKMSRCSLRPFDSPHFPPIASVRGGVLMIRKVLLRP
FT                   HPTGRLHIEAELSTKVLTLKLGPGAPFEFFRTAIEHTSASALILRCYGSGNGPTRRNFM
FT                   KHLLAIAKARDLVVVICTHNRYGLVVLSEYEAGRQLIGAGAISAGDMTQEAAMVKLKYL
FT                   FGLGMSPEQVRKHFPVDMRGEISSPSAKL"
FT   CDS_pept        1699407..1700255
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26302"
FT                   /db_xref="GeneDB:LMXM.36.4440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM8"
FT                   /protein_id="CBZ26302.1"
FT                   /translation="MGSSSSRQTPLPAESADTAPAPEVATNTTDYHEYIQFRDQLLSFA
FT                   LGESAFDYTERLFAQKPDSPEVMALLAETTFLYDKTKNKVSRGHWCDRLDLLQRGVDVS
FT                   RKCINENKDYGPCYRTYVMCATREAEALYYMKSFTGLGLVENYQAIMRKGVRGMELLPT
FT                   DAEIPNTLGALCARCCFRWYDPSRAYAWFYGLPTTRRLRELSVDFHKKACENDPKNLEY
FT                   ACRLAQAYFQLGDLANARRWYVKVRDEMPPQELKDEKWQGVAHTQLSTAFVKPKWNVPF
FT                   A"
FT   CDS_pept        1701374..1703404
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4450"
FT                   /product="putative mitochondrial intermediate peptidase"
FT                   /product="metallo-peptidase, Clan MA(E), Family M3"
FT                   /EC_number="3.4.24.59"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26303"
FT                   /db_xref="GOA:E9ATM9"
FT                   /db_xref="GeneDB:LMXM.36.4450"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATM9"
FT                   /protein_id="CBZ26303.1"
FT                   /translation="MLRRLVSCASPLRLRGCGAAGVFGNVRFTSTADASAAAPISSSKA
FT                   STYGTVPDIPNLNFLSSPDNLLNTVDGTVEVCEALLKAIPKAKTPQAKHDLIDSTSNVL
FT                   CLLLDPCEFVRQIHPDENYKRGASLAFQKGYEYMCEVNSRRDLYDVIKELDSPEGRKGL
FT                   TPESVKNVVQLRRDMENNGIHLADAQRAKVTEMNIEKEELAMRFLTEQGSTNPFGTLRY
FT                   LLQCRYELAQLLGFESYAEQQLRGTMLENQENVWHFLCSIASKYRLQAEAEMDLIRKNV
FT                   GEVRNRVNITDEYRARVASSMRRDAEPENALEYFSVANCVRGIQCLCSEVFGVKLEEVP
FT                   LNPEEVINTSVKKFHVYDEHKRFLGVIVLDMYMNEMKYCQAGHLTLQLGCVPHQEALAT
FT                   VGLRLPKRQYPVVVLTANVGALKPAQRRPDGTYDDESTLMQPNEVTTVFHEFGHAMHTI
FT                   FGQTQVQNLAGTRSSIDYVETFSQLFEQFLSSHEFLKLWAHRINTREPISFDVVQKRNS
FT                   AANMFKHLDMLDQVVLSAVDQALHGPQPLTVYFPHGDQGHVGKRTLGDLGDYGRGGFNM
FT                   ARALIQVAKPVSVAEPTEAGVLSTLSFEHLSGYPAGYYGYLYSLSVARRIWTQKFERDP
FT                   LNRDAGRELVEKVMCHGAACDPRETIEKYLGDNLTDIDIWA"
FT   CDS_pept        1704706..1705188
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26304"
FT                   /db_xref="GeneDB:LMXM.36.4460"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN0"
FT                   /protein_id="CBZ26304.1"
FT                   /translation="MMRSSFVHKAAAAAAGGGMTATSSDPKMSSLHKLLTGEVQFRNNA
FT                   LLKACNIEHNFGAKWKSDIEAYAKCLPAAERSSLERQVARVMLTRYTTRELAEYCGEGP
FT                   EHVDAVAREANIAQAKAYAQKNGADKLEAYVKAESKNAGWSEADTKSFMDAVKAAK"
FT   CDS_pept        1706675..1707502
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4470"
FT                   /product="putative chaperone protein DNAj"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26305"
FT                   /db_xref="GeneDB:LMXM.36.4470"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN1"
FT                   /protein_id="CBZ26305.1"
FT                   /translation="MGAVKFHLYKILGVPVESSTEDVTRAYRRLALKYHPDRNPEGVEK
FT                   FKSISNAYAVLSDPERRAAYDLTGFVSDFADSSHVMSDEAARQQRSAELADQVRSFFAT
FT                   YAGSAEERADVVRGYEKCNGDFKKMVRGYLLFDNGVEAEVQRLHRLVSTLIEMGNLSRT
FT                   PAWESTSTPEAVLRLEKAMHRERQAAEKVLKNMAGSGTSAAGTADGDLSSLQVMIRQRQ
FT                   QSSYESMLNHLESKYVTKEKSARESSKRAREAAPTAREDERASKKNRKASRHR"
FT   CDS_pept        1709312..1711684
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4480"
FT                   /product="transmembrane amino acid transporter protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26306"
FT                   /db_xref="GOA:E9ATN2"
FT                   /db_xref="GeneDB:LMXM.36.4480"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN2"
FT                   /protein_id="CBZ26306.1"
FT                   /translation="MQPFAARSSLLVHDVRASQRQSFAGRISHRVASRLSFAGPPLEER
FT                   TGTVTGTVINTLCSVIGAGVLSLPLALYFSSIVVGLVVLLVFSSFAAFSVYCLVVGCDA
FT                   TGRYSLTEVIAFALYPPQLWEEYLRKQGTVKETTRKGGEQQAAGQQHMPAPASCGVRSS
FT                   SRNRESDVTTPQQTEAATTSADARQHSDPGKGVASDEKESEDTLLSRYRHGNDGYGRRR
FT                   HDGQSCAEASQKSGRTERDPEASFLVPSTSTYARLRDAYAREEWHRRRYRRVITALMEL
FT                   IVFCSNYGTLVIYSKVIADSMPPVVSYVTHTDGFLVTKYFWLITGGVVFFVLSCSRNME
FT                   ELKWSSLLGFLTILYIVFLILYRYHTQKRYDYPHVDPGSYGKVHWLRFSVGVLQTISTF
FT                   GLALSYHYNVPYLYKELQDRRPYRMMQSLVVAFPIVVACYAVTGVVGYLTFGNQVAAPK
FT                   VGGNIVSNYPKKDFLMNIGRLGLFVHFACVFPVLSICTRRGLHRLTMIALTWAEQSALM
FT                   MEAARASGVQLTEAEQGAEVNTATVPSPSLTAVSRSGSDIEDGAQVCGHISGERSPLLQ
FT                   RRGIPTPGYEAFANSSPPHLAIFRQQCNAESPPSGRRIPAPADSPWDSLCSDASGAEQA
FT                   HASQPGSGQLGTVDVDRDVGSPDQTTMLAIVIEAAFLVITSVLIAATVSGIDFVIHLIG
FT                   TLFSIFIVMVAPGMVGWCVFSPSGPFGSASAAVAAYSGGDGKLSGAPVSDLSSRFQLIR
FT                   LKQLMCLLNALLGVCVTCVGIATLVYETFWGKPIPAL"
FT   CDS_pept        1712842..1714386
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26307"
FT                   /db_xref="GOA:E9ATN3"
FT                   /db_xref="GeneDB:LMXM.36.4490"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN3"
FT                   /protein_id="CBZ26307.1"
FT                   /translation="MTALLACSFEQRVVPLSLAWMRYRMTALRRAAAQPNALLLYASRF
FT                   RPTSSLMMSVRCRSDSSFAKSHPVAYVSTEAPELRRGSSSAEAASYETFSGALSEDYVG
FT                   GLSNVTAERFRGMQPVGTLERGDGDGECDESANDSVELMEVDFTSDEKLSKLEKLYHSA
FT                   HKGDLILSPRERQLFSRMIYEKFYKVGAQSVVDPAIVYQASLEVHWVEEWVAGRARAER
FT                   WSHDEARRQVKRSLLERVDLHKPLSYIIGSQPFFGCDIHCEAPLLCPRPETEMWTHWMV
FT                   YSYLARAERSITATDLSPAVSPMRILDVCCGTGCIGVALAKHLSSAVVTALDILPEAVR
FT                   VSRENAMRNGISPERYTAMESDMFSCFLEEPVPAQQGDSAHLSEDRPLGTVNDAYAGTY
FT                   DVIVSNPPYVLPEQYVDLPCTITHWESKTALVGDDYRESRQYLYFKELCVHGAKLLKPR
FT                   ARRNEMLRDAPNIAIEVGLQAHMVADLMEKSKLWRDVEVHLDYAHQERWITANSAH"
FT   CDS_pept        1715372..1716175
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26308"
FT                   /db_xref="GOA:E9ATN4"
FT                   /db_xref="GeneDB:LMXM.36.4500"
FT                   /db_xref="InterPro:IPR021298"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN4"
FT                   /protein_id="CBZ26308.1"
FT                   /translation="MVLLECKRLPKEEYSKDYDAFIASVPATTNIGEATDAIQKMQNTR
FT                   VRLTWMMAAAKQMIKDGMVDAERQHYLTGPIGDTERYLSLERTERRQLCIQSELDALVE
FT                   AFKGGVMILFPAECSGSDACQRLAAILDSDTAPDVEKSKAHRILSMVDDGATNENILSG
FT                   RAVMWWSAKPLARDSDFVKYIGKNDKTKITVKLAAEGSAAPPREPAVDVKAQAELMQHF
FT                   YRKQEEMKKVVEDEDISFGNSAWANPHGLKNQLQGLDSIHYKGAF"
FT   CDS_pept        1717137..1717733
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4510"
FT                   /product="putative 60S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26309"
FT                   /db_xref="GOA:E9ATN5"
FT                   /db_xref="GeneDB:LMXM.36.4510"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN5"
FT                   /protein_id="CBZ26309.1"
FT                   /translation="MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFN
FT                   KVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAKNKTAPIAVVVGDVLDDVRMARIPA
FT                   MRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFGASG
FT                   VPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHI"
FT   CDS_pept        1719306..1722467
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26310"
FT                   /db_xref="GeneDB:LMXM.36.4520"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN6"
FT                   /protein_id="CBZ26310.1"
FT                   /translation="MSSAQRSVLQGGAAAGLRQVSAIDLQRITAILDACGVSKVHGSTQ
FT                   IYAHPESIHLISPRDLSFLMVHADVLATHTDLLYDVRAFTGILWGMMQHADRGIETVLR
FT                   AIEGNGAAVAESAWGGNVGGTPSSSPSPAPAHTFVYTAVSKVYSTMFPHLVQVFRVGTL
FT                   LRAYESADARAEVRDTRRIAQVDIDVVARLAGRLNYLFLCEAGECSSGALGGAGALNVT
FT                   ATYTNVGHHLFRTTESALSSVLLLLSSLAARPGSDVGPILRYFHDVSAWKASALGILIT
FT                   ESYSMAIPAVLFSLFQRSREFDNVEEVAANLLLQRLALRPPYQWRAFRLLYFSVHDIGA
FT                   SDTHTAEDRQGSSAFGQLLVFRRIQDALQWCLTIDGRDSADDLATVKSLRKAVSARVQR
FT                   AWFEQGSADRAGSPSHTSRADAPPRLLSYYELLVLAALQGMPEADLTKDAELLRRAAQT
FT                   NLSAEPEVLTPSFLRMLLACCYTVPAPTDPALSHAMLSTPSTLALYESLAKHIFQIPLC
FT                   ASAAVSDAVNQLFATPALRIETLVDLCVWSAIHNTREDEVELAEGVTGKENSAAAAADP
FT                   AVVSPAPHVRAQAGPAKTAGLPLPPIPSARTAEIGTTEAMPPLPRSPTPSMALFHLMRR
FT                   DVSLLFAGNEDVLQHTPEAARARAKNFPYGFRAVTLMTVRLLFAALRTPELYHHIPPTD
FT                   MLPVIAQLFALRAYYPLSPSETEAKRKAARRVLALMQNTLALLPQEMKAATVNQLLCRT
FT                   LVPMSTTTAQADQLQLALFEAYLRSMATASAANAVTDELMLQHWVDIAVPAITNRHSVT
FT                   LSVAGHDFLIAAFRAEKYVSPLFVPTYIALYVPSVELFSTGDSVGQRSTYSPLPVSVIQ
FT                   HFARMVRVACHGIERCDSTALARLFEEDAGSEGEATMPGSVNAAATYMASLSPEQRAAL
FT                   RKLTPTNAALLVVSALFDCLCLLWNNTPGYVKVAQDLFVAYFSGLCNLLQCTSTPVLQR
FT                   VCASIEAIEVEHLRGSGSVQFQFLKYVNSVVDAVQGPSKVGIAEWFLKMSKRIQEQNYG
FT                   KHSKL"
FT   CDS_pept        join(1723632..1723772,1723778..1724042,1724045..1725117)
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4530"
FT                   /product="putative ABC1 protein"
FT   CDS_pept        1728752..1729861
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4540"
FT                   /product="elongation factor-2 kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26312"
FT                   /db_xref="GOA:E9ATN7"
FT                   /db_xref="GeneDB:LMXM.36.4540"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN7"
FT                   /protein_id="CBZ26312.1"
FT                   /translation="MLLVKTKAAAAPQPSRAPVPESSPKEWTSPMHTHEGAEHLPTDEP
FT                   DVLVPAHKYVYDVKTCAWKGVDTMLRVLHPNRGLSQGTMRVCFALEELDETGFSSQMVA
FT                   KMFRHNISRVVESDYFNEGEAQCICGILAEKFNRVQVPEGFQRHVVSFLQCETVRIKLS
FT                   EVPEAYQDKRSGFFSYRTTDSADILFAMEPRLKGNFTKYTNNFGDVYDGFEKRRTLEEE
FT                   TKRHRVLMAVEAFSHFTLVESGGSMLVCDLQGVNDFLTDPQIHTVDGKGLGMGNMGQEG
FT                   IDKWMGAHVCNEVCRAMMLEPVSNGLRNFLRTAENESRVSYYQILRAKLRSRNSVRPED
FT                   IIPLSKPLSLMSDDERLEYAMRLSALLSG"
FT   CDS_pept        1735583..1738168
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4550"
FT                   /product="related to elongation factor-2 kinase efk-1b
FT                   isoform-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26313"
FT                   /db_xref="GOA:E9ATN8"
FT                   /db_xref="GeneDB:LMXM.36.4550"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN8"
FT                   /protein_id="CBZ26313.1"
FT                   /translation="MEPNTVACEALGISFASREVDETMCYSRGDTMWPRDIYRDIADGF
FT                   SHFTYVRSRACMVAHGFVRSDGYLLDPLFHTTDSERFPMGDGGRSAMEDWAKRHRCGDT
FT                   CRALGISNNDGECIKNSAACANPLDAEENHYTDYLRSVRQMRVMVHMDAAQFLNDKKDS
FT                   AVDTVSESSDFTPTMAALQPAPVSSVPLKVTCDAVKYVFLPTHAKWMEVPMRLSVSASA
FT                   LPDTVTDRYAFFAIEEEREGGRPVPMRARFILRPGARDADYHHVGDAYCVCVTLGQVFR
FT                   EYRANNVLDRDLDFCAAYTVRVPQANIPDCIKAAVPDSDFFARTTADSGDVMFVAEPEF
FT                   QPFSPQCSPNADGVTKDAEGFDDLVLRHVVDAFSHFTLHKSGNHLLVCHFKCKDGLLMH
FT                   PNVNTSSGCGFETLNDGQAGIDAWARTHKCNDLCKLLGMEPLPRQLKLYNISSSPLMRF
FT                   ISHVQEHQVSSDKMLEFASPSRRISDVMLPGASDTVVSQSETACASTSATASTAAVAVA
FT                   SFVRPIPPSSQEAVLRPWVKRSWKHSAACAKESAGQRRTLTQRELLRLQSKGIATTYII
FT                   PATRYDLNIGDLTWTPKRVFVRIVNPERGIGQGGMRVCFEITNVDPEACEESVMVAKMY
FT                   RRTIKNVVEKDYFTSVTVQKLSSLFAKDFNTERNEDCPLRLNVLDGAVIALDRADLSPE
FT                   LLAKRTGFFSYRTEDTERVMFCVEEKLLGRFTKYNGNMGEAYPTNECRLSPHAARERTM
FT                   VFEAVEALSHYSLERSEGGLLVCDMQGVRNNLTDLEMHSYDGQGLDMGNFGARGIQKFA
FT                   LRHRCTGVCKSLNLHSLRDRHFTVTDDVKTKNRFVALFERIKVIGSMEE"
FT   CDS_pept        1743663..1744670
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4551"
FT                   /product="myosin heavy chain kinase a-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4551"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26314"
FT                   /db_xref="GOA:E9ATN9"
FT                   /db_xref="GeneDB:LMXM.36.4551"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATN9"
FT                   /protein_id="CBZ26314.1"
FT                   /translation="MNPAAQGVAPAEEESPVVCTANKYIFDLHSYVWKESDCLIRIPHP
FT                   HKGMGHGGMRVCYAVEDVDEEGAGTPMVAKMFRRNISDVVEKDYFNEGAAQCMCEEFAN
FT                   NFNRIHLTNVHKPNISFLQCYVVRIPRDTIPVTSHNKRTGFFSYKTQDTGEVMFVMEPR
FT                   LSGKFTKYNSNYGETYREDKKAALTSSEAKRRTEIFEAAEAFSHFTLVESGGSMLVCDL
FT                   QGVNDFLTDPQIHTEDGKGLGMGNMGQEGIDKWIEKHECNEICRALGLQPLLDAVPNST
FT                   ASPKTDNVYLGLRAQLQSQNPVRLRDLVPLTKPLEEMTEAERIEYALKVSRLTD"
FT   CDS_pept        1747350..1749107
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26315"
FT                   /db_xref="GeneDB:LMXM.36.4560"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP0"
FT                   /protein_id="CBZ26315.1"
FT                   /translation="MPQPASSQALEREQLASVVCKLVIDADEFFAQQQKTLQLSYAELN
FT                   SRIEQLRMRVLQQQLQLSPMHTINGGYSNMNPSLFSALHNIPSADLLGLSGSNGGMVGG
FT                   VATTPSAANAMNATPMRPNTGGATRSLMGSLNGPNAVLSMNEALSESARSNSALGGYLS
FT                   TALNGNNAATAGPGSLRSYKADAVTPPKKQLALSQPTNKSPSMPPPHLAGGLNVMSAMD
FT                   DSISGEFFSTAPNNSNRSHHDSLMASPQATQKLSLVELIERFNMSSAPVNTATSSAFNF
FT                   DSLYEQLTGGGGGSEELSQSPIDYTERAPNVIPTSQPDNAQVSPSDRHHDNGGDPSPDA
FT                   NGTSGGAMTKNSIPIDTLRALHDQHLTTSVRVAYERGRPKVLKIVGGAADTPGKLGIDP
FT                   RSSCEVLVEFKRKRVLQYESHDYVAPGSYVIVGGDRGEDLGLVVYVWCEVAQEGNGHGH
FT                   ASGGAGSSDKTASASRKRKVVGVGLTDSKLPRSIGVGNGTVLRLASETDVQQLLSTQAE
FT                   LERRAIDVCAQLVLDHSLPMVIVDAEYQFDKKKLTFFYEAQQRMDFRELVRHLYKTFRA
FT                   RIWMELVDA"
FT   CDS_pept        1752983..1753957
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26316"
FT                   /db_xref="GeneDB:LMXM.36.4570"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP1"
FT                   /protein_id="CBZ26316.1"
FT                   /translation="MSTSALKVSTFSAGLQFTSKDIHEPPADTAVDNRSGVSDGEPHAA
FT                   GRKPVRPEIRCFESEEERLVWKAARLRHSIETDLMPRQELAERALRHTRRQLVKIQRLL
FT                   PSAAFLAFRQKCAAWCERLRLFEELVVRTMLREAVDGAARSGEVKAPARWRKSNQWPAI
FT                   TNFLELQLHLCYTVEGSAAVEASSPDHSSREASAVHRHLAAIWAAQQERLLTRDLLEGY
FT                   YTLRDIVHGWGSVWLVQVSCASEAENVSSTARSCRPQESGGSCICPFPEWESLSAVDQL
FT                   TSYSKICSHHLTEDVVECLEALMVTQFAGVWCHIESIISGVSA"
FT   CDS_pept        1754913..1756271
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26317"
FT                   /db_xref="GeneDB:LMXM.36.4580"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP2"
FT                   /protein_id="CBZ26317.1"
FT                   /translation="MSDSEAPRQDVLAAATFKKAPQRAWVDDQDVAVEQETPAFFKESH
FT                   VKPAWALSDTARADKDQFDPDEGAVPGYGRSAEALARKRFRSEDLDTLLSRKEPLLSSK
FT                   HDRPHSAVPTVLSVLPLPRDSARTIHWHRNGQLAVVGGNRHIYTFHAAGGFVEQLSKVH
FT                   VNKRVETTALSESGEEVLIAAHEAYAPQLLNIATEQLTPLTFLDTRDTAVHRNGRRDNT
FT                   REEFFVSKLVCRPNDPVSRGVAMARGSSVTLASLSSGSVLSHITADTAVVDVAFLSSTE
FT                   LAIATKNKVLLYDVRKLSRFTRELTDDAALDITTCGFSASGSSGARERAMAIGSASGVV
FT                   SVYDSATLRPAATTAASVAPGSRPKLLRELKQLVTPISCLCFGKDSRGDSVLAFATRGQ
FT                   KGGFRLARMPELNVVPSFPAVSTRHGFVQSMTIAPTVPILSVGERQKVTNYAL"
FT   CDS_pept        1758228..1760675
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4590"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26318"
FT                   /db_xref="GOA:E9ATP3"
FT                   /db_xref="GeneDB:LMXM.36.4590"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP3"
FT                   /protein_id="CBZ26318.1"
FT                   /translation="MAAAAQLTQAMTLKKNTVDYIPSKLAYDTAIPVTILEDRSDFIKK
FT                   CKPYDIIDGPNPLDEPEATDTTRPQAQSALVSPAPEVKKSERSSGRPNRKLHYSALKAE
FT                   KPHAVKRERDTEEGQDGPVVVFTRPSRHGWAAERLVQHRPYQLVRSNDMETRVRYVLDD
FT                   VDYDWCERHNISPESLQRGVTYLEWGYVSSLLRAATPHVATPKDAGTVVTESVVTGHGD
FT                   GHHSLSTLSSSLVGAAAAGNGRHTTSRRQNGKDKTSAGDAAMCLCALCSKPVHLLTSQP
FT                   RSGALEPSKGSANALRKRGGETTHSTGALSSSPTARGGARVGGGHARGMSSPQPSGLAL
FT                   PTNKAFGDASAGIVSPSHNLPSKGLRCSNCGVAAHLRCWFFSEPPKLPEAWICDGCTIY
FT                   AHHRKRSAGVCCMCGRAGGVLLPYVSSALKDDSDAVEPGPPQTPAFHGLSSAAALFDTV
FT                   CHAVCALSIPELAVRPQVTGLRRNGLVDVQMRPYICALRRVGKHKYAMNCQFCQHVSGR
FT                   CVQCSHPHCFETMHASCAAEAHTVECQAELLCLPAAASPRSTSGGARGGESTSDATTQP
FT                   VSLGSSLSSTLMGTANWTSCSPYCRKHYGYSVGNSVGSAELGRKAEAEALALDLTGLLT
FT                   GGDGVTSPVVRKRGRGRPPAALVKQREAERDLILKLRAYWLERREQRRQTSAQLASEIN
FT                   ARVRPIVEASLRPEIVKISAEKVRLSHFLSLVPEWQCQLVAIVEGELPLPDEEYDDVQK
FT                   FRKAAHTRRSGNTRSLYDKMCAATVQLGLLCRVAEAIKEQCRLRRTSVEQELAALRILS
FT                   RWQ"
FT   CDS_pept        1761729..1762208
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26319"
FT                   /db_xref="GOA:E9ATP4"
FT                   /db_xref="GeneDB:LMXM.36.4600"
FT                   /db_xref="InterPro:IPR019184"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP4"
FT                   /protein_id="CBZ26319.1"
FT                   /translation="MRVRTYHKHAIQRNSPALQGLLVLHTIFSIFYSAPIWFTYLGIRW
FT                   HLASVTSQQRIWMICVLIIWFCTEILRLHLGCLANKQSLFGGLVAFLTITLVPQLPLVC
FT                   VLLGVLPECNDLEFSVCVTQILLLVLESLAALQLLLRVTRNNIVDFYVSLGSPYC"
FT   CDS_pept        1763015..1764433
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26320"
FT                   /db_xref="GeneDB:LMXM.36.4610"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP5"
FT                   /protein_id="CBZ26320.1"
FT                   /translation="MDISYQLWSLVEQARRSSATPPARITLPARRARTADEAQATESLL
FT                   TTSHALDHAADVAIGRATAHISAVMAALDAVTPNSLAHLQNNLLLSDAELLSVSSSLKA
FT                   FMETLTKVTSLNDARRWRGRFNGTPSSAPGTHDALESLAVDKPEAPDGKARSGVVAHLR
FT                   QAVSTLQQRIASKRLQVALSKEELALYKTELFLYGHCGVLACSDEVAAELGRCTEVTRK
FT                   EATSRGQHGAKAVDFTEVTALADANGGQQRRHYTSSKPPAAMPGFGTTFRVVDGMVQRA
FT                   AETVKAAGSHADSALQVALTGGHAAARQLLHAGTASVAEILMLGAGAGRGSCGNLSIPA
FT                   AETLATTAGGGALRLPTLQPYQLTNEEEAHLQEQNRALLQAQRQASAQDAKAVEALVRE
FT                   LSQLTSLMNEQVVQQTEQFSLIVKNTEVAHTNVKKAMSEVEKPLCAFWNPTRQLVALLW
FT                   VCMALLVTVNWASR"
FT   CDS_pept        1765166..1768888
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26321"
FT                   /db_xref="GeneDB:LMXM.36.4620"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP6"
FT                   /protein_id="CBZ26321.1"
FT                   /translation="MWLTAARRCVRSYPSDAAAQLTHISWAARKQPRAAASIVPAGTAR
FT                   CYATGPTEPENLAGVSLASAANLNAGSSHVSSKTKSSRFVRTYGNAAPPATSGADPESG
FT                   AIPQGEADARWPALHVNLSAPPGLTSAAAVAAYLQRLQSLLRHRRHPFLRACAVRELGK
FT                   ILLPSVKGIDGATVLLLLQTLRMADADDAMPLVQDAATWMGLHGFHLTPPQMTTAIELL
FT                   LYFDRSVACELAVALVQRTSLSTLFSFSTARVVPILTAMLPTLTYGRNSNRALQSLAQL
FT                   EEVRENKVSAAEGLRDACLSDELMSVSSGGLVQLLRALWAFKRANQGFYSTAAATEWRS
FT                   LEEAVCGILATPEKCAEALLSELINVMADLTQWREQRKVSDSAETAVNSAQEKLFTAFL
FT                   VRLEAITERIRSCSPESTVKGSILPEPLTMSDVSVAWSHCLAHTESRGPSSDFPSLAAS
FT                   GNGANAADTFGTPLQALQAALWAVVGARYSAESQSIDAMQLAAFMCSEVVVSWMTHAHQ
FT                   ERDEALAQSAGDDISAVLPDLASLIPEATLQGLMNGISAQLLADSITWTPQMVRQAVTL
FT                   LGNSRDPAHRARALQLARKWYGQLQSRAQEGERLQPIELLAFFVPTLLQEEKKDVAQAV
FT                   RTSLSRWSVAEVLYFFSEIAMHGGRAGGVESMTVLRDSGKLLGVYAAKASAPQLVGLVE
FT                   CYGLAQVRSDDFCEAVASRVSELLRTTVADASREKTYLSAAQPTAASENQANSLAAGEK
FT                   EAAQTELAAASSTRPGATTSPGVTIAQLARLLRSLALMETRQVTPFIDAAHSITRAADA
FT                   DQGTAEQITQLIAAYAKMLIWCYPVLRALAERLLRMDKSEVTLSHLVTAQLALLRMDVT
FT                   FPSFTARFYEELSQMYKPATGQSRVSATGHASLSDRVVQLSILSRLRGHPSETPIDDAV
FT                   VEVLIERIVAHSDHLKVDEVAEVLLSLSRLGKGNSAAFGSLNVRTLGMLPKSPPRVMAH
FT                   VVEAYALAGRGDDTELFTLVADRTVAMRHEMASVTIASVLASFAKAGVRNDRLFIEVIP
FT                   RVRHVATYGTPRDVVNVVSAYAAVNLWHYKLFARLADRAIQLRADFRTPEVVALLKAYA
FT                   TVQMRYDRLFTEFSPRIQTLVHLLSPADLTAIVSSYAQLDIRCPPVWKATAAQAVTVAR
FT                   SFSLEDAKTLLEAYASQSFFNEECVSALTDRFPELASISWGSAETLADGKESSSRGSDG
FT                   SESEHRGQSETSQGV"
FT   CDS_pept        1771785..1772489
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26322"
FT                   /db_xref="GOA:E9ATP7"
FT                   /db_xref="GeneDB:LMXM.36.4630"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR027502"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP7"
FT                   /protein_id="CBZ26322.1"
FT                   /translation="MATYGKVYLVSGNKGKLVEVQSYLAQANIVVEAVKFDLPETQNSS
FT                   AEKISWDKAVEAYRVVNKMPVGEPLRHGGTPVLVDDTSLEFDALCGLPGPYIKWFLDRL
FT                   GVEGLLKTVKGFAAPGEENSVAAAPAHRGANAVCIISLCHGIEEATGKPLVEQFRGVCR
FT                   GALPPVPRGGVGFGWDSIFAPEAQTPAYAKTFAEMSVEEKNTLSHRAKALEMLTEYLKI
FT                   HAPGIRGTELVA"
FT   CDS_pept        1774594..1776351
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4640"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.1.1.73"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26323"
FT                   /db_xref="GOA:E9ATP8"
FT                   /db_xref="GeneDB:LMXM.36.4640"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP8"
FT                   /protein_id="CBZ26323.1"
FT                   /translation="MLEEEVVFDDASVASSEKAPLSKDKLDVPPRKVTRSRAQWLSCVT
FT                   VAGVLLLLAPLYLWNNFHAMRAAEEDSISVITPASDNFDIHKLIRELNENGEKIYLSSL
FT                   ITKEPDGCARDVPGLPKGKQTVVTFRTVESQEREAVVYVPTSYPSPVGGTDAKPVALLL
FT                   LFHGLNDNCKHFLDATGFMTYAERDGFVLVSVCGSLGYLGRGWNAGMCCGFLGEKPDDV
FT                   AFAKQVVAELSRSVCIDKTRVMAAGFSNGAMLAQVLACKAPESFRAAVSVSGVVEMRPG
FT                   NEAALTACTAAVEKASSTVRTSVLMVHGTADPLVPWNGNMALGFPSIMKNLEGWRERNG
FT                   CTEETNTTISTDAYVNTIYADCYVPRRAASPPTSDEDPEEPPTCFEDDLYWDADLVENT
FT                   SGDAPAAVVDAALVDRERRMSPMEAEDLSVRRESRRLVTRLKHERRSRDQRCQKWVRTK
FT                   VEHAKSHEKHDGKTVYSGKDSNWSHHESKDFHLRPQPHLKEKPSQEVLNRHVDVEHRRL
FT                   HHLLFGSVPKERSEVPVQRDSTPRLQDGRSEVELVRVNGGGHSWPRDKDFSTTDYTYNF
FT                   GIRIFGRYN"
FT   CDS_pept        1777744..1778427
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4650"
FT                   /product="putative 60S acidic ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26324"
FT                   /db_xref="GOA:E9ATP9"
FT                   /db_xref="GeneDB:LMXM.36.4650"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATP9"
FT                   /protein_id="CBZ26324.1"
FT                   /translation="MPKSKRAKIVPLTKTQAKTREDKNKLIERIREALEDYSDVYTFQL
FT                   HNIRTNILQQIREERAGDSRIFLGNNKIMMIAIGRDEASAQKQNLHKLSPFLTGLCGLL
FT                   FTNLSKKEVKEYFATVGAPVYARTGQTATESLVLKGGPLPQFPHSMFDHLAKLGLPIKL
FT                   DRGVIVLLQDTTVCEPGDTLSAEAAQLLKLFGVQSAEFKIDLTAHWANGVAKKVSSSAP
FT                   KKIEK"
FT   CDS_pept        1779620..1782421
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26325"
FT                   /db_xref="GeneDB:LMXM.36.4660"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ0"
FT                   /protein_id="CBZ26325.1"
FT                   /translation="MPSLDTRDAVKHYELRHNVFLQSILPGGLLSSLELKERCETLLVP
FT                   RQVSLEVAHIAPYFLATAQRPSTESSAKAAPPLSVLFGEEHDAAERGGSPNQGTDAAKD
FT                   EGRIGSVTFPPENRDAFRAALTRFLEYHLLHFDGFGNSEFTNLCGQRGSFAEDLGHVKR
FT                   FGHFGQVAVLADADALRPRGSGASADGTAAAADDLPRHPSSLQIFIIDKPLMDSDEVRL
FT                   VRETLHKLTVSAVFKIEAKMMAPTLTTSLVDIPFLMGNQDAGPLTAHMNLSSEQYALSA
FT                   PSAARVVTAIAADATDTNSCDGSVTETVAIEDFEDEPPEDPDLEAYVAKYTHISERQRQ
FT                   RSESTLSERKTLYSGGTANVQDEVIGGTPLSYSLPSVGRHQEVAVDAADCPSSASRATG
FT                   AKTAAAAAATSRTHANVLCHEYSRECIKDYRRVVAADNEIFYSEFERLMSLRCAGPLAR
FT                   LMSEYVSKNQHLQQPIQSNTVYNKFVEGCHMVLHRTPRLSTDNERLTIMQEGVERYVTS
FT                   RLYHQIFNVSEDERRKNERMQQKLLRLENMAPADLDALPEVERHHVWGQAMFELDGMDF
FT                   FKSPREKLRCGMRSCELLSLAVGDILRQRREAKRAEKAAKTAASGNAGGVPLAFGADEF
FT                   LPCFLLLVLRARPLSFVQNVLYIEKFRCPALMSTEESYCLATLQSSLLFWENYGEDGQM
FT                   DPTCDTISTSGSVEAPSHNGGSASIRALTKAHPSLSGIMQQQQPPPQMTEKDLLPSVRQ
FT                   ASSTGRHPAGVTNARQPGSEATALSGGKPMEEGAPTVLDVLFGWANRNLAPLASEIGLG
FT                   KKSGGSDGDGSSRQNDGLGTKPASFTGPVAVTHVSPPWGTVAASTSASGTADVVQDTSF
FT                   SSNIFHAAVAPASSPPHLGSNMSSRARVRQLLVTQNKTFEQLTLAELQMIVEEARQLLL
FT                   EGK"
FT   CDS_pept        1783603..1783986
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26326"
FT                   /db_xref="GeneDB:LMXM.36.4670"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ1"
FT                   /protein_id="CBZ26326.1"
FT                   /translation="MLKPSRFVSLSANILGSHLHMSTEQHTEAQVAELEKRATSAEKQL
FT                   QALRMKLEDGAGTAANGAKLEARLRELLKLMCEDRDECETIRARRDELMEENARLRTQV
FT                   MKGEYRIKHLLRTIEEIEKTGAP"
FT   CDS_pept        1784791..1785030
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4675"
FT                   /product="putative cytochrome b5 1"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4675"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26327"
FT                   /db_xref="GeneDB:LMXM.36.4675"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ2"
FT                   /protein_id="CBZ26327.1"
FT                   /translation="MKEYTREEVAMHCTAQDCWVIVDGHVYHLDTEFVTTLHPGGLIIL
FT                   ESAGKDGSVMFHEHHNPERVRPILEEYCIGKLKK"
FT   CDS_pept        1788698..1794190
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4680"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26328"
FT                   /db_xref="GOA:E9ATQ3"
FT                   /db_xref="GeneDB:LMXM.36.4680"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ3"
FT                   /protein_id="CBZ26328.1"
FT                   /translation="MRRAHRHSSGHGMGGVMSSISATVVSAVDLGDAEAQKVSSADHSG
FT                   GNDTSNCNDAGKQVTVLERLWRPVECVLTDICYTIEDRFIIPQIITAVPALIEEEFTDR
FT                   QGFLMLVGYFISILTLMVFAAYSRRLSNLMSGASPVMGEIMFCVSHLSQVTQEQLGWSL
FT                   FSSGFLSPSTFEWTATEGGVSGGVAILSGAGSQGSRRQMLGANGGGGLGANGASAGGSQ
FT                   GSIGVGGGSAGGIAGCPYTGGNLVRYLLGRKSNNMIRQELLRSYLYSSFYSPSAFLVEQ
FT                   TVWFVVLAATMDLVSMQRLAVAAFFANVVGWLPVYSVKPLTGLGVTLVVVFMYWIPSSE
FT                   VDDVLLSVTFLHRPMHRVLSAYCASLCITLLFAETLLLDDVRRVVVHAVFTLPQRLLRV
FT                   GGHHPVVTKVVHGCMWLRCEYFYFVDFYFFLGMMCWLSLVLMETAAGISVFGTAALLIA
FT                   VPWLVGSGWRETPKQAFKDTIIYIVFYVVVALLLAHVVPWSGLAFLSNAVQSGTVLYLM
FT                   AARCEYKQPGGSAYVLLWMAMMCVYLYVKAGTMRGTTGSLTWDLYDSNPRANFVKAAYA
FT                   VWCGKPEMESGALSLLRIACVTFWQLLSKGLSEDGIQLLHFNVAVLGSMLLFSTTMRAV
FT                   VVEGVRFSSPGPAVWTSAEATNTPAAASAASTVSPLPTSTTAASTKGDHNGGAAEAFTG
FT                   RQYCFRGVLNGSHCSAPTSSSCAKSRVVPHVGGAKASSSSTASTMRRSWQAPTQASVAV
FT                   IDACVSGNSSDGVAAPGEGRSEKAVTEALVGMEKEIEEAKEPAREVGSVAQAADEQPAS
FT                   PTPPTATSLSSVEDEGTPVALEEETEMPATLQSSTSSASVSKREDNQKEQRSQPSTASL
FT                   TQIPTSVDSVDETVREEDERTPPQPVSDPDGKKTEAAALVSPRDESDIDQDASRSAYLE
FT                   EIVNCNATSFTSTMCRSDMSSATLSSFHYDQAALLTSRSSTAAETPLEPRRERQEREHE
FT                   KDRRHERERVKTPASTGTGASTTPFPAIKAEQEGGHPPPPPQQQLPQQRASKPSGGRKK
FT                   STDTETPTAASSVPALPLPRSRAENLKKGAEAPMRPLVSSRQTPVTESKEVLRVKNSVA
FT                   AATMPAASAAKAASLTESTASTGANSAAAGVGVGATKDKGKAARDNGEGKKADGKAKVA
FT                   ADKNSTNSKAATESSSGDVKAAEPAVANGPVPFPLPELRHEHASAAEASATATAKALTA
FT                   AAKAAAGDAAGGEKRGGNKAAPFAVPDKGGAATAKKAAAAATSTQISASGPASTASSSQ
FT                   PVAMASAAPSLPLPRSVKAAETDGTARAARISPTSGEQPHEVPLQQAWRDVSWGSAVSQ
FT                   VTLAAKTDGSGPVSASGPKQDVKSKPSAATAADEAEDSDVSYDLDRVLNFLRLKINYAA
FT                   GVDDGDDDDQSSSTVSNADCRQNPTSFLHSDSLEHSTATPKRPLSNGTEVKCGVSAAGD
FT                   LGVDANVSHLVPQRTDEAGAAQESYALAQPSGNESLTSTPQRVSQAIQSASEWTTTSRS
FT                   GFGDCRVDSFACTNHNSANSSGNCALHGRRSSGFHVFSTHPNAAVATTAAGSSLSPHPR
FT                   PVHMSVASHASELLPSEMVESGVELSAATRHMDFNAASSSLGHYQLAQMVAPPSPPLES
FT                   RQSSSSHVPFSVSTNNPGGSQMSSMSSIGRANSDTADDRSSVLPRMRVAPNGRMSMSDQ
FT                   MATQKTQQSVSVADTMQQMQFAAPSMQQTMMMMMCAPDGQMALYPMVYNQPVYMTDANG
FT                   MMQPAQSVKITSQPPAQQQQQQIVYAAAAPSPGQAVDVAYHIAPDGSYMMTAMPQMPQQ
FT                   MMSRYQQQQEPYQWF"
FT   CDS_pept        1795993..1798944
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4690"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26329"
FT                   /db_xref="GeneDB:LMXM.36.4690"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ4"
FT                   /protein_id="CBZ26329.1"
FT                   /translation="MNIHISGNLRKPTVIFIAGWPDTCDVFRDNIMATLATDYRIVGVT
FT                   LPGFDDEHPFLEELRKRDDAARLRQLGKLRCAATGSTWASTLSPMRLLTSADAAPRPND
FT                   SSSRSGGACASTPLQVFGLSFRCAALEPFRTSWKGHSFQDLVTLLEIAVDTAMETCNYY
FT                   PSVRSPISSEVQASARRSGGGETETSEPATDAFAAHQLPPTYTRPVLIAHDWGCLLAYE
FT                   LLLARPRFFSRIVALDVGAYCFESDAAHVERMCVLVSGQGKGKPNDMARSPFAAAESQS
FT                   AFKQEKAANLSASGREADALAQTTATCDSNLAQQGRRVPVADAVPALTLLQRQSSSLLD
FT                   GPPTLSTLPQMRSGPSTPGTKRSLASQYAIRRRRGAALPQGAETRKTLFIVLYQFFLIA
FT                   CELFVPHRLGRWLVGWFANVSGRPSYSYDPQMVATPPMELLNHTLNAQFFAQHPFALEN
FT                   RGALQLPMLLQTEEPKVSPSSSSAAAAATVEAGYGTDRGPAQPTTAGWKIMLIPYLEKL
FT                   SVTAFRGSGTPGNQGLMQSSGRRLSERGVGETFEGNCGTVRKSRHSGRAQRHWFYGNSS
FT                   TDSCAGADGMGDTSEGDDGAGRSGATFDKKNPTDGAHVVFSSYAKGADMVFDEWNSLAT
FT                   DTRDIVDMGPSGLGSSGELDPYAPVNGIAAPVWVTEDPLTLTGAQSFRETYRATRVNSK
FT                   DASFLMAADGTFASDGGRADVFGVSSNTGTRQMHMAKRRLFYQAVVFPPLNNGATGSSS
FT                   TSFYGDLDDGDSGRSSVGSRSTVLCRLRKSNRTSSLRPLVLVHASPWNSWIYLRFWLGT
FT                   LVLRLVALVSWLLGEKQSTQPSSVPGDGTAASSAAGAPSKASSNVMTTAMTTIYRRLPA
FT                   TPSLAADVSTLPGNGDVVLQPKSHAPLVTQRYFVPLPIPILFMYGGEKRVMFHADHWCS
FT                   YIRQYQRPRDGISDVVEVQGGGHWFFAEKKYQKKVADRIAEFLVAEPTTPYEV"
FT   CDS_pept        1800405..1802588
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4710"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26330"
FT                   /db_xref="GeneDB:LMXM.36.4710"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ5"
FT                   /protein_id="CBZ26330.1"
FT                   /translation="MELDNLKEDVLMGDTNEVTVPAAIVASAPVLDIGFHPRLPIMATG
FT                   LVTGEVEIYKRKSVDEMVKIPLQNDFSSWIFSGQYREDEVVMNYHHQNMLMHPSGSVSS
FT                   MEFTDDGNYLVSASGDRTISVMDCVSLRLVIHIPSEEVRVRTAGKKKLNSMSKKNDPSA
FT                   KSGKATGKKAAATGRSSSIGSMVPVNPHKYGISSLNVCDENLIATGDDDGLIAVWDMRE
FT                   RRPVHVYHEHGDYVSQLCYFTDAQELVSSSGDTCLGAYDMRAGKVRDFSVRRKDELNCF
FT                   AFINSSGVSNATFIPSIVCGTPHGGLPLWKYGSWARPYDVMDRHPAECEAIISFHGENT
FT                   SFNHNLILTGACDGLVRVLQMYPVRRNLCQLSARDYTYSHASVLGIQSSSGGHQQQGNY
FT                   VVRRARGQEAISRMRVSHDANLLAVSGSDNIIDFVDIAFMNDEAELDQLRGRAEQRHLR
FT                   TLRDLDRELEEEEKRERRLVEGSGADSENEKNDFDEASSDSSSSGASSQSIEDSDTDVE
FT                   TEVDVQAKLAWREALQQKFAKIGIAQKKRTHSDSSSDDDDDDGAPAANKKTSEKALQRS
FT                   DVRGPKTAKSRDRVVASVRSPSSDTAAPLPKKVSRHVDSGMAGTGTACTQKALKKKRQA
FT                   LVETSASSATMEAPDTANVNPTSVAASSVEAVASMDSMEVYRTERQKKRERAAAARWLK
FT                   EERRKKINFTYEKRRRRVGGFFGDMASRDDDSD"
FT   CDS_pept        1805008..1809375
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4720"
FT                   /product="methionine synthase reductase, mitochondrial
FT                   precursor-like protein"
FT                   /EC_number="1.16.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4720"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26331"
FT                   /db_xref="GOA:E9ATQ6"
FT                   /db_xref="GeneDB:LMXM.36.4720"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ6"
FT                   /protein_id="CBZ26331.1"
FT                   /translation="MSDEAVFMDTGERLYVLYGSEAGNAESIAKRLHHDATTTHGLRDA
FT                   ECMTLNQAVAMKLFDAQLAKDASTSLCVVIVCSTTGDGEPPQNAARFRRWLRNTTGTLH
FT                   NVRYCLLALGDTNYNNFCAPGIFMDNKLRDMGAVCCYPRGEADDSVGLHLVVNPWLEGL
FT                   WAALKQSGTERTAASGQETHSTGETCIDMSVAQEAAVLYSNASQLCVAIALFLHERITE
FT                   LGGEADLYPIQYFNPSTSLRRPPKVLLFVLGTEDDADTLCEQRRRSAEQLPPLGPFTGW
FT                   IGSSGPCAPPPAEAAELQRWMADPSIRFFNSLFVSRKPDGASRAAALDADLKAIAINCK
FT                   LEFLCRCQFSGEVPSVAVSADDVFLWMEKVLHNLPGVTADAEYIRRTMDGSFDNRVGVA
FT                   FRAAQAPELRNGRATENDGVARSSDAGHASSKNGASHDAGASSKTHEVVEDLLTPIVFL
FT                   YSGHSSVVKQCAMDIFSGASQHHLHCSISELSNFQRMGFPRRATFVFFVSGVVTEPMAR
FT                   VLKVLRTLQGQKKNIEGVSFAILGIDQTSESGRFNVCALELETLLLKVKASKIHCTGLA
FT                   DLDSSSLVPIIQSWESNLWGAIVHTMKSAAYLDMASPSLRVQRTVVPLATSGSSVGAAL
FT                   SISGALVGESVHRDGGSGGDGGGNSHIERSVFEDFVGASATPSLLPLPGGVDPSRGAGL
FT                   AASSLVAVSGSSLAGNCSTPTTVAAGDTPSSEKTDTPAAGGGLADAILPWDPTPLNREK
FT                   ARHTPVVFLYASAGMSKAIAMHAMRSAEEKGFPTAVHPFASFQLVDYHAHPNVILFCEA
FT                   GAEGQSNGGRRFRRFLTNPSHRPDTLSSVRFAVLGICATLASVVHPAFRWASLLLRLQA
FT                   NRIFPVLIVPSMSQLHSLAMPWVDCVLSSLALLPSSVVVPAPPRGSDAPGAGVLTIGPA
FT                   RVGPAGAPRTRDDGPDNDAVEEAENASEDAEHSVLAEVGNCSADVSTEQDSCTESSMEN
FT                   RIAYRIDGVVQSWKLLTCPTARHPVVQLDFSVTAGTQWVPGQTIAVVPSNSTAEVEALL
FT                   RLFRLARDEPFLPPASAGPGASVFPTSPLYEVADFPVSCGTVLLRYVELRVTGIHKPLF
FT                   QLLAHHCTSEEAKAVVQTMYAKLLVHRTPRDLREVLEAVGTAADSLPPFRHIVENLSLL
FT                   QPRQYSICSSHRADATTLSICFKVAEKGLCTGWMYEQCLSAAGLPLVSAASAATTHAEG
FT                   KTAPSAVRQPVLPNTVIAAKARIVIPFVIRGASVFCMPRDALVPMILIASGTGIAPFRA
FT                   FLQERQAWLTEHQLRSGCTCPKGKLCGCPCEEATQHGEALCGTIDVFFGCRRRGEDYLF
FT                   RDELLHWEDSGVVHSLTVAFSRDTNDGRLCDGGCYVQDKIQECGVTLMNLILQRNACVF
FT                   VCGDADGMAKEVHRKLRELIQEHLSLSDAAAATYLERMSKDGRYLRDVWSTGV"
FT   CDS_pept        1810601..1815040
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4730"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26332"
FT                   /db_xref="GeneDB:LMXM.36.4730"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ7"
FT                   /protein_id="CBZ26332.1"
FT                   /translation="MTVHIGSNTVVTALWGSEDVTVIPLQPSGQFLSFRLSLTAATTDN
FT                   TVTSVAFHPVDETCFVLGTGAGKAYGVSLQENKLFLLADVGERCALRCATFCPGYLTGP
FT                   IVVFVGNDNRLLFLDWQHGTVLQDVLATAHQRPILHIVTGASTESLFCTVSADALSCWE
FT                   PLASRESADAIDPSSSAVPVTRHQGSTSTPGTTGPSLKDRSTSGFSMPRYGCSGSALPT
FT                   ECTLELQRNCDIVPKLADRVTHRFLGVHILHPALLVSVEADGVLSLWSRAAAPGDNEPV
FT                   AHRAPLRLQRSATTPSVLRVRCSAQCGALVVLGADAATVDELGDHVEPVVAFVVGQTLE
FT                   GAGIVRLPSGGTGAPAKDRAAAVTQVSAVQSDCVACLLSTGIVHVVLPSTFHLVFSIPP
FT                   PSVDRLGHRLGPRSHWSFTPSGPTFGAMWCEHVLLLLHLPTARRCDAGAGHAIEMSTLR
FT                   VGSRSAPSAGAVAGKKRTPVKPKATPRLGGCPGDAAAAAHGVAVVAQSFLRSCQASRST
FT                   PSRRGVGADSLHSGVDAALAVLSRCRPPIVVPKKGFSEVWPDVNEVDVRAAKQELTARR
FT                   ISDAKEADKDTPANGPSAWSSTAAFCDTLSPSSCQYNVNQLQAHLLKHGVFPHQYRPAI
FT                   WRFLAGLPSKSRTASQFAALARRPPHLAVSQLMNPFPLPPSSTRDAVESALSCLCWASP
FT                   VFTLASYLPVLVYPLSLVFHDDVQSVVELVLMFFLNWGRDFFVCHPHGPATLLMAMERQ
FT                   LRRLDESLCQHLDAMGAGVAVWGWELLTSFFTDSFTGAEWVQVMDHIFTAPPLFLFAFH
FT                   VAFVHARLRPELTSALSVDEVRGVLRRSPTAAAASQALSPPKSLQGLIEEGYRLYQSWS
FT                   CESGDSATGLSSFKVFQTLTPQFEYPVNFVHDSVVLAERLRELSLLQRSRDEEKRAAAH
FT                   LEALRKASAAASAEEAAFVLQQRARVAAKYDTSAAAWQVYVAVERSRQEREAEERQLKW
FT                   EMLQKRTRNAEELEALRAEMNMVECQLRHDMVDRHMEQLKWRLAAHLTDEELVRLQKDA
FT                   DTQVERAVQRIEEDEQRHAEDALHYETASPLSIEVPPGEEDRAEAENTASPTRGVEESH
FT                   PSTQPSSTAIMTKERCDKAKRQSPTSGRGVSAKGQECEAAAEGQAPAGGVSSSCQPSGA
FT                   RIVLHERRLCCYSSSPSASSSNDSTSVSLAATDETGGGASGSLHHRAQATSPSRVTLSQ
FT                   APVPVDCSGGQPDKRELHARVLEKANSSGGVSPTSRRPRLVPPPRHAYFDAAAEHGETA
FT                   LNQQRFLELRDRVLSRAEAYTQPGGVEDPLRRYRPPYRGDGSTAMATSYTPTITATSSC
FT                   PSSYTAPSSRLPLFDNYEPNQRRFGGGKCPYDPQQRRQLQPHVDAYMATVTRTSVTSST
FT                   GQSMSDSTSTTSSYQSPSTYTSYDYNYSATCSTMWRTGETTSAGSTACGSSLAQATRPR
FT                   SDPLAHDDGRKHLCASHR"
FT   CDS_pept        1816274..1820503
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4740"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26333"
FT                   /db_xref="GeneDB:LMXM.36.4740"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ8"
FT                   /protein_id="CBZ26333.1"
FT                   /translation="MGMSPNVTSANVDLYVLEYMVNMRWLLRYAAHELDPTVEQHYPDF
FT                   VAQVVNLDMVLSDTTFEHSCTLGDVPFGIVRLAREAVLYLLVSDHLLGGCPPTMHPFLQ
FT                   RTVVAVSSGAARRSPRRAPVSADLNVSFPSDGDGDDREGGALRTVTELDGLPLNTIDPS
FT                   SEEMLRLAEVEAQGRETQAMLLLLRWLFSEGVLSEDDVLATVEMDRTVDGSVNTQASTP
FT                   TLAATGYERFSRHQRLAYHLAQMVPFYFGAHLLLSRSLLLQHCSTLLTKEAVMRHVAHL
FT                   RSVVLLVAPRLAAVPPPSSVEGALLEWFQVIVDSINSSEDGAVVLERLHDCSALRAFIQ
FT                   QGPFCDDVMDPADRDFFRLVQSGESVCVALLFYYPDTVPLEGLSTALRAAEDCAEGCLD
FT                   TESGLELLHQHLSLCYWTAIVAAARQLGVWTLLRPEEIVRYGRTALPLHLFCLIQQLFA
FT                   VLATKAEEDVRVSADTAWWEQMKSRDGLTEMMRAAEADAGTDAQEWSDTPTTATMTKSR
FT                   VALSGAQQVLRRSMHDTFLPPMFAAGDASGDGTGSEQVCMESDCDGRPQERRVVAPPSS
FT                   TGRAAQRFDADECRSANNSVSVPVTGEDDTDGNTTQFFEVVRTQRGVRTVSGTGPEETL
FT                   ETATSVLRPMVQGRGSALTRTSAATSGTATTTMSLDTLTTVPAANLHDGQRRTDSRAAV
FT                   FGVHVMDTYARAEEESVPDSRATTAGNLTAQAALVLGQPLPTCADTLLHTRAADAVLHG
FT                   SAAAAYAKLPTSTTVLVDVPVVTAPASQKRLSRERDQGELSLHGAGSDYNANKDVSVVV
FT                   QLAEVSRDTSSTIARAAELSVSSSLTESSDFVMWKAPPDSNEANEAAHEISDSGDFSDS
FT                   KQMSAVTTDFQCTTEESPSRQVLAPGTGTAESAAALDSAMTRPLLASTTVTSAHIPAAR
FT                   MVVSPRQEGGEGVEDPETHTVALRQIRDATCTGQSSSMVSSSTTRGKVTAAEQRSDPSA
FT                   AHVPSSLSPVAGSARSTPNASTSPLSREADCSSPHSRKCSRVRDIAVEDKPRALLRGEA
FT                   EAWARAASRGRPFSQTPKKLEPLQTRWQDRQTGMGGGAHATVTCDLPTSLSHEQTLRRV
FT                   DSDALPAMSGEDREEYCSLPPSMLSPSPVYPVSSARRAREHASEGMRDHNTPHRTVSEG
FT                   TNSIEVSPLPLVLTRSVSEVYGTDYALMLEDMAASDVDLLRRRHRTTEESWYSSASWPY
FT                   RRSWRGAAESLVSAISSTQNTAQVRELLDRLTGISLTDLADKDKQELYSALAQQQAVVH
FT                   ELKTALHGGSARVGSRGQFNIPTHRPALQRRRKVQRQSPLEETDGRGKEALVEAGGAVR
FT                   RKPRDTLGEGAGTRRSLLSPMTAESGGSAAPTVQSDGDGQLAETDVSLQVNESLLFPTS
FT                   TSPPASA"
FT   CDS_pept        1821312..1821782
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4750"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26334"
FT                   /db_xref="GOA:E9ATQ9"
FT                   /db_xref="GeneDB:LMXM.36.4750"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="InterPro:IPR016542"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATQ9"
FT                   /protein_id="CBZ26334.1"
FT                   /translation="MTEDSQGAQIAINGFIGSILIVLGSITYVLWAVLPDDVLHRMHLT
FT                   YYPDRYWAVAIPAILVMFIFHYFTTSWLLVLVTTHPLTDGRCITDVDSKPDKEIEVGAL
FT                   ADSSSSVPPWVDIPVSVASHLLFEPWNEKVRYSARRPTEMMNGEKGRRERFV"
FT   CDS_pept        join(1822387..1822479,1822483..1824327)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4760"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26335"
FT                   /db_xref="GeneDB:LMXM.36.4760"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR0"
FT                   /protein_id="CBZ26335.1"
FT                   /translation="MLVCAFAKTYCGPHHPLSPHPSQAHRFLFACAAMSLRRSCGRLQQ
FT                   TALEVSTLHRLLQHTARHPERFELAEMYKLGILLKDSNDTLALSSNTELLKSLASRYAQ
FT                   IRENASPFQRSLLDAVLPRLQSLSTTGSSAAEAQLTTGSSSAPVGAVPVTAHEYFKAIM
FT                   ELAKDAEAEHYRAIAREARASSCGPQHDASVAMREDVSPGRRGAAAPAPSRSDEASATG
FT                   LDEALGSSRTEVLEAHLTALEPNLRQLSPVETCNLIKTLAKFNYTNYEHAVLLTRRGCE
FT                   VSGQLKRRELCQVFFNLHKLHTRDSLVAIVNHLLEHTTEMTADDVFLLCQALERQENTS
FT                   SASQRLLAPLVAQAIKKLPDAPSAAYHRAFLVSMARYNVVQPVTLQVVLRDWVEHWKTT
FT                   TSERDLLRMFEAAASLMAASKLEGLQQLVERLTELAPTMDVCHMDRAMDLLSMVPMEMS
FT                   TKCMMLILARLVDEAGRLSVRQVVFILQLLSTYPPAKGHTAVVSMAYAASVRAPSMDTE
FT                   SLESVFISLAMLQLYTDDFFTIAHVLQTQKGGMRSFAAVQELLRHCTSEMAATKRGLGM
FT                   LANVICTLAPMLNDEELASCRRALVSLGVQDRDVLQGIFARAKKLHRTQSTGHARKKRR
FT                   GSYDPMEDLL"
FT   CDS_pept        1825251..1826903
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4770"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26336"
FT                   /db_xref="GeneDB:LMXM.36.4770"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR1"
FT                   /protein_id="CBZ26336.1"
FT                   /translation="MSRAAAGAAAGVAVMGLFSSALSTGNRPASLDYIFQRIRLNLVPL
FT                   NAQDIYQICTVVYSNDTLGVLSDAELMRGIADAFQRSDQRVLNPFQASLVMDTLRRAGI
FT                   NASPKEVMLPEEEAISPETLLNVLRAMNVHGGTRDERKIDEVLKNIPAVLDEFSPTQLS
FT                   LALCELAKLRCVNAEAMNRIAKRLFEKTDDLSVMEVSLTTFALAKTRGMPYATVRRAFA
FT                   LSEQRLEEFQPDDYVNVLLALQVAGKQYGRTFVKLVEAALGKVENLDAVTLTEFLVTFT
FT                   TLDYGKREHLEIFADALVDVASDLDQQHLVQSLVALQRLDLLDEELFSALASCVMRYAK
FT                   NLEPRLIAPVMDICSGVSHNTDGLMHVLLDRALECTRMLHPNDLADILDIVALYPGARG
FT                   HALVEVFGRQARLRLELFNPVALARATRGLAHLGYRDVDYYTQAADTGFRFGFKDWSSL
FT                   EPILMGMCFNEEVPVRTVKVLASFVSQMAKSMSLQEVERANRYLVQLKCEENHVYRSLA
FT                   NRVMHFVKEITPDMPQELQVLVQRGAVNRLSEG"
FT   CDS_pept        1827782..1828735
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4780"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26337"
FT                   /db_xref="GeneDB:LMXM.36.4780"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR2"
FT                   /protein_id="CBZ26337.1"
FT                   /translation="MEGRLVIVPRDGLHKTSMFLVGNARRCILAVGSQPEGLLATPYVQ
FT                   QMADALKGEWAIAHVVLGSSHVGRSAPSHEADADDVDAVLGLLVKEHNMDEVVLYASGT
FT                   GVQVALEALALGAHAEVVTRVILQGGIVSPKSSKLFSVEATKRRLEVARALIAEKRGDD
FT                   ATAMAKVYDMAVTPARLSRNATLTVQEALWQPVLGESDSTCKQTLRGVTVPTLFLLSTE
FT                   SSYTATAMDAVPAAQRAARDAIGLPTEDVQVTLLPTTIDEHRRALNGNGALAMKTVSDF
FT                   LQRTDARRTQLKAGATVVAHDAKPKKGVAPVKRVCA"
FT   CDS_pept        1831290..1834079
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4790"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26338"
FT                   /db_xref="GeneDB:LMXM.36.4790"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR3"
FT                   /protein_id="CBZ26338.1"
FT                   /translation="MLSESDESTYTVHEVHHDDHGAVSKQVESQKEPEPSSPLAHYYRL
FT                   GTKERHTFDEHMRQLRQQVAAVERERQFRVSHPFQPKTCTPSATAKDAVTGEALADSPD
FT                   RLAHPVASGIGSFSSPSDVRPVFDRLAAQAVQLEMRRRHREEQRRRAEAASLRGAFQPQ
FT                   INHTAPIYAERLQHLDLAPVEERLLHYGEFVARERQRKQELKEVEQAVAWQSTQASLVG
FT                   ASTPQLRDPEERRRQQEEFLARNDRFLAERSKHRQYAEAAAAEAFTFQPKISATSAALD
FT                   EARQRSANDVSTVELGQLLNRSVDAPGLSISKTSASARRRSDALYALAVTRQRQRMQKL
FT                   HHNSTDSGESIDGVDKGKAVEDPKATYQPLTNPMSEKWIAEGAHGPFFQEGFVRRQALY
FT                   EEVKREEAALRATATQEPELSNGRPATHKVDAQQVNQRLYYNAKIAREAAERRRQALTS
FT                   ARECPFRPQLSPGTKYVLQHMSSRDGDVVKRLTSQSGRTPSRGARAAVDSELYAPAPAH
FT                   QSPLQGHSRSPSQQGMTEVTNSTEVVHDTRQRRRSLCTVSPRTDARGEHADSNGDELPA
FT                   PQQQQQQRKPHGRTLTLDQVEHFYQRQMAALQQRQDVIQERREGKAMEELVECTFRPRT
FT                   NTDRHVGTEAGAGEVASTAVSVNHVTGVSAFLERQAAARVRKAEHDELLRTVGLPRHKR
FT                   VGSNGTSSRITTLTPFKFQTEVRRQRLSSSPLENNQNREAAPFSIAALTTAERALHEAI
FT                   EQSRRYPRASSQAPLFPLPGYAHSSEDGVHFDDPGHVAAGSKGAEEPTSPVPPLMVSTE
FT                   KKRRGDAAGVGVGYDRPSLFSLISPNTFSGRNLGSAAYDSGNGKGTPAGRNFASDKPSP
FT                   SALKGSRQRLTASAKRHRRNRSVSFVEETADAPLAGVSRRGGKSFADPAHLAFLSGEL"
FT   CDS_pept        1834945..1836480
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4800"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26339"
FT                   /db_xref="GeneDB:LMXM.36.4800"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR4"
FT                   /protein_id="CBZ26339.1"
FT                   /translation="MPPLAPRRRRRTSELKFHHTKRRRVSEALVERGIEKEFDRTLPFW
FT                   RCFIDLRLATGRVPEVVTRHTQVLCRIPCKIFKRVDVVWARTKVQLRPVHVLTWQERKN
FT                   GPRPPRASYRVPAKASAEPAVAHAGPANETPPPVTDSDRSLRVYTIDTVHFVHEDAYKS
FT                   GTGSDHSFHVQSVVLRDAPHILQCVGGSMVSFSLIIYTSLRLAHACDARKCTVQELGRQ
FT                   LETAMAACSESSSTTTTESTRQRANNTSSAEVTTGTVQSADATQHVHSTTQTGRASLLH
FT                   DGDFKRSSDITSFSVLRAWCPPATVRVLILGMGGNSMAHALRVVLGGEALIEVVEVEPA
FT                   VVASCMQMGTLHDSDTKTKVHLQDADQCLATLPPNAYDFIYMDIFEPMQATMRNLHPWV
FT                   LATRKLLKPGGLLVMNDHHLPSAAGVAPYAKVFGEGNVQAVNLRGWSESIVVCVTPGDV
FT                   ATDKYSLDVSKTHADIAFNIYETLVPGWLPHFSWLVRARTYRHEGVRCRLWTS"
FT   CDS_pept        1837504..1838340
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4810"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26340"
FT                   /db_xref="GeneDB:LMXM.36.4810"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR5"
FT                   /protein_id="CBZ26340.1"
FT                   /translation="MASLSEARVARFTSRWLTEELNSFARSGNWEGALQTFEHMQQSSL
FT                   VRRNVFHYTTLLTACTRAGQMDAAMMIFRQMKANQVKPNVYTYTSLINGCANAKKLDLA
FT                   LRIFAEMRLVEVPPNVKTMTALISVCSRCGQWKKGFQVLDQCEELFIAPNALTYTAAMD
FT                   GCRRAGVCTPAIALLETRMTDPSQVRPNDVTYNTVLGACAAAKDHKSALRVYARMVADG
FT                   YEPIEYTRELLKEVFRGTSLDGLADNLTVRVKTSKWEAYVPDSDPATALRAAQEGG"
FT   CDS_pept        1839099..1840628
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4820"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26341"
FT                   /db_xref="GeneDB:LMXM.36.4820"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR6"
FT                   /protein_id="CBZ26341.1"
FT                   /translation="MNQTSMEELLAANAAAAQELRGVAVLDVPAFDPDGPLRTSSSNRN
FT                   DSSAMMSEAMRRRANVLCRALYPRTAPPSTAAVATSSNSGVEADAATQTDPSVRDVVRQ
FT                   GILAVVSNTSGEGASKPSASASSGVLTYKRARDGDDILSVNPEQLKARSAVVVSKAAAE
FT                   EADARKYSPPPKWRLAKVLVGHQGWVWATAVEPGNKWFATGSFDAIIKVWDLETGVLKM
FT                   NLTGHKEAVRSISLSKVSPYMFSGSDDHSVKCWDLERNEVVREFFGHKSAVHCVAAHPS
FT                   LDVVISGSRDNTVRVFDLRSRAVVHTMLGHTDSVMSLVVQQEEPQVISGGSDGFIYLWD
FT                   LASGKPLQRLTRHKKPVRGLAFTAAGDALVSCGADEVRVWKLPSGDFVTNASTRVLDDH
FT                   KSRSATSASANGADEVGEYSYRWSCCAVSPRNVLAVGSQDGELAFYDWNIPQPRRVAGK
FT                   HYAPYQWTKTKSLPGTLHGEGGINAITYDVSGTRLITAESDKSVKIWRMRD"
FT   CDS_pept        1841327..1842745
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4830"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26342"
FT                   /db_xref="GeneDB:LMXM.36.4830"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR7"
FT                   /protein_id="CBZ26342.1"
FT                   /translation="MTSSCSTYTGASGSGHERVTRILVVGEASVGKTLLIRRLCNHVFG
FT                   DTSITSTDEVSAPESPHQSQNAVTDDDLGPEWGPTVGIAVDALKRTTTVLDDTVTIPNL
FT                   AMSAPYDTASMAGYTAQSSSLYSVENGNYPSSFAYGTSCLNNGCRGSNSGLQYRGQGFV
FT                   GSNASFSLPYQVTSASCPRRQTVLQTVEFHELGGTHGYRDVARLLLRNIHYDGVMFVYH
FT                   RRSLTSTLYLKEWYRWVRSVFSACPDVGYHYGAEANKPARSSKTMPRFMLVGTQLPGDE
FT                   LPAAAAGLAKAPTETLHMASGAISDETLLDGNLEVKLRALQSPQTLTQRRGVWCALSKV
FT                   FRRLAWPYHVCWCASHPFFLLSKQYQEELGPRGRLGACGSCIVERFVWLLYQAEQALLY
FT                   VMAVILFGPYQKAVVLGHSRLKQTLEEMLKDELCVSQAHVCRLDSNISLQSSLDDVVAF
FT                   FDILLRRDASDDGH"
FT   CDS_pept        1845512..1849135
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4840"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26343"
FT                   /db_xref="GeneDB:LMXM.36.4840"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR8"
FT                   /protein_id="CBZ26343.1"
FT                   /translation="MDSDLSKTFGSVRSAHAYDQRVSSTRQASSSFVNINQKRSWRPPS
FT                   SLFQPILDYMNCAPFALAAANPFLRLFVERNVEGGGFSMRDYQVTPTLLGQNRCGCDVA
FT                   GGADALTQEGITPMVNGGLFGDCHALGYRAAAAYSGACLGTSGLVVEEDGVMEAWCGKT
FT                   CDDENFRDGGTGPRSGASASVPRIIPLYISGVDAPQGLSPLSNHCYPSVGVNRVAPSTA
FT                   QAASLSLKSSSAAPAGMRDRMCLWECGQSAALEISLCVCITCKSDAALHNLTLGAWWLS
FT                   RYYGVSLRLHHLHPAQLAAFKAAQRALSPKEIQLEHCVISEDMLQCISTCSDLLSLTII
FT                   SCSASQQMTLRCIDSILRKGNELRPVGFSDAHSAPLDGDASGGKGTHAMRQVFGMSRNT
FT                   NGCLKNDTPAEPDREVTNWYLSGVRSLGSLKQLRCLHILHTPLHETFLQALNTCSSLEC
FT                   IILHRCRGVRSLEPLRRLEHLQSLSLHGLSVTDTDLLSLAGCTHLRQLVLDECRQITDL
FT                   SFLANLRGTLERLLMPRTLLSNVNMQHIGLCDKLVELHLQSLRQLTDIGMLKDLTALRV
FT                   LNLSDNLVTDEGCSALHCLPSLQRLNLASCRCITSLAAAFTASGRWMHRLLSLDLSHTN
FT                   ITDVGVQFVQECTDLRYLNLYGCRELRLLPWLQKMISLRWLNLGGTRVTNEETKHYLPC
FT                   ARNLRFLSLSGCSSVRLLSFAVKLHHLEYLNLESTSVADSELSCLCHCRKLRYLSLESC
FT                   VDIRDVSPLCALPALLELNISLTAVGASAGGALSTTSGGSDGRSTPHGSSTIISSTSSA
FT                   LSARSTSPLSSISSASPVSPNIGANRFPVVQVLHLNGCSRMTRLEDLSRCYPQLRVLYA
FT                   DRISVMPPRGVGIGFTRMDERRRLGTTPRHRGLLQHTRSVSVSTDEPHSEGPPGANKSA
FT                   AHIHQVQQQYLPQPPAVPRPRTPHAVTSCHHSYPRVSSCGNEPRAKSRAVSLRFPGEAA
FT                   RVLRLVLRRSSVTDVMLEQLCATFACVSCLDLTRCTEVHYLSGLENLYALRELTLTQSS
FT                   VDNDGVRVVSACETLEVLRLTECRGVTDVNCLGGLRKLHVLCVARTQLTNQGLEGIGHC
FT                   LALQYLNCAECRYLSDVNALSSLKHLIELHLERTDVVDAGIRGVMRCSALQRVYFTRCQ
FT                   RLTTMGDVRALWPQLEVLDVYGTSIPTRVAGQGQQFACAVM"
FT   CDS_pept        1852087..1853916
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4850"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26344"
FT                   /db_xref="GeneDB:LMXM.36.4850"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATR9"
FT                   /protein_id="CBZ26344.1"
FT                   /translation="MSGITVQLVFAFVGTRVPYFMPESTTAANSPARSPFGNASSVSFN
FT                   TVAQGTLRADSARTSPHLAPCIPANVFTAQGLLSHLAKALEPSLHAAATPEATTTDSAS
FT                   LSPTVPLLFHKPPVFELFDYASLDPLEGSAVLHDEQVLLVLCDIATTAQLVEALQLEWL
FT                   EVYSGAHHPHHHSSSTSTLQPAHTTDMAVCTTEEKLRNVAHAQQALCKPVGLHLSLLRR
FT                   ELIARGVTLAAQKEQLAQMRSCTAAGTGIAASSTASGSDGVSTPMLSGRAASFPLLVEL
FT                   EPSLASEPALRATDATHLQKLEAPLALCEARVRAIESLMQRAEKHHTKLLELAASERAT
FT                   EEAFQRGNVSRACAEYLERTEQDRSAAEAIIADYQVEMTRQLKVVRQLVAYITQVRRLV
FT                   SKAKYEMGVVELILSRLSLTSLRPRLMEEAEALLRRRVIVRRAARRQMLLLQETEFVEL
FT                   QQDLESFSQRMEVQKVLPEKVRWYLRAPLPSLLPEEDPVATLLDHALIDREEDEAQELV
FT                   EKTRVYTADSSDPATNALQITKALLPVERLARRLEEARASAAQYKSRVEELEERLKMYE
FT                   TAEALSPPPLQESVVKSPSTERPAERGGMFEEG"
FT   CDS_pept        1857263..1857970
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4860"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26345"
FT                   /db_xref="GeneDB:LMXM.36.4860"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS0"
FT                   /protein_id="CBZ26345.1"
FT                   /translation="MSLLALNVCLISSSFDVVALPLSSTLCPVEVDDDAGDTSLCYGLA
FT                   PLTEKGHKGYGYAHCTVMQFCARALDLKAVREIVRETWLKFRKHVLESKESLVLTGVAD
FT                   GPIFATTVDGRAVRLPNITVERSPNLMWLHETIVRELGQYHVKVGSEDVAKSAFHRKFP
FT                   ADGNSTTPEWMLSFMNKYAHENYTPHITLGACTEKNVAAFSFLQKTEIPWRECRLVVSH
FT                   MGNFCSCFELLEN"
FT   CDS_pept        1859296..1860015
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4870"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26346"
FT                   /db_xref="GOA:E9ATS1"
FT                   /db_xref="GeneDB:LMXM.36.4870"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS1"
FT                   /protein_id="CBZ26346.1"
FT                   /translation="MGVFLQIISVCATLAALCMMASPVVTVQRMRAAKSVGSMTITFFC
FT                   AQFLNCNVWSMYGVQMLALPVIMCNTFGSAVSAYCILTFLTVARMEEKAGHVLKSTSYV
FT                   ASLKMATLTMFLITMLLVLFLYLMSFSSSDFSAQLNGILSGCCSVLMLSSPLVMAKAII
FT                   REKNAEPLQPATVMFATLNSVLWTLYGLLSLDMYITIPNVLCTLACIFQIFLLVRYGRH
FT                   PAEHIEITATIAPVPLD"
FT   CDS_pept        complement(1861409..1862350)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4890"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26347"
FT                   /db_xref="GOA:E9ATS2"
FT                   /db_xref="GeneDB:LMXM.36.4890"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR027734"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS2"
FT                   /protein_id="CBZ26347.1"
FT                   /translation="MKTCDGLDGVAGAPKMTESLIFQQCRRHQGYSTPELNEKLYLHHL
FT                   GFTQLDSLAAFTGCVVLYLDHNALSDLAGLAALTRLDSLYLSCNALSHLDSMPRLPALR
FT                   TLDVTQNQIVTLNGLDEAAPQLQTLLAGHNRLQRLDGVQGLSGLLSLDVSSNCIKDEER
FT                   TSACLCGSRATLRTLLLHGNELCRHTAHYRKRWIAAFPALRFLDEYPVFDDERARAEAF
FT                   AGGGTAAEAEIRSAQRARALAEAREQFAYYGDIREAQRAARRRNGAETRATPYFLAHTP
FT                   TIDRTVAQDAEDEPIYIPATRGAALHQDPLRG"
FT   CDS_pept        complement(1862971..1863636)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4895"
FT                   /product="putative exosome-associated protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4895"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26348"
FT                   /db_xref="GeneDB:LMXM.36.4895"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS3"
FT                   /protein_id="CBZ26348.1"
FT                   /translation="MKRADGRESPGAVRAIHVATNVLANCHSSACVEIGKTRVLCGVRP
FT                   PQQLVQEYRGTRGRVSCQVHRSLESLSNLDNSGDRDMALALEGVAEQAVVLERIPQLLV
FT                   GVLIEVVHDDGAVWDAATTALCVALTAGGVEVYDTFSACSAAVRHDGAIIVDVTQEEAA
FT                   TALASVVLCSGLSLGGVYYCCHKGACEATTMSQLVQAATKGLQVRKVPLLEQIRNQLV"
FT   CDS_pept        complement(1864081..1870437)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4900"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26349"
FT                   /db_xref="GOA:E9ATS4"
FT                   /db_xref="GeneDB:LMXM.36.4900"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS4"
FT                   /protein_id="CBZ26349.1"
FT                   /translation="MNVSGDGGVHRGRRPHPGENCASVFATSSGALPETQNDSQCSVGS
FT                   TETSKEEERLIVEDALRRLPQLAAFPLLSMSPQTSNHVNDAPVENSSFFSRHGTSYTLA
FT                   ADEEALLLQELVNITAGAAPFISTAAQEELATGDSDKRPDEADNLLGSRETGTRVPAAT
FT                   ATANGDSTSSLPKVSASEPAATSPAASSVHSSTHTGKGASSSKRRRAVPPPTSSKTAVL
FT                   KEEQDILDAIFAAVDGQQSSVSGDLLDEASSAAAAEASATSADSDEEIDEVNLVLEQAK
FT                   QLTSSTVLCETQRGELVLHVHEHIALRRKLADLRKAAGEPTCVAVAESFDISAKAPTHS
FT                   SAASPAAHTPSQSLSCAMGTSLGVVVLFDHRWTVLGICGSVEASVVNVRGAVVSLSLCT
FT                   STPALGGPDETCDGRTAATGHARGMFVLWSLHTLSPLRVVSDESRVPVLRVMHLHRDPT
FT                   RILVLDSSGAVRFFQFWKVMAKYMLRATSVTSASAAAPISDIDTLPCPSSFYMANLATM
FT                   KQHMPSSNGEESDAEVNAPWLCTPPPLPPAAVTAAGISRTTWPTIAGKHFVATVSNDAV
FT                   LVCVVETGLQGTVTGVARHSHPPSSALGNELVRFVVMEVGTSTPRLLLCVSWNTEVELL
FT                   LMNLRVPELSESRKTAAAEPMLEGLERLALLRVSAPLVQMVPLAGCSVLLCDQNNHAQL
FT                   MDASVAVMVERHHFVSLEYVGFASRLCGVNYHGTAASNRAAALLMGKEHTYGISLRSWR
FT                   ERLSSLLAHRKYTQALDLAKGFVEEVALSTVGFSSKAAKCRRELHQFMERILIAYVESR
FT                   LALLPTTEATGKSSGGQPKQSAGSSDPISGTEFLLDVLQQIASYCSAVDGLNLLYGPVA
FT                   LALQQRGLLSHLLYVLEQCMRHGIITYMPETLMERFIYLFLDDAELAAVEVALGVRPRA
FT                   PHEGKEARDDVLDAGQDADSAAKINGRDRVELALMYLDSGASSLLRLAQEHGLVRLTVA
FT                   VLSLRQQLYVDALAYALDEEQKADECLHGNGRGTDVCAPRVPKCPSPFDSPDAASVAVD
FT                   FVECTLKGVSFLPGASLAIAEQRPAKKAILEYLLRRASSGGRNVDSSAVGGGEHNLLRF
FT                   LRRQPEHAMRVLLFALSDEGPCSPWGGADGLSRTQFVSSVYFILTGGTRTRPRHAAESD
FT                   LLSASGQRQGPLDLFRIDDESLNRLPTLRTLRATELAQRPFPPYIAVHTFLAGAAIFNE
FT                   LFLSIDAEELASDELDRPPVRLDVWLDLAIQDLLFAFQGAERVEERQELQEHLLRILAP
FT                   DLLPPYRVAVFQADFTRLRMARCLAALLCKEQRYAEAIACYTDPKQNCVDAQLQHDVFK
FT                   MLRGEMQHLQDVRTQTINRAQQESSRIQGLGSSVLDSDRGAMSLMAGSATSDVGGGFGD
FT                   DVEQHFRTESWLISPTVTATATAPIDAAIKALQRAVMSQVELLVRIDATALAQFIFDYL
FT                   PSNQREVMKLLRGSSAAFMDYLDELVTQGDQAVANDMNLQNTYIELLCAHTPRRVYSYL
FT                   QEKGNRVTYDVQLALRAVRKHRIADAAVYLLEKAMMIEDAMTVMLRAMRELLAALREEV
FT                   LTRLTAGAEAATEAHGDQDLDGSAPLFANTPDTEEGEAATQRGCKGSSTRGRDDPPLPF
FT                   ELATLDSATELWRLVGIGEELCSRHQAECVARGASTSGAATPLAAVSSHIFSSATHGVP
FT                   GGSPQHPEYWFRLLDVFMVPRRLLCEMMAQDDRLHTLDTPPVPARPFASSDPTGMNSEL
FT                   DAAVHIAMASYAGAAAASLAHLPSAAGPPQHLANLSTPLSREQRRCVEALVAVYTQYTS
FT                   RILQSMMRSLDISVVVNKVVQDNKDGTFRAFKPILLDMMATLSFDLEASRLCKLATERD
FT                   LMLLGRELYQMLNTSVVPRSDCCAFCHVHVSKPPLPKPAGEEVGAAAAVGLVPSGVSVY
FT                   TCGHAFHTVCAAQAMGSHQGCGVCMQSRCSSGKPGGSDVYGHASGASAVWPSTSSGAAT
FT                   DHPEHRDHADPVTTVVMRGAERSIDVAQMQRRVRQTKMKMDHPEDLYSVLKSLMARDTS
FT                   ASDSSLGKAGPAVTRDGTGNWALAPSPSAPAAAGQMHRPVTGGVANMQDKVFDTLTDAE
FT                   ILELFGGV"
FT   CDS_pept        complement(1872113..1873195)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4910"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26350"
FT                   /db_xref="GeneDB:LMXM.36.4910"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS5"
FT                   /protein_id="CBZ26350.1"
FT                   /translation="MPLPPVESGPAAMTRRNFLVEMNRLRVSQYTPTRKQLEEEDLRIA
FT                   TIRQEEKRVKHAEWAETRRKAADSYNAAGTNSGRPLPGSVLRSMRASGKGQPAENTYKL
FT                   EKEEEAAKKRAYNRLYEQDAKHQLAIRQATLKQMHDDEAHQMEALRKLNEEEDRKVAEV
FT                   HAQAMEEERQYMQRMKESNKRELAARRAEQQAKEARDRQLQELVNENDRHRAEMDERRQ
FT                   KNVTLMLRLQNEQFHNEVLKNKHASEAKHYEEVAAMEERNRRLTKEEQEAAQRKKEQFR
FT                   QEFEDCIARDKEFRRTHNYDESMEMTRQRNELAAQSYRLVLEEERLQNAERRQQYRKDL
FT                   MDQIMAKQTYRMTHLDEAGI"
FT   CDS_pept        complement(1877953..1880085)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4920"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26351"
FT                   /db_xref="GeneDB:LMXM.36.4920"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS6"
FT                   /protein_id="CBZ26351.1"
FT                   /translation="MSAGFTKQDKEDLREIFRIYDFSKVNKVEDSVALAQKAGQTPAEL
FT                   FDDLYQLFKIQKLPQRETVARRMREAVPNATDADVESVIRQSEMKGFTERDALRSLERK
FT                   YSVQHLDRRALLASRGNHSSPQCKVLEGESELGQAASSLHHIQVNETSMTSSTLLATSG
FT                   DVMEKASDSSLMLARPPSKLSGAPTREDLDEIIAEEVREWVAKMVGVKYNADVLSMPNF
FT                   VDALRSGVVLHVLLQKMESPPVSDEDLKLPKRTTGFFVRDNVATFLTTAKRRYNLVDAQ
FT                   LFTVSDLVDGKNDRQVVTCVMSIARIAYSGGTIKDAPNIIMYEHEIEQQQNRLTRLDLD
FT                   RIVQEAEADEGMSNPVARHDDPVDWPSNKTVPVPTTTSPTVRSCDECHDFATPPTQESP
FT                   CAGESAFTQHELGSPDVAVEGLVRCTVPDTAAVCDTDKLNDKGGEDKAAATSASTLPSD
FT                   QTPLRVSASLACMPPPRTCAIEGTTEPGVLSAPTDVGEHFLPANASVGQVSQTSAQLTP
FT                   TNSDEALTAAAPSTAVAQPAETPEDRTEARGTDVSDAAPSERRRSGGEDSDGGGRVFYL
FT                   RDGMIHPAKATPMEEKVVAEHRKKTGPRVVWKSTSTPLEATQPPRYHSRHWDGIDVALG
FT                   RHLNAHYEKHRQSPWRFRTVTATSGEYVLYNRLDASRRVVFLRIIQKRLFLRNAGKHQR
FT                   WVEIDEALEGLERLEV"
FT   CDS_pept        complement(join(1882074..1883300,1883304..1883576))
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4930"
FT                   /product="translation initiation factor 2 subunit,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4930"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26352"
FT                   /db_xref="GOA:E9ATS7"
FT                   /db_xref="GeneDB:LMXM.36.4930"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS7"
FT                   /protein_id="CBZ26352.1"
FT                   /translation="MRFSFRGGGREGLPVDAPCLPCATPLSFISTPFCLSCLHFGVFVF
FT                   CHPPKSRATIDPLLLTTQPNHKTSAAHAKLREARKETYPYRVRNRSILTPPPLQKGFSP
FT                   AACTTPSTPLNPSLLELSTVMMSKPHHATLESIKYTPGSLRLLDQRKLPLETVFDDVLT
FT                   VEDIWSAIKEMRVRGAPAIAVSAALGIAVATQRKVANGELKSGGEVQTFLLTSCDFVMT
FT                   SRPTAVNLFNCLRDLKAQVDKLDLTKAAAEVAQAFVELAEAVYTKDVAFNEGIMQHGAA
FT                   HIFAAAKAEGRDKVSILTICNTGALATSRYGTALGVVRQLFYDGNLEKVYACETRPWNQ
FT                   GARLTVYECVQEGIPCTLICDGAASSLMKNNKIDAIVVGADRICQNGDTANKIGTYNLA
FT                   VSAMFHGVKLYVAAPTTTLDAKTASGNHVEIEEREPTEITTNMVTKQRVVADGPHLSIW
FT                   NPVFDITPGELITGGIITEKGVQAPATSAPYYDIASIIAQP"
FT   CDS_pept        complement(1885293..1886120)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4940"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26353"
FT                   /db_xref="GeneDB:LMXM.36.4940"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS8"
FT                   /protein_id="CBZ26353.1"
FT                   /translation="MSAHEEEINMILSMFSDECERYEGTSDSVVVHLPFHFELQVTLPP
FT                   HGYPDASYPQLYLLSSPNAQLAGAFSQEINRRMRDELPLGIPMLALLIPLAQSVAEELK
FT                   DLKERADKARQDEAVEEMSKLQRKEEHRRETSIAIWSGEGIVDRRSRFVAHMARVHSID
FT                   EVREVVGHLRSTKSIACAAHPTIYAYRFTDANGVLQKDSDDDGESGASIKMMFLLDHLQ
FT                   VDGYVVVVTRWWGGILLGPDRFKHIMEVTKDMLLTIPEREKGMAASAKRKSVR"
FT   CDS_pept        complement(1886735..1888882)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4950"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26354"
FT                   /db_xref="GeneDB:LMXM.36.4950"
FT                   /db_xref="InterPro:IPR032862"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATS9"
FT                   /protein_id="CBZ26354.1"
FT                   /translation="MRPFLVLQRRRHCITRLRATDACERLNQQRRFIITNTPSSYAAFS
FT                   SATSGIGAEMRAKGFHHSTPNFNTAEFTDAADPSDLANDIVTESAAGVDFARDIYGPWL
FT                   VMTDDLQGELFVDHDGFVYYRPANGLGYGIGKLQVLDAGATGTAFTCQLESYSYQPTNT
FT                   VVPQYGLTFDITGMVKRVTSKSSDYTTFSLVGVWRRSNRNKDAPALLPSQRCSSDTAVE
FT                   GASVAPSPESLGNQGTLGGPGEKASGQFNAAKLSPWDPSTAEKSFAPNAELQSVFAQVF
FT                   PERLRVESHVQRAEARGESQAARHLTGSAGKPSLMHLDMEQYATGNIPGIYYIPDYISA
FT                   TEEAQILTLIQGTPEDLKSKLTKRTCQEWGCTMCETCQKSFVSDANMPPWVQELIDMQV
FT                   YDGLFTPTTFPNSVRIHEYHQGDGIGPHCDGPIYVPMVTVLSLASSCLMSFYPKQPLYE
FT                   SHPMDHYNDTFKFGDGDIGRRVPLQSVVMEPRSLLIFSGEGYYHYPHGISDKTEEVLTP
FT                   EVVGDVVNRRFLRDPDVQLIPRTYRASITTRNLMTRCSHQPARAEYAMKRAWYLYNHLP
FT                   VPSELFTPGPQLSQQQRSAGVSTGSSPGSRESSDGSAPPSSQKRVESPFPACTPPGTFA
FT                   VDTELREAIYEMRARQEELCNNVEELKQLVALSIPSQATFQTETATILNHLSSSVLQLE
FT                   SKVDDLLEEVESAKRKSLTDT"
FT   CDS_pept        complement(1889987..1892920)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4960"
FT                   /product="hypothetical protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4960"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26355"
FT                   /db_xref="GOA:E9ATT0"
FT                   /db_xref="GeneDB:LMXM.36.4960"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT0"
FT                   /protein_id="CBZ26355.1"
FT                   /translation="MPVSSDMDVVAAVPVLKPLLGLASSSPVSWKHLSSQDGYNVSEFP
FT                   PIPALGLPMKCYRTQFVVNADLDSFQRVLNDESSIRQFDLTMKEMHILERCASKTLLYT
FT                   SYASPSPWLVAPRDFCVWSAAIFTTLEQLKRISSEATEGSAQSSNNSLTVKKFVCTSQQ
FT                   WGEAPDPGQTVYLQNSVTALESDSAAVATRQGGKPFVRGVVYCFGYVAFADPSINGKLR
FT                   VTHYCCVDPVGQIPKWLVAAAVDENTKKLRKMAELVEAAAAAAASAAEPTLACIRAPSA
FT                   DWLPAEEAQEPEFTLAGSAEEPSEEAKGEGVSTPLFTKDLCDEAPSPAVPAVEGPSDSG
FT                   ACPSPDAEAEAAPCMTPESSDVSPLPQPTSKERRSSPPSPATWRNTATHDPSLTSMPPQ
FT                   QPGTAASVDPRVKILSLLARSNDWYTRREVAEMQYAELRILPEPLCSKNPLCIAMRVST
FT                   LVRCTLDTFVAVLRNPALFPEIDPELVRVVAASTSSGASSRTASREPSTSGHGAASTAG
FT                   EVRHYQFDANDSFRRPWDMVLHCTDFELTQVNGGRYGFHTPGVPAATYLWVGADNTTCS
FT                   YRGVHPDGYHQHMQVRVFGVTAVAVPRSAESVRVSQYMLFDACAPLLSTPHSSWHISFQ
FT                   KKCPTEEFLSSVSRWLEDRMGRVRRLSEARHRRRHNSAMVALDKVPLLRFLYAVHCAEG
FT                   GRALESPEAAWYGDVLAGAIRWTGKGGSPSLRTETGSDDPPLVVLSTVFPCSLAQLRDY
FT                   MLCSSPRHRYALEYGVHTYEELTSPPEFTTVRVEYGAASASFPRVRLTILEAFGELHGV
FT                   NVPSPTLVLSRTGVDGDVKDECEELDFNSENFGHLRGSADERFDDGHVFCSGWVATTLE
FT                   GSGSQPCANGPLAGLRSPHSGLAPLSSELCTERSTSDAKAEKAAVHQLERIVVTQYLSV
FT                   GLPSAHQCDLDADGLPCGCIAEQAALLQRFRDAVCTRGPSIAATALE"
FT   CDS_pept        complement(1896342..1897388)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4970"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26356"
FT                   /db_xref="GeneDB:LMXM.36.4970"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT1"
FT                   /protein_id="CBZ26356.1"
FT                   /translation="MFSRTVFRCAPVVEDIVAAFKVLGLTYNPRAPASSRPGVDDVRRQ
FT                   YLEMARLHHPDLSSGDDNRMKVINTAYELIQSSGILQGAYDASAGAKEGVAGQQGGEAG
FT                   TATRFARKAGRRRRRLPDDFASGDDSSWSMKTSLDWQAIMNSTETLSEEEMKNPANHPF
FT                   SHSKFFTFEDDLTIYRMIRGGATVRQVARSLGKPATFVERRLQNAQFKLRVQYVLRQDK
FT                   RKSTAASLNGAASSGSMQHTTSTPITEPATRRALRRSPYEDAHVGSTAAAFSTPARKRE
FT                   WEPSYPEWRAPRYRDQMTLEEQGRLDGLLRETPRAAHPTGKAVSSPHSAASKMGRSYEN
FT                   YKRLRSKL"
FT   gap             1904328..1904427
FT                   /estimated_length=unknown
FT   CDS_pept        complement(1906167..1907171)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4980"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26357"
FT                   /db_xref="GeneDB:LMXM.36.4980"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT2"
FT                   /protein_id="CBZ26357.1"
FT                   /translation="MEIMTTTASRSAFCLPGGLQTLSASCYRHNPYAFTLLQEKDRERA
FT                   TESFGYIYSILTDEGRTSPAPPQQRRKARRGVAGNKGGSKYDSSCRDPEMQQLDSSFAK
FT                   SGGAADSSNDDGVSETSSDSGSHYGKEVLGSNLPGFSVTSSQSHPGASSATAAATAIPA
FT                   AVPSVIRYASVNFRFGSAWFVAPFRTFTGDMVVVQYPGNNSLHMGLVSAITTAKPITFY
FT                   TEDNMDPNYLSPEELQTVPRLLRHARDFDKETKLDLRRHDLSSLANARKLGADIGAPVQ
FT                   FLDAEWLLDLSAVTFLVKVFGSTALADKLVDELAMQEGAEVVFTYPVSSTTMY"
FT   CDS_pept        complement(1908809..1910503)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_4990"
FT                   /product="putative delta tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_4990"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26358"
FT                   /db_xref="GOA:E9ATT3"
FT                   /db_xref="GeneDB:LMXM.36.4990"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002967"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT3"
FT                   /protein_id="CBZ26358.1"
FT                   /translation="MATVHVFVGQCGNQVGTAFLDTVASEAEASVDEGYQMRVSAMDFR
FT                   PALRPPPARRHHQRSAAACSATGSSREPSGAARRIGHRQYYSLSYYAQEEERATIDTSL
FT                   PQPRCVLVDMEPKVIAAAVQRANGQLEQHEFSPSSSSSPSPQSASRRLYSLAPQQCVTR
FT                   GEGSANNWAFGYHQQGQSRRDAIVECLRRESEQKGTVVSTFHVLHSIAGGTGSGVSCLV
FT                   AEEIKTMFPRSTLLHSVVWPFSCGEVVTQWYNVVMAVSTLGGLADGVFIAYNDSIAGEL
FT                   KGARANRGFKDAGEVSFQLINQRISGVLAPLHLPQLLYTLPSPQKDLSKNRILGTSTGA
FT                   ARGILGSGPSGCVAEGTAPQRYATAGDVIEALSLDPVMKFFTGSLAPQMVTGSTTWAAV
FT                   LGEAARTAQHSFTAPSALSPSADTGFSRSEGKATTNRLADASAFYMQHRSCLWAIRGVA
FT                   AHTDGIRELRHLMTNNVSSPFPMTSLFVSPAEEWRATSSHTRPDHSVTLYSPTPMVGAS
FT                   LADAARRAEELLNVGAFVHHFERYGVSKTELRDAAAVLYDTAAAYHL"
FT   CDS_pept        complement(1913027..1914085)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5000"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26359"
FT                   /db_xref="GeneDB:LMXM.36.5000"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT4"
FT                   /protein_id="CBZ26359.1"
FT                   /translation="MSLRRGSVSLNRTLVTTVLLLTLPLLLDLTRLPDSSAAQEYVFSL
FT                   LTPCDGVGLCNLCGEVLEMVDLVQRALTNPFQDRLTLSPEDWDAHGLQSYQRCLREPFL
FT                   RGCDTLVHKIRMQRIDFAKVILEQVVEDVQFRQKWGSLGEDYVVDNAVQLTTYIFDSQE
FT                   RSLGGRRDSRKEDGAARNIVYQPSTFSLGGDPEVESLVTRVWFLRRDVLLLHQDFCYPV
FT                   CEGRLTVFRRVQVVILRFYVRHAIKPRLLLLRQRHRGTLVVAELMMIGFAFCVERVMRP
FT                   GLTWNGTVARRIRRLQGGTASSTPTSSGLVSGARGEDSAAAANSGGGSGGCVGGGKTHC
FT                   RPGRRRRWVVVV"
FT   CDS_pept        complement(1916111..1916851)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5010"
FT                   /product="putative 40S ribosomal protein SA"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5010"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26360"
FT                   /db_xref="GOA:E9ATT5"
FT                   /db_xref="GeneDB:LMXM.36.5010"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="InterPro:IPR027498"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT5"
FT                   /protein_id="CBZ26360.1"
FT                   /translation="MTAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRT
FT                   AEGSHIIDVHMMWEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFHGG
FT                   RFIPGTFTNQIQKKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIA
FT                   IPCNNRGIKSIGMMYWLLAREVLRLRGTIVRSVPWEEKVDLFFYRDPNEAAEEKAAAAA
FT                   AVPVAEAEEGFGWVERNDDNAWEA"
FT   CDS_pept        complement(1917822..1920359)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5020"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26361"
FT                   /db_xref="GeneDB:LMXM.36.5020"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT6"
FT                   /protein_id="CBZ26361.1"
FT                   /translation="MSSPVKPAASASDDLFKSLERDFEEAMCALEGEESLGHFRLEYDK
FT                   LYRALKKSHASENKIATQCQQLTQELLSNAAKMQAAVKLSQGDHSTIESLKKEIEKAWR
FT                   AVDVANEKNQRAREMVKTLKQEIQSLQSMIHDGTSLSTDHTSTLEQLKIDNKRLLTESE
FT                   EMTKQMDTYTKEMAERTATLETLKSSTEEAVQESKLLANRLELVRQEYNRERNARERAE
FT                   YQCCELLLTLKTREKALQERQERLTLIHAHAAKHKTELETQQRRLQALQQQLETAEKQL
FT                   YHTKQSYNDSVDTTVELNERLHAMEKQIAATGKTILETRDECTRVTRIEERDFREFDRL
FT                   KQQIDNIRKDEERIVYEEETVRKRIAAVKREKRSLQEALRLLERECTALEKKGAREESV
FT                   QTVTQAAIQNEVAQQAELEACISQETEIGRRLRDTLQRLEKERENCVSEVSQMSGQSKS
FT                   AAEELKMAVFQVEEVQRKLDESERRLTQQQAKYEHMRAERNQLSKRLVDAQDEIVEYRQ
FT                   RVKVVDHQVHQFKEEQALKARKCQSDRSQYKISKERLMKARQLVNDSTASFDATLEEGE
FT                   RVGQEVKQLLKVVQECDKNLCGQQREFLKMSNERDTLAAQMTRRNDELVLLYQQLQLIQ
FT                   DTINAGEAAYRDRLDDVRLLHLKLREIQHQSMLAHVRGREVSTAKDRLRAKQKEVLLEQ
FT                   AKVAALAEELENPQNESRWRRVGGGYPSMAELESKIKLLQRNLLTKSEECMKQEMALEE
FT                   KQRLMMELHAMAARQPGPEVAQHLNAYQKDLQKKNAQMKQKASELNMTATHKAELRYEV
FT                   ARLRRAVDEMRQKYYEVKVKNETFTAAELIPAS"
FT   CDS_pept        complement(1921302..1922468)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5030"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26362"
FT                   /db_xref="GeneDB:LMXM.36.5030"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT7"
FT                   /protein_id="CBZ26362.1"
FT                   /translation="MSALNDSRSTSGRPLPGGKSHALRPQRTPPSLCADDVGASSGGDG
FT                   IGEFETAFEHLHSIRSEEEGSVDPAPSAEQRMRCIQRDVYRHERQIASLLSEKHEHCEH
FT                   LATVYEELEKMLRKIQLTPLEDLKGHAASPSASTFCAPSRDEDGYAASSTVSALASSLQ
FT                   QSFHQVLQRHQDRVYEVLVDYRQQIDKNEYETGRRLCAIEGAIAQIQSDVRELQHTASI
FT                   QAEELRHVQQDMRLRAEAVTAQQEAQRAALDAIGEARDTKAAKLLSKIQDDVAQLMADA
FT                   KAVRTQQIQSGKDVEEQIRSLLLAQQRAEEALGVHRASIALLQNQDSLEGAFHEVKDWL
FT                   GDLEKRMVSRGELLQWTESLQSEIHQMRRVTSGVLSHTIEPTAPGQDA"
FT   CDS_pept        complement(1924176..1925471)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5040"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26363"
FT                   /db_xref="GeneDB:LMXM.36.5040"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT8"
FT                   /protein_id="CBZ26363.1"
FT                   /translation="MLRRTLRRLMPSDAIGSVHPDVLWGYQQGQYAGPGWANLIKSLPL
FT                   ETLAMQGGSTMANLNDRTGTFLDPEDPRHPIALMQFGMMGKMDGTFHQLAYGDFGRVPK
FT                   GSRLMQVLYENYLEPFSMNRVCAQLYFYQKVPNNYHASVDATAEYVGQTASLVGQVVIG
FT                   LGACIMEGVTIRADTNCVYIAEGVQILENTCIMSDAPTDLLAYQRHELLNPYQQWDGMD
FT                   GVTRIMPNTIIESNCYLDGCSIGSFNRIGHNTKIMKGVTTGIMVHIMPGSVVTADTKIG
FT                   DGELWGGAPAHKIGEVSKFEYKRPYYASLLHRESVAESYRNMSRYGDQFVHYTNAMGQL
FT                   ETLMIHYEDHVTPGIKAKVRDFEEGREPFHHTITRIAQGWSPANRPDDKNFAMAPPAPG
FT                   VKLFAEHNTDSSPSEWNGSYANITNIFNDFRW"
FT   CDS_pept        complement(1927676..1928479)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5050"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26364"
FT                   /db_xref="GOA:E9ATT9"
FT                   /db_xref="GeneDB:LMXM.36.5050"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATT9"
FT                   /protein_id="CBZ26364.1"
FT                   /translation="MGTRLHFTVGRVCSAIIGVHLAMSSSLFLCSAFLHDRAFEQHWDY
FT                   STPTLRRRTHYFDFWRSAFYSPVLSREERECLDVWLSILAVHSPMFATIQLSPKAVLQD
FT                   SMAMLHGISELRDGVYLLEELPIRVEPYLQEIRREKQGDVVFLHGKTRTDIYLTVPFTS
FT                   YSVPLFVFPASFTLQLERTQTNGHLHITTVEHRWFSGLICSHLTNSVASPWGDVGDLCR
FT                   RYNGFLWSLMVTKKISLDERRRALATRAAEIEADLKEQQERQISM"
FT   CDS_pept        complement(1929828..1931150)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5060"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26365"
FT                   /db_xref="GOA:E9ATU0"
FT                   /db_xref="GeneDB:LMXM.36.5060"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR036283"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU0"
FT                   /protein_id="CBZ26365.1"
FT                   /translation="MSWAALVKSIKPEEATNFTAKPRVTVFAVDPSQNDAERQLQNPQH
FT                   ETAEVRLPSFSKGLLILDANAIIKGMDNFVSTADALVTTPQVIVEIKDRASRELLERLP
FT                   HKVTVLDPTPEAVAAVVACAERTGDFGAMSRTDIRLCALALDCCKVGGFLGEPIEPRPP
FT                   QVNPGNADKVQVMTEEMGEDDSDDEREKSEPAQAQSASSGSMPGWGDWSNEAKGTDGEG
FT                   GAGDADEDDGEGEWITPENIQDVQSGTRRTGRAFEAGMACVTSDYAMQNTLMHLGVPIV
FT                   GTNGIHIRELRLWMMRCTACFTLVGDTTRQFCPECGSGDTLRRVNYVVNDQGEKKLYIN
FT                   FRKRISTRGTIYNLPKPRGGMRGTNRNLVLREDQLAHVIRGTTSSKVKAHQVMQNDDGA
FT                   LATFGEAPKLKKKNLADPRAYSSYHKYNVNEKKKVRAAHRK"
FT   CDS_pept        complement(1932096..1933277)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5070"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26366"
FT                   /db_xref="GeneDB:LMXM.36.5070"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU1"
FT                   /protein_id="CBZ26366.1"
FT                   /translation="MSFNLEKLNRGLTRLASVRQYPIAKKQYVAKQTKGRVFRVGVLHK
FT                   KELTETALLRNRRGFINAQLNTVAHAPSLYHWLFHRCGIPFAETQALAKSGRLKVNDVV
FT                   VSSATDLESQLSWETFQQLDIQVCSSLPALQSSSSTGPHARDTSRAAQGTWVPALKRAL
FT                   HRTYTFIYLHPGVSVSSEESEPRSFVHRMAPIMGTDPSPLLGLNVLRPIGFFDGMKGIG
FT                   IASNDVSMVRYWNNESLGNFGVYDVRFPRGTPLEVVQHAAKAVEATLRARVQPQLSTDV
FT                   GVSCSCVCCPPPPPSRDTVANQLFSSIPLLTEERLLVTTPLLPYRAARRLQRSGALISL
FT                   VRNGPFVLHSSLVQETLRPCSATDLALLFTFERRLKTNRMVLSLREFDVEKKA"
FT   CDS_pept        complement(1934399..1936261)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5080"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26367"
FT                   /db_xref="GeneDB:LMXM.36.5080"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU2"
FT                   /protein_id="CBZ26367.1"
FT                   /translation="MEAPVPSAGAPAGNAPSSRGASRGGRGMFRGDRGTNDRRGRGRGF
FT                   SHGGHDAFRGRGRDWGDARGRGDTGGRGRGNGPREGRGFVPKKFMRHRSLSGKHGSHTP
FT                   LDAERKAKREKKDRKPNSNFALLRSVLGDAETIAEYIRDYHSSEKFREAKSVNTFLQAI
FT                   SQRPKAVYEELMSQYKNEVFTTLERLFALYALGKNPMIPPAHEFLIRCEQEGVRKSAWG
FT                   EGVRTLPVRAAEADAAIPAEGETEGVAPSPQPPAPVAPLLDAEVASLLSPRELLKKLAS
FT                   LDAVGRLQRLIEMSRSVADIQVCAKKLTAMVTDAQDDVEKGSVFPSTSAEKFDYAAKCQ
FT                   LISKLLSKARRLVEPTFAPSPRAAATGASDNHVEEPTEEATVRRNEQVCGGDDEEGLPQ
FT                   TAAEAASSGTSATAVDHAAPIVTRRRVPLTDHEIEGFQAAISLAFHALETVLEQRLPSV
FT                   TQQPLSKFCKVLEWCKEKGLLAAADERFATLLEQQAEKDIAEQANQIETVISLKSLTAG
FT                   DTAALREVVDQLWEAGGTQCFSPSSMDVLSAIAVAASVDGIDSDVKGLVADRLVQTQRH
FT                   LADTVVLPRRALRFVNDERNKVKQASIAKQLQAEASKYKTEGGE"
FT   CDS_pept        complement(1937811..1938638)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5090"
FT                   /product="putative protein kinase ck2 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5090"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26368"
FT                   /db_xref="GOA:E9ATU3"
FT                   /db_xref="GeneDB:LMXM.36.5090"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU3"
FT                   /protein_id="CBZ26368.1"
FT                   /translation="MDEAYSPENMEYEYEDEELVSWITWFCDLKGNEFFCMVDREFITD
FT                   DFNLTGLAPIVPFYHYALELILDVESMESDGLTEQQKRLVESSAEILYGLIHARFITTG
FT                   RGLKLMEEKYIQGEFGSCPRVFCEGHALLPVGQSDVVRESSVKLFCPRCEDIYHPRSVR
FT                   HRSLDGAFWGTTFPHLLLMQLRERGVSIPPPNQHYVPKVYGFRVRKPGIPLITNGTGEE
FT                   ETGAASAGAGDVSRKAEARPHHEEEEGAVTGSKALDQRVPAESSSSSSKGKAE"
FT   CDS_pept        complement(1941564..1944518)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5100"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26369"
FT                   /db_xref="GeneDB:LMXM.36.5100"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU4"
FT                   /protein_id="CBZ26369.1"
FT                   /translation="MQGGAPNNGNPYAGYQRGYPPQDGMQGYPQQAARGVGAGYYPPQA
FT                   QQPPQPQQMASQQPQQMASQQPQQMASQQPQQVAAQQYGGYSQAYNQPYAARGGYQPTP
FT                   PQQQAQLQQGYASRGGYYQGGGAYGGAGIQQGYPGAAAPMGRGGYGQGYGQGYGQGYYP
FT                   VQQPQGYYNQGYNQNPNYAPAARGGFQGGAYGVQQQPQQLQQPQTQPQPQLQQQQQQQQ
FT                   PLNQQYARGGRGGAVGLQRGGRGAGRGRGGRMFESYAVVHLDSYAQLEEVGRKGATETI
FT                   VTPEVLSAMRSRGRGSTIRVLVVIQKKYAAACLSIPRGPEDTLLSEKTAESFVGVPCVI
FT                   VGHAERLIDLANGAAIQGPVFSTFRSLMMLLTPFDKPQTTPAEGGQPVNVHEKTRDELL
FT                   EAITKDIATYEALMTEMAADSDESTRLFSHLMHFSDGEEDGVQQGEAHEEGADADVGHN
FT                   DGEEGEEGNEQKTAAGEKPAEGAAAPKKMVKRTLMSSPQGIRILRAALAVSRKRQVFFE
FT                   KIAPPPPNPEANPLNRIEWSASLRLIDPLLHYPLLSDLVFQFFGVVPVGAEAVKPAKAK
FT                   AQEVKALCDAIARYGVQLTSSASCGNTILALLQAMDPQHAKISVTERAAEETNRKPGLK
FT                   RGREAEESDANADDGAQKAKTEETPEGEKEASPETQAAKPAPSSLAEYKASAAPMDWRL
FT                   YYAVAESWCTGEQPVLRRKRTRFTTQAQLDADAAAAEKPATVESRLRYVGHHLIGSLVL
FT                   RYMTPIFADAILSALKSPASRKKKEHDAFVQQCETILSTMAGAWSTNDASFTGGNVYRN
FT                   LLTSLASRAVPDTPIEAYLRKLLDGIVNTIFESSKEKYLSHCVQEALTVARQTKDGGRF
FT                   TLEVARALMEKADESFMNLAISPSGNYVVRHLCGQLTDYATGKVAAESEVVAEAKELEA
FT                   KYYTFMTANLGKLSRIQYGRGLAGWQSEQAARLGAASAPSAPSATSAPSSPNAE"
FT   CDS_pept        complement(1945665..1946459)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5110"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26370"
FT                   /db_xref="GeneDB:LMXM.36.5110"
FT                   /db_xref="InterPro:IPR028034"
FT                   /db_xref="InterPro:IPR040673"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU5"
FT                   /protein_id="CBZ26370.1"
FT                   /translation="MEHSSSCSGRVCRGCYGEIAEIVTHVDGVYMLQTKRQGTAHQLNV
FT                   IWRVLGEQLEEMLIKKRSGIVLDFLHASIKVQRVMLFDKSIAIELKPQLVLLPDFTSKF
FT                   HLKNVLEMQDAHYHATVPNTVSYITIASIVGTDRFVVEAAVKDSVREIGKYLQRNAAST
FT                   LTIDIGVGFLEFQDRTYRMKWSEEFLARMRASVGAAEVVTPYDPPSRTIGGPTAPCRFQ
FT                   KGCTSENLLQTQVCDTVLAESRLSSAELNDGMGSSSYRRTHW"
FT   CDS_pept        complement(1947501..1948241)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5120"
FT                   /product="putative 40S ribosomal protein SA"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5120"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26371"
FT                   /db_xref="GOA:E9ATU6"
FT                   /db_xref="GeneDB:LMXM.36.5120"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="InterPro:IPR027498"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU6"
FT                   /protein_id="CBZ26371.1"
FT                   /translation="MTAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRT
FT                   AEGSHIIDVHMMWEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFHGG
FT                   RFIPGTFTNQIQKKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIA
FT                   IPCNNRGIKSIGMMYWLLAREVLRLRGTIVRSVPWEEKVDLFFYRDPNEAAEEKAAAAA
FT                   AVPAAEAEEGFGWVERNDDNAWEA"
FT   CDS_pept        complement(1951013..1951849)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5130"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26372"
FT                   /db_xref="GeneDB:LMXM.36.5130"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU7"
FT                   /protein_id="CBZ26372.1"
FT                   /translation="MSAPPSYKNLANVVKDYLTKGSDVCGWQLDANENDASKGFNAFPF
FT                   ASSKAIGAHLSYECPSYHTTLKSKVSAAFTSWREYLPTIIYHTKINNTLSDVEVDAAAA
FT                   SVKVTAKHSVFNASCKSSPLDGFVTDANVTTCVSHQVYAGASLQYDPKRSGVRDFTAII
FT                   VRYACPHIGKGDLLGQYSLWNGVSVHLRIPLHTCMDAAIMAERRCFIAGVQARSPCGAR
FT                   LMFNTNVSDGTYTMTAIRNMNDIWKLTLTMTAPLASGEGAAAPRFGLKLTNMDASD"
FT   CDS_pept        complement(1955073..1956599)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5140"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26373"
FT                   /db_xref="GOA:E9ATU8"
FT                   /db_xref="GeneDB:LMXM.36.5140"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU8"
FT                   /protein_id="CBZ26373.1"
FT                   /translation="MVQLSLIEEIKDKALRLIPNSYIDIVEECTAPQLLIPTYEHVKFL
FT                   CETVNKKPEATVDVVRAIRRRIADSHVAVKHLTIQLLESMIKNCSTGFHVEVATQKGLL
FT                   RDLVAVACVQPTTGRAMQAKESALLLTLNLSIWFRGHPAEECYILTTLADDVRNQMGPN
FT                   CFEGLEPERNARMKVEVRGPNHNRRQPSQRSDVGRNLHGAHSHGHHRDKRNIVNAIAID
FT                   LPTSERVSAMLETCMTFSDYVNNAETNPEVCLRDDEVVLSYVSQLRDDHIYVTILLSSN
FT                   LQLDRDLLRTVSDSQSAVLAKVEKSMAQPLADATPEGSSALPSAVQQTLMRSAVDTEQN
FT                   SGDVSAFQEAGMQQRLPPPRAEVPSGNVRMTGISPAPVSTPPLAAAPVVEDLLENGQSA
FT                   PQATSSVPKSPVLSIEEPGSTPVPSPPAASPAVGDFATTTPTSSNAASPSPMHAEAAEE
FT                   SGAEETPAPLHAASESALAVEAAAAPAPPTTGLPKDADDFDAFLEGHTVN"
FT   CDS_pept        complement(1959305..1961182)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5150"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26374"
FT                   /db_xref="GOA:E9ATU9"
FT                   /db_xref="GeneDB:LMXM.36.5150"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATU9"
FT                   /protein_id="CBZ26374.1"
FT                   /translation="MTMSLKSSTCRSFVRVRPFTPSEAKVCPEDSAIPRGILKWDGNSV
FT                   ISVLDPQNYFEVRRNAVFAVNEVLWSFQEPGEETVKSSNKQKPATQQDVYNRVVAPMIP
FT                   AIVEGYNTAFCVAGASSSGRFYTLYGSEAEGPNRGILPRFAEDIISSFKTNAQTNSSIS
FT                   VELEAVDISGETYVDLLATGRHGGSIQASADSLKLISTPSGPRLVGVNSVDADGTPELI
FT                   KVIQQLHRIVEKRNCTHTVSFRLTETFEFEDPENVNQSVSKSRRVQVLFVLLRNMPSAF
FT                   QRCIDVAVEHDSGENPLAKVPVRECAFTKLFPSLLQQGFHLNMISCVSPYYEHMREDIN
FT                   TLQFSVKVKQLRGNPQLLHDESFVEMRRLADEVKDLQVEKKKTHEALSVVQNELNAREV
FT                   ELMKQEADYNKTTNEITESHQQVKLATIGRNMEAERSNRARKLMNTELNKKRAEIKEFQ
FT                   QMQASLDAATKRQMRDADDAKARAEAVEAMLKKQKMNTSIYEERLNEYREEDRKTESIE
FT                   AFNVASPDEQRRILISESDEKKNSDAEIQRIERERSTARGLDNTEERMRAIQAEYDVAY
FT                   QVAAPSREKAELEEEIAKYEKEISETECEIQRLQSEIDKKKSQCQCNLM"
FT   CDS_pept        complement(1961968..1963665)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5160"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26375"
FT                   /db_xref="GOA:E9ATV0"
FT                   /db_xref="GeneDB:LMXM.36.5160"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV0"
FT                   /protein_id="CBZ26375.1"
FT                   /translation="MSRYVPPHRREAVASSSEELTSTSSVAFQQEAWRALSRSITGVVN
FT                   RVNKDNLEQSAVELFRENLIRGRGLFARSMMRTQQVDPDLTPVLAALTSRINKDLPTVV
FT                   ELLCRRLVVQWSRAYLRKDWRYVENASRYLGWLFLLNVVEVDIIYQLLLRHLTSEKRSD
FT                   EDVDQAAKLFRETFKVMSLKERRSFHEQILTPFRDLLAMDDEELRLSTRSQAVLESCLK
FT                   EVQEWERRKEREEAIPDYLVLFDLEMQQTHEMDLDEKYPTEDTLDRYAFDAEYDTHEEQ
FT                   YEAVRKAILGEDWEVELLQQVADAEGDEDEKGGGEDADEAADGPSAGAGAAASEAASLP
FT                   TSAELDASKTLIDAEERKLRREVYLAMRSSIRADEAVHKILRQMQPQTERTICFMVIEG
FT                   CCEERAYRKMYSMAAERLCKSNARFQAFFVEAFHARYESASELTLKQIEYTCKVYSHLL
FT                   RTNSVYWSRCLSCLDIVENSESQRLMIQYLFKGVAEEIGMSGVMERFQKDEELRWHTQR
FT                   LFPLNQGVEALKSAVNLYVAMGLPEMTTPLRAALEEERAAQKRARVDY"
FT   CDS_pept        complement(1964771..1965400)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5170"
FT                   /product="vacuolar protein sorting-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5170"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26376"
FT                   /db_xref="GOA:E9ATV1"
FT                   /db_xref="GeneDB:LMXM.36.5170"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017898"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="InterPro:IPR037206"
FT                   /db_xref="InterPro:IPR038358"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV1"
FT                   /protein_id="CBZ26376.1"
FT                   /translation="MASIEIPPEDRQHIDYLADLFAVIIAIEQIEKANRRDLINQDQYD
FT                   STVRRLLEKYKNTVAHLQGARNPYFTTIDDFFDKYCARCLAARATIRDGPMSSPNENNA
FT                   RFLARQSVECSDHFITLLDSLRLQQTSVDVLNPPLGDLLQVLRKLSLSKEDFCVRLQNW
FT                   QRRLDSMSAADMLDESAARDFAYDLDRGYACFKAFLENDPTLSMRR"
FT   CDS_pept        complement(1967156..1968754)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5180"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5180"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26377"
FT                   /db_xref="GOA:E9ATV2"
FT                   /db_xref="GeneDB:LMXM.36.5180"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV2"
FT                   /protein_id="CBZ26377.1"
FT                   /translation="MTQCFDVKNPATGAVVGKYVQQQASDIVKAVANARVAQKAWAQLT
FT                   YDQRAVHLKKMKTFLASNADRATDVIVSCSGKTRQDALATEVLSGVLACDWYAKNTRKV
FT                   LVPQKLPVGSILFANKSNTIYYEPVGVVGIISPWNYPFSIPFGEVLMGLMAGNAVLLKV
FT                   ATNSTPVGCFIEEVVQAGELPVGLFQHLIISGAEVGRALLEAGINKLFFTGSVGVGKKL
FT                   MAEAAKTLTPVSLELGGNDPMLVLKDASIERAVNCACWGGYQNAGQSCGGVERIYVDES
FT                   IYPEFLAQLKAKTEALRHGPDTGAFDVDIGCITTRGQYETIAAQVKEALAQGAQIEAQS
FT                   RPSANCPKNGFFYPATVLSGCTPSMRIMKEETFGPILPVIPFKTEEEGIQMANDCTMAL
FT                   TSSVHSRNMNHAKEVAMRLESGVVTINDHLYSHGMSEAPWGGWKESGIGRTHGYLGLKE
FT                   MVNAKCINSDRMPSGLLPRNLWWYPFSRETDAMLRNVLSFAAPTSILQMLSSLWYIITH
FT                   CRYMFCPWKISSTEK"
FT   CDS_pept        complement(1969580..1973434)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5190"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5190"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26378"
FT                   /db_xref="GOA:E9ATV3"
FT                   /db_xref="GeneDB:LMXM.36.5190"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV3"
FT                   /protein_id="CBZ26378.1"
FT                   /translation="MDDVKKDYDCSTSCALVPAITESHPDGGANRDDDDMSELVPLLQR
FT                   SRSQRFPPPSFALAPAVPLPLWQRVALSSLQSREASLLSQRKFKHIRQSLVRDLGRYHV
FT                   ELQERAEKQRQQQREARVRAGERVAAGVRRYWSRRGDAYQQLAKVEFDVMKHQHDRRKQ
FT                   EDLLRETEELTRKLLESIFSAARKRPASASAPSVEGRVVNCSPNGMHHHTPDAPPLDST
FT                   PPLFPVTVPAHASFWDTVGDDDTAPIEAALSLLDTEGGQRPLRHYQRSALRWMVHLYEN
FT                   NLNGILADEMGLGKTVQTIALLCYFAEYRNDWGPHLIVVPTTVVLNWKAELERWSPGLK
FT                   VLTYIGSTKERHQLRKGWTSEDAFHVCVTSYNLVVQDRKVFRRRPWGFLVLDEAHHVKN
FT                   FMSLKWQSLFDLQAEYRLLLSGTPLQNSIMELWSLFHFLLPFASAFRSNAEFKEWFSNP
FT                   MDEMITGRSTLNEDIVRRLQALIRPFMLRRLKKDVETQLPTKTEKVVLCRLSRRQRFLY
FT                   DDYMQLAETRQKLRGGGGAGGVLSVLLALRKVCDHPDLFEERPTTSPLVLSYDAVVELR
FT                   VPREVLLLDNDDRGRWRFPCFHVLDVNDDGGRVHSMQSQAEVSGSDWAVCARECRSDRF
FT                   LSGTGAPAPWWLFLTHVEQPDAPSADAMSSFAKRFSPAFLEGPIRRRRESAPDDPQLCN
FT                   CSAALKAAFVSVLAQARQQSRSRHHQTTTAQWQRYHAIQTARNTYVPPTCRLSLRQTVL
FT                   AQRHPSLCPSIAVRAAALLPVLERVCVYVPAVLAAHPPRLQWSLPIPHPGPFEVLNREG
FT                   CAPLIGAVSKAQDAAQCGRAAPRLRYDAAFFLQEMWPIQVRRSFLFPDKRLLIHDCGKL
FT                   QFLETALKKMRNDGHRMLIFTQFVHMLNILERFLALIGVVYTRLDGSTKAELRQQYVDR
FT                   FNADPRITCMILSTRSGGIGLNLTGADTVIFYDSDWNPTMDLQAQDRCHRIGQTRPVTI
FT                   YRLISEHTVEESILEKARERKKLNNVVIRGGQFHTIAGVSEQYGDTAAALAALSNPVNL
FT                   RSFFHDLDEDATVASGATAPPIDTSDSAGTAESPLDVLEAMADVEDAEDRAAGQELQRE
FT                   IAAHAAEEAEGGDEDASGPPHQRGTMYSSSEREKELGSSAACVANDDAKWRTRLPNSFL
FT                   DALLWSSTSLGSGAAFHEREGSSVDSVSSAESSSAAALLLAVRKRQREIAVKAHAPVDQ
FT                   FLAFQYGRCHRADAEERYNALVLSYRAHMGENIGDNADLEKAHMDLFQPRFRVEYRLGS
FT                   "
FT   CDS_pept        complement(1974138..1977098)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5200"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26379"
FT                   /db_xref="GeneDB:LMXM.36.5200"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV4"
FT                   /protein_id="CBZ26379.1"
FT                   /translation="MSALVSLVQRAAAIARPYNSQDALLLIRALSALRVSRPEVRLICE
FT                   KASFSLASSPAEVPTAVLVDAVNRLCTLQSAHIPVVQRVLLKRFCELQSECGAQRPPYP
FT                   SPTSSLPVDPRTAQKAALVLAKLGRAAGQAETTDHVLRLLHALLEHRRDDAGLHIAYVA
FT                   LYVNSSSYTTQLPWWATTAPLKGSVQTLQRSVHFLLKNRQTLTRASGNVAWQLLHLLLV
FT                   IPPSTQSAVASQGSSAHHLHGQQGDSFDNYFASGALAQKVSTGAYVQFVHSFGSDVCRL
FT                   DLQRTIALLTPLARPQKEAASAALHTQKRLNVYDATKLASALAAMFSVLATHPSRSASF
FT                   AALGDPREQGLSVQASQASLQASAGAHEAWRRVVQLCFTILCDLVECEQARLCSTHNDD
FT                   ALMDAVVSPDRFLVAALLDSYARGCNVLLESAEVPKGMRNPASPLSMLSASISALLEFV
FT                   PQLSETPPTMISWMLRSLASLGRRGNAADGDHLERSSAFLLRQYLCAPSKKRCLRSDVE
FT                   TLYAYVRLLGLNGDPHSSRSYSTTTATLTTPGKPPSHRLPPLSALDPIVREIASRLRGS
FT                   PFAADGEPQTEDADMLLATLLHLYKKAVSVSATMTGISTGTIEVPPLLDDLQSTLAAYY
FT                   CDRVAGTPSVQMKDNVAVRAARLYVVVALLRGPQFSSCRSGAALARAAERTTKEVTMIG
FT                   APVASSSMLRVLAVLERGEHTDVAASLSPTSFDVSLLFTLCHRYQQYINEIVQTGGRRE
FT                   DVSEVVRVLWRVRQVGVQLVFAEAASRDVLLDASSVLQGSNATQPQLWFPASLCRLEHL
FT                   TCCAAVDLLQLIAESQLRSPALMQLQPHTARHLRMTLFEQLTVIADVECVTRLLQSNAT
FT                   PAVSQVVLPEKDDLHRVVRCVDACVSSLLDSTLKGRSEDVAKASQHDDFREKASRLLHA
FT                   LVESQLFIRIPEIVSSVAGGGLRRRMLELAQYLESSARKADAIAVLKMRLFCGDVL"
FT   CDS_pept        complement(1977923..1982335)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5210"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26380"
FT                   /db_xref="GeneDB:LMXM.36.5210"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV5"
FT                   /protein_id="CBZ26380.1"
FT                   /translation="MSSSAFSSPSAPMRCDVYDAPITAIVCSGSRGEVYFAAGNTVHCS
FT                   RTDSLTCSTSVSEPQASSTTVRFATAPPGTTINEIDVAHPSSPRPIVFMGAADRVLAQC
FT                   GAADDPSRYSCSIVLHADEARVLRIVVDERRGVVHVLTASNDWFYGALDNIAQALRAQT
FT                   TSSHYDVSARCAFARVSGPRLGVVLAADCLVQHPLLPEGREGDVTGVPEGMAGVSCRLF
FT                   SATYAGEVVEWEAEEQDECVRVAYTESQQLRGQCARSCYVVSRVQAHPSGCAIFSVRAK
FT                   ATYSMLCGTGSAQDDATVLTRVHLVTCSDDRSVALYERRGSIASTSKHLDRSAEPQERD
FT                   WVLLWRGSGAGFARSRIFDVALHAASWPYATEGPEQPWRSCIVFVGVAGEDGAVQVVEV
FT                   NAREDGDLVTWPLRHRTQSDRWRAAATPRLVRLHQHRGHGAYRVAFSTSSPHSVTLISG
FT                   GFDGAVFAHTLSSALQHETCDMGRAVQLRLHDVMLQPPILATAKDCDGDTIEREELLQL
FT                   HPSSSSSAKETDQVRSVHVDGRGLLLACTSRALCVLCADTSAHSWWIALPTGALRRRCG
FT                   VAGDESALDWGVAATLESAVARCCVSSARGPQLSSVGCALVGTTAGVLCAVPYCYTQAE
FT                   LGGSLPVASFAAAHASRPDGDALPFTSALQAFGKITRVSVARMHEGNFGASTHALSGDD
FT                   DATARHSTDATTSEFVVATNHVYGTIVLSRLLLTLCHACSSGGCSISGDGAVGLCVSAV
FT                   WHTLIVYSDCPGPLTTALSLMPIRCGRYDAGESNDDGCGCRDGNVAISLWLLVGDRKGC
FT                   LLGTRYEVMNRALESAANPLDSHALPLATSLKAVAAVHRYVFAEHLHTAISALCAENCS
FT                   SATSVDGACVSSDTLITVAGTGGVMEYVYLHASTSSSKGEAVGSSPLPSRAREPLRLPF
FT                   EVSSVLSVSPWLWVVQCGTTVSILHRIPGHSSWVPVGSCDGVRAPRLLTARVVAASPAG
FT                   SPMAFFAHCSDGRTVERMMVKPGPNALLHPALSPCGAQTTLVHGVGFPGKDYNCVAYAP
FT                   APLHCLLMGNEDSSVALYPVLAASSGMGVSNMHSLFGCLLTPLNVCGAHHSNILAMTVL
FT                   PRTEADALRFVSVGGGAMVNLWSAGLIPSPLQLLDWWCGSGAPSPHNTATSPTDGAPSL
FT                   DVKSEGASCEPRISSARFQRRREKKVVAASTSLTLTDRIPRFMAVTALSSTDIAVGSSD
FT                   GTVLFFRVHDDRGAKCGSPQPTGTMLQLRWQGVLNTERPKPVMCLSSTDDGDRDALTRS
FT                   LNVDRASRFVVAGDTNGVVYAVDAALHVVRAHTRLEQSCVNAISELQRVLTVSPSDADA
FT                   ARHQWRFAALHDSGVVHLMALEVSAAQDGNIQTAELRRLCSASTGLTAGRSAHWPAQSL
FT                   PLVVVTEEHIIEFDPEAAQRGKLRHLRMQRVSVRCVSGAALVSEASGSKQLPPRSRVAV
FT                   VGQGFELVG"
FT   CDS_pept        complement(1983702..1984439)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5220"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26381"
FT                   /db_xref="GeneDB:LMXM.36.5220"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV6"
FT                   /protein_id="CBZ26381.1"
FT                   /translation="MGCRSGCILWLAAAALAVLTLQLHSAAAAPMDLSNPVEHNHFLLL
FT                   APYGDSHRSGATADRGNTARYVQLSNGSRFVCDTTSIKRRDPLDAKRYSLRHQMESLMT
FT                   VMRSSDHPCVHYAEENYVTVYCWDKEVREDALTENKGRSLGRRRTDGPQMYWASNDAFG
FT                   RYAATVYGDGDECQYDMGRRIETEVHFYCRYSEFENPIPYMSIHESSQCRYMLRLLSSK
FT                   FCSVSQLDHPSEEETVRCQMLAD"
FT   CDS_pept        complement(1985497..1986963)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5230"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26382"
FT                   /db_xref="GOA:E9ATV7"
FT                   /db_xref="GeneDB:LMXM.36.5230"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV7"
FT                   /protein_id="CBZ26382.1"
FT                   /translation="MFEQQSHTAAPASHRSFCTRVLSARPVHMRQRRVSAHVSGAASPA
FT                   AATRAFAVKGHSRYRRRWCGLGIAAGCFIVCLVLYVCLGNSIMFQSSAQQQQQQQQGRR
FT                   PRKYPVLAERDVMALDVATSQVTNLATLPTLDDLVKSAAELGAVYAQLLEQVAAAQEVE
FT                   DSGRALRELEVSQNHLSSVCSSLRRAADVSYAKLKAMLLQEPNAELDMAPTSLVRTTYS
FT                   WMLGNIYLYSAVLPEYYLLQDDSTSHALVLLRSINVLSWSPRVHTVPSAEMREHGAAMV
FT                   TYDLFNWSGGAACRRGRLGHVPHAKRFCESSFSSWAAVARRVAATYEELIVLYPTYAPL
FT                   RLHYAISFAFLAMDTAADVAAGDTQGLDDHSAKALKVIRSDRSKLESTYRHADAVHRPV
FT                   LALLEAFLTPVGLRTADQDTQLVTALREWGSCAEAQAALLEATSWPGGVFSGEYRAPLL
FT                   RDVQLLHLLTKVQLHLGDDHAALQTLRLCL"
FT   CDS_pept        complement(1988705..1992166)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5240"
FT                   /product="putative glycosyl hydrolase"
FT                   /EC_number="3.2.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5240"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26383"
FT                   /db_xref="GOA:E9ATV8"
FT                   /db_xref="GeneDB:LMXM.36.5240"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV8"
FT                   /protein_id="CBZ26383.1"
FT                   /translation="MLSKVTEDGAGSASVGRRIDAAIKVDRWELREDTLPVGGQALVSE
FT                   TLFSLGNGLVGVRGHAEETEAGQNRHERHRAYTSRQRAYHNSRRGDELYSDVKGRQCPL
FT                   ADGGDWHHSRAQGGGSSGGSVSGPRGPRGVYFSGFYEQRPLMHPRPFSAGISTKEGYRL
FT                   RTPDPFCIDAFLSGEHITAARGPTRNHTRRLDLRTGELHRRFVWFSNQQHREITIETRR
FT                   FVSAARKNISAMHYKMSVRNAHNTDVRLISRTFLSAAEYDVETMFTQSNIQDAMSVVFV
FT                   RTRNSCRHLVIASVETCTSRSYPAGIQTFPSREANTPTQGGTGGDTGFGTSPSGTSPSC
FT                   SASPSRPAATSPTTLTPNSRETEWGTETSYTSCISDGVIVEFVKVIGHFGDEDATTEEL
FT                   LDVATHQTREVAALGYEGLLAEHRDVMNAFWDTADVRVEPRADVQGAFRFNILQTYMST
FT                   SGDPYYCFPTRGLTGDMLLGVQQWDVDALIVPFLSHACPKKARALLEFRIRTLNEAKDI
FT                   AADLSLPRGALFPYRTVTGEKNPTPYCGAFLFVNAVVVYALKEYVTATNDTSILVQGGA
FT                   DLIFTTALVWLQWGTWEKGLFHLRSVSGPDTYNDVADNNFFTNLMAQMHLQWAVQLAVM
FT                   LRQESPEMWHGIMHRAQMTENDIVAMDQAAAKMVLPFDGTHRIHPMDQSFMRKKHWNLT
FT                   SLKDGAEGPLTSLYHPTVVYRHRVCHIPDVLLAIMLAPDSFSLDEAKADFTFYEAVTAS
FT                   DSALRLAIFSVVAAQLRLSNKAMDYFHDSLFVDIDNLVGNSGGGLHCTAAAGSWSSMAV
FT                   GICGLRVAQGVLHFNPVLSEEMDEFEFHARHRGCLVRVLVTKRLVTYTLVSAPEGVTDL
FT                   ILVHAGVNRITLRLNHPETVRLFREVRVFDFDCVVFELDSVVEDIEGVHYHAWTQTLEE
FT                   HFHQHGFSDFSMTKELYLAYLRHVKPFYGLNEIFKKYNQNPPPTGEVDDTAESNTLYGL
FT                   CCRKLQLFRSYATTHGMPMREGVLQLISLLRQYGIAVGCVSGSKNARWVINETTKGSSI
FT                   FDNFLEGKEGEELGLRWRPEMDYFEACAHRMDAATNRAVVVMDGIDGFSKKALERFRMV
FT                   VDVSPTPEETTLSIPRVLAKNLGDITMETLNEYTVRGGVVNHLREM"
FT   CDS_pept        complement(1993269..2003540)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5250"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26384"
FT                   /db_xref="GeneDB:LMXM.36.5250"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATV9"
FT                   /protein_id="CBZ26384.1"
FT                   /translation="MSFIEEMSDAPVSITGEMWMCADSAGPLKIGAGRGLKNFITIEKD
FT                   CFCAYSSRSEQSKQIKQIAFRSMKRVAWFTHHPKPSWRELAASTTAATLRRGTRKDPST
FT                   ATYYYLVLEFLRDNTIPGTMSLGKRERIVLCTDDQQDFSMWRKFAELYECPPVHEGFVK
FT                   GRDKKALRAHANADGARDHDDTTSSDDDGYERPGLGGGSAVARRSLDLWKNRCVALLND
FT                   FAHLSNPSLQVQNADVFDTPAGCGGLDWDAHVESVLHAIEEDMRPAMKVIPANSTRGAA
FT                   AGPSSLLSSPSIAPSSIHPCAVTKGTMEIDVDEMQSQASNLQVELEQFQVFAAEVGALV
FT                   EGRELKTTKILPDTLHAYVERLRKMPTPAEPADSVTKQQVDKAAASASAAAADLAKLES
FT                   ACVNAVRSFTEKVHTSALSLSQEWNREKAEQQEQAALPQRVETIVAVLIDELTRATADV
FT                   SSLKASLAASIAPTTVSPATSVPGELSELRSLLNRKELEVETLQQQHFDASRHIKQLSR
FT                   KLEELVFAYSDVAHDLLRSQYREYASLRNLFLRALRGEVPLDNSTAAEASLGASGSLGG
FT                   MSESRFSGLLSASSSGAQKLLISAAHLEAIQALEQERIAARERQRELEEVMKELEALRQ
FT                   ERDEEIANLKCNFLAAGEAWEKDVAVLQAKLSALQSAIPRGALLLPASSLAANTAVKAG
FT                   IAQKLQSTQSHTPTAPADGLESTESVTPVFAEDHTALHKLTTLLTVAPKETGLEAAVVT
FT                   QRLRAFYDWALETVVPLSTTCVSDGSVLEMITNVVHAYHALLQQTSTIYTAAKSGTDGT
FT                   HVDVLQLMRNEHEQFRKLWGILEEHLLIHEAESSVHDSGHQPSSERAALSFSSLPTMDE
FT                   LDQLPFFIDTLCTNAALYSKLKMRSGGVPIATYIQDLEKKSAHLEQQLQHKEQEEKSLS
FT                   ELIAKFHDYKQNTSPLTSTTNSALAALGVEAPASESAAEVIARAAADAAERERALRAEV
FT                   AAAEERVEAVRRQLEADRDERLRDAQERLAETAAAREELSDGVAGALAALGVEAPASES
FT                   AAEVIARAAADAAERERALRAEVAAAEERVEAVRRQLEADRDERLRDAQERLAETAAAR
FT                   EELSDGVAGALAALGVEAPASESAAEVIARAAADAAERERALRAEVAAAEERVEAVRRQ
FT                   LEADRDERLRDAQERLAETAAAREELSDGVAGALAALGVEAPASESAAEVIARAAADAA
FT                   ERERALRAEVAAAEERVEAVRRQLEADRDERLRDAQERLAETAAAREELSDGVAGALTA
FT                   LGVEAPASESAAEVIARAAADAAERERALRAEVAAAEERVEAVRRQLEADRDERLRDAQ
FT                   ERLAETAAAREELSDGIAGALAALGVEAPASESAAEVIARAAADAAERERALRAEVAAA
FT                   EERVEAVRRQLEADRDEKLRELFSKCRNYVLDMGLMEVVAEEADARVGCVIGGLNLLPY
FT                   VGTVFLCTAKVVEMSGMLGCDVEELVGRVRGLLLELNTLRGSLRGAQEKELWYEDPRVR
FT                   VPLIKLSDFVRKRDDSEDCDHRDYASVAFLAETLRSSFETLQCLDANAVALRESLSSMT
FT                   ALVKECGAALNESVVTLQMALPRAAFLDDASPSQSQPTLPVEWGLRVACRRLAATVSEA
FT                   VHWQGELMNIVMATFRSLVALSGGTGMHGAPVSDGDTPSFVEYSQLPRLAAQACSEVLQ
FT                   SRRFTSFADELADVTQQRNDLTSMVGVCCRSLRSTISVTTPGRVGSLSAAATSPTCDEA
FT                   RWTLRDITDLTSDILHHYAQSMEHTLAVLTPLANIAADPVATSSSFEMLAAVTENVRVR
FT                   IEQMERGQLQHLHVRKCDEEGSAQARGLMHDQLLTLSEVSETGELVLRSEQDEHAAPLA
FT                   DVALQQQRWDAVAELFSRFAEDVDATVSAQHGSESQNAEKAELLPLVRQAISLSASAKP
FT                   QEALQGRLSDILDACKRRASEHHSTEATVSRLSLHREELRAPVTTSEQSLEKIQAPMNE
FT                   CHKPIATMEAAPAALGQSATQMQLVAALAHAEALDFGVREGAASESGVRAPTGDGERVE
FT                   EMYLVHSRVDAMQDCLNDAEERGSSQVMDAGGLFEAAGQARSLEDLMHVVASYSLEYQT
FT                   KSLESKESRLRSEIVQDWAVKVVPLAAELRVLRAIVEGVDRPLPGTALTDLSAHGSSVC
FT                   RELTEAERLLGAAVSAPCTEEATCEALLGATDQACHLLLGAPPERALGTGTPHGVASSA
FT                   ARCPTVTAADAVSTTDVGCRTAPNKLSDAVYAMIEERGDRTAANGTLFTGEEWYCSVAR
FT                   VTQTLCSALSSAGVVVSVPGDHSLMAGHPYCASPESQASILDSLESAAEHVSKYTTDTT
FT                   RLFEDLRESLQDSLSSTESCLPTLVAAVVEEVSSLRAASQLAAEAQQHRHHELEALRTL
FT                   LQEASAVFPDTSPFLSTQSPNFMEKCMAYAEECARLTALESELSSALCANVAQRLSWED
FT                   ASLSLGDLVAELQRDRVELREVAVPQLQGLVCALSVEVLVAEERAARAIMVGEEATSRL
FT                   DAVCNPQLRELGFLVEKVLARAAKAEAQCAQKTAQHCSLLTAHESLVTTASGLVSVQED
FT                   CRRVLLESEGDASCAAVPTCFPPETLHILEQEAVLVPRLVQAHGRLTATCAALRSDLDS
FT                   AKAAYEQALSDGRADLDIARGRSTEVEAQLEHVLDAIEALGSLLCPNEEVSLRDASCLP
FT                   CLLEASRQLARTAAEDAAARCRLEKDVCDAAAAFAELQRQCAAAAGNVEALQETVRRYE
FT                   RKETDEIATLKASAEAAAEAYAGIVTALCLSAELVPSAGSAAAAVSEEQWVAVVEAVQA
FT                   TVEEGWRQTSDAAEVRGEMTILQSRMVEVKAAVLGAEAREGNLLQRLNALMMSSGPLKE
FT                   AVTAVMASHECRLESLEDVPLAMHAAVQLVERQQGNINQLIACCRDLRSDVESLNGRLC
FT                   GAVGECDMARESLASLEETHGMLQRRMAQLERHVRDTISTVDRRAAAVLGEAESRRLDK
FT                   DTPADCLDGIAYLADALACRAEECDAAKAQLIAWKTEARDREEAKVRATTTLSTLWQAF
FT                   RRALLPQLVDESEDPGDCGEAAVTSADGVEFFASEAEVRRAAQMIVDTAERLRRTRGDL
FT                   QAVYSTLRDHFGGDAATAVNGVTTTPHAPARALNKSGVTSLRFDDTVTATLHLVNTVVN
FT                   AKCTSVKDFIDHVVSDVLRDTSVSARVSFAALRSGAFAEWLHGLLTSLRTLRESSDQHR
FT                   DRARRLPAFMDALVEAIHSHGGRVDVTSSDATGALTIADARMPYRHDPTTTLEDWQARE
FT                   QRAIVHGLQALLNQQEERVRALTAEWQYVTTQYHQLSQEQVAAEETIVELRRRVQFKVQ
FT                   EDYKLEESLRELDSHLDQQARELSMRYFADQDAIVRRFTLLRNQIHAAMRLPTRRSASA
FT                   MPPRTPGRDTSTPRS"
FT   CDS_pept        complement(2006453..2009002)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5260"
FT                   /product="putative adaptin"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5260"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26385"
FT                   /db_xref="GOA:E9ATW0"
FT                   /db_xref="GeneDB:LMXM.36.5260"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="InterPro:IPR026740"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW0"
FT                   /protein_id="CBZ26385.1"
FT                   /translation="MNGAALIEQATFVTERAWEYASNTTSVFHKARSLVAGDAQFFSVA
FT                   PRVDDLRRSLSSESLHDKRDGMKRIIAQMCKGGDMRHFFPDVVKNIHVPSIELRKLIYV
FT                   FIVYYAEDCPNETLLSISAFQKDLLDPSMHVRALALRMLASLRILAIQPVVMVAVRKCA
FT                   EDMAPLVRKTAALALVQMHTVARQELDRDTVRQLLRTFLSDRCPDVVGAAAMAYTRICP
FT                   DEWDLVHGVYRRLCRILKDCEEWGQVVLLRLLLRYARLHFVDPSGPFAVKTARCSRGSS
FT                   SLSGEETDSDDDDATSSSRSSFNMTPSRGRGAKTSNAAADAQVDPDLLLLLNSTRPLLW
FT                   SMNSATVVAAIALLCHCGTRHFQEACVKPAMRLLNTCAEGHTAVLHVIYALLLLQRDAF
FT                   LPYLKSFFLLPLDAADVRHTKLRILSRLVTPATWTEVSREFRSYLHQYNDAAVVEAIQG
FT                   LAQAVQQYPPFAAHTVRLVTPLLSSRTSSPAVVAEAVAVLRVLVLQGTDPVCISRLACQ
FT                   LTLDIMDQRITESSAVATILWLTGENISRHPSMAAAAPDCFRVFAKRFGGLTSEVKRQV
FT                   LTLGCKVWVHLQGNSELSERLKRVYHYVAELAKYDDDYIIRDEERLIEATFDRQSDTFA
FT                   GVQTALLREKPLPDVNDPYADRAGLEIGTFSQLLGSTVRIYDPLPTWATEATDGALRRS
FT                   IEEMNAAAAAVTMFESTSDEEESGSNSSSGTEGDESNDSDGAASSSDSYEYSYRGSSDV
FT                   GDVSGKSSSASGGDAAALSGASAAQKVARGTGTVKVSPPKFTVKVTMQSAPPPTLPPVL
FT                   AQVTVKAAEKTDAVPAVVPELPPSPETVMELHSAVEA"
FT   CDS_pept        complement(2010311..2012521)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5270"
FT                   /product="endonuclease/exonuclease protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5270"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26386"
FT                   /db_xref="GOA:E9ATW1"
FT                   /db_xref="GeneDB:LMXM.36.5270"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW1"
FT                   /protein_id="CBZ26386.1"
FT                   /translation="MFLISWNVAGWSSTSQAIRESFGSIHDFFACTDADIICLQECKGT
FT                   LAKLSASPVDMGASDLPLSRRPVVAPLERLEAQQKRRRLSGSVEGCASAVSSGGGGGGG
FT                   GSNDGIDGWESFWSLSGKQHRGFNGVVTFARKGLTWRCDSQPFSEDEFNEEGRAVVTHH
FT                   NAFVLVNVYVPNARGGARHTFKLRFLHALEKKMEQLRQDTGKPVILVGDLNMTYCAHDA
FT                   AWSLRRIHLGTLLQLQAFAEVEGDTAWTAALPHLSKAAVKRVANMIANHLCAQAQEIAA
FT                   SMDSAATAASSSGTGVVSVDTEVNSSDNTIDREALQRLCALLPPRGSSGAGKGMHNYEA
FT                   PPVSLRALYDVGFRCAYTSDFVKSSPCPHNSELYAVVHFCGLAPHSDASAEFMGRLLQL
FT                   RLPVSSSAMPQRLPWTAATDVAARQAGISRVRMWDTFLLTREMIDAWSTAPADSPLIDL
FT                   MLLREVERPRLRPYCPCPYTCWDQSRNRRLENEGTRLDYILVDSALLPAVVCRAETVNN
FT                   VFAGVPERNLSASFAPGSSVDREDFFSELHGTRYRDGVMRAMANGAYPPAPFDGTGMPA
FT                   LCEQARELCFAGLPSTGLFVTPPQFSDHIGVGLLLDLAALGTESELLQRSGKVVEDHKC
FT                   MYRPPVGLHTFFAAAATKKATASVAKPSVQREMAADGQGVREAEERVAGDKRAPDSCAS
FT                   LSSFNSSTNARTEPAVAKSRTEDGAVVARGDAEACIIDVDSL"
FT   CDS_pept        complement(2013340..2016495)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5280"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26387"
FT                   /db_xref="GOA:E9ATW2"
FT                   /db_xref="GeneDB:LMXM.36.5280"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040362"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW2"
FT                   /protein_id="CBZ26387.1"
FT                   /translation="MDLTSSSAALGERRELSEQEVLDWLSRRGFAHAHAALMAETSSQA
FT                   LTNDDSPARQRFVRDGALEVTANGAIPTSAELQAALRDSVVEALSAYRDLARDDNVLTL
FT                   LERWDPQLCSLYVQRAEKRSEEDRSSLERWAQVAEESNAQLRTRERELDVQMKQTVAII
FT                   AERLQTLASSLDPMRKDILLPLLRTVAVLGSSGTVRAAARHMMLTLYKRPMMEHRMAIV
FT                   QEWLRVAQEAPSRTLEQELIPELYTLVNAQAFERRLLALDCAAAVAPLLRHSPQVRYSL
FT                   CQGLLRPLCEDDTSAVRRELPRCLSLLWGDATTAGTTTTMNSPASAGAILRPSVGGGLP
FT                   AETNTVHSSTAHTSVEGLPGAITASLSPTQQTFFMELLVHLATDSNSRAVRQAAQTQLC
FT                   EVLYPVFLRDGVLLTQFVPLLLTVMEMEATQWLLRKGVDKNISSAAALGSANAAHIGEW
FT                   QKGPTDESNASAAAALSLSNVMTLIQLLHAALRCVAAELLHSREAEGRRDRCQASDGSQ
FT                   TSSSLSSAYVRVVLPIAYNLLSSLLSKVHLASLTTGGEGGAPSSSDASTRLCGPLCALC
FT                   ATLASLVPLLGAQVWQEVAHYLKGPLASGPRHEVEAAAVGEGTSELTAARPPPPPLQPL
FT                   PPQSAMGASLTQQDLERGQLLFVFSFFLFLCGDAVTLPQGGTGASAEDDATASERKRQT
FT                   TDMDAFTPSTPPLSESLTPKRIRRESLRFVTWSISLESEDVSCPRSAPLMACIRCVAAL
FT                   TPLAMASHEMGSGISGLVRFLVASPDVRQRLTAVVLAHDTCAVLASERLKVVLLIEPLL
FT                   PLLEDPQPAVQEAALSGVLSVSVALTEPRAQEKVIRPVLRVADATGCTSRFTRCLLQQL
FT                   YQLMQRMPAEPREALLYPQLSLLMDHLAELCVERVSQEVFSAAPAAARRSSMASTSAGA
FT                   RIALQGSAGSEQRDLGEYDWEDTMLVLNALLNSIVKCAVVTPTLVYRYLLPGIQQLSSD
FT                   GILSACSPSLRSRWLRLHKNYQVFMENNNASRLASSGAASAGGKPKVGTLLDRFKHELK
FT                   RRL"
FT   CDS_pept        complement(2018082..2018669)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5290"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26388"
FT                   /db_xref="GeneDB:LMXM.36.5290"
FT                   /db_xref="InterPro:IPR039963"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW3"
FT                   /protein_id="CBZ26388.1"
FT                   /translation="MYTEKDSYAPTKVMTEEELQRSVDRLSRSDRVKVELKPLAPCSVI
FT                   TREALDKRIHHLYDESLERRQREREEVARQMDAAIKKDTTITVTKITPLEEEALVRHLY
FT                   DETLATKQRNFDELYKQVTSHYERNTKKLTAKKHLTAVDRLYREGMERERNKHIALYEK
FT                   YVVARQLPPPQRTAAELAASADKMTRGEGLAS"
FT   CDS_pept        complement(2021055..2024387)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5300"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26389"
FT                   /db_xref="GOA:E9ATW4"
FT                   /db_xref="GeneDB:LMXM.36.5300"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW4"
FT                   /protein_id="CBZ26389.1"
FT                   /translation="MAPNLAGTTVQSIDRQPISRPSLRSYGRQNTGAHRSQSRAETLAV
FT                   HLGDVEARTYLVEVLQGEASPLESLLKAYPGCVWDGSEFLLLPLLDEQREPSEVLPSAI
FT                   AREPTVHVRGAVEESDTTASMDNAPPLGFGREAADEMVLPGMTTFLCSANASFDGAGGG
FT                   GTVPGATPPPSSQASVPMNGGDSVVNSAGSAARNTMGMQAGRLTTTAVPVVPCWKRFSV
FT                   TAALYLALGDAGCCDVAHFPYAAVQLCDWDDLVGQQRIRIEAKVSCSAAAISALEKGTR
FT                   GRRARLVPVAVLLPTSRKGVMRRPLSLTTQPFTDAEVFQLFYLQLLFRAYFDVRFRGMT
FT                   FTPPGQAARHLRSDLVAARSSGSHHVAFEHPTKNDEWLLFPAHTRLLTLLNLEEAVVPL
FT                   YATPAELQETFSLPLFGAGETLPCLGVAGRDAAQWAATVEVSSPETAVLALVALFDKMR
FT                   DQFGCTRGELWRRATGDAHGGALPFAPLLFRCGELTAGASLQLNGVTLSRFFVPPSKQA
FT                   TAGSGAPPAGDVSADSPPSGSLLSGIPAVDSAHTTTDSPTPSLSPRPLLTEIGLQAATS
FT                   TTMDTVTEMVPDAGGTRASFDGDQDRDAGFPSSSDAVELAGTKSSEEMLCGSKSVPPVL
FT                   VHLGSVHNTAGATSAQSPNIVPALVSTVDSDQEEDAEKAEAPPLCVVADFEGVRLDEVT
FT                   TTCSELRSASSVGPSSPFTKRESLITRWRDYIQNGNCAIFTGATTDIEVLRFLGRGGSG
FT                   LVYSGIYGSQRLPVAVKVFVIPEGMDHEQYVRESLTDVAFYVLLNELEDFAVCYGGRAH
FT                   DFIVSQQTPKGLPAETAAEARRGDDDATIKLCYLVTDLMDGTLGRFLTEHDADFDPLYD
FT                   QLVNSPLRDGELFQFLFIQLVTKMLFDWKVLDMMLNNQLRGDNIGYRYVARPPAQIAHL
FT                   RESPEEAVALAGSRQYYAGILYGFQFGPDEPLHYLRFPAETGVANHAKLGPLRFICIID
FT                   VGQGIQPNVAELVRNRFIGETVLDSCVEDDGFGRYWPLNELYCSYVDVEGTLAKDVAAW
FT                   GSARRVATKEDASQALRELFEYFYPTFGIEAPTEEELHTYLCFSWTPTNLGHLKAADVY
FT                   RGE"
FT   CDS_pept        complement(2026572..2027687)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5310"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26390"
FT                   /db_xref="GeneDB:LMXM.36.5310"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW5"
FT                   /protein_id="CBZ26390.1"
FT                   /translation="MWTTSVALVSKRSMKYQTKLRHRFRNPSVLPLKQTKAQRDETIRS
FT                   VLQVRNINPANQSSYRYVEQRLYSTGSRLDREGVKLNTTYALQGLGDLEPLRNSKSFGF
FT                   SEREALKYDSLQQAAKYEAPPVPFTPLAARKLAEGKLWPSAPEPDGMLSREVRYLRHRA
FT                   NMSPSAQTFSDKIAYHLRRSLKACPAHIAEQMDFAQLIIEEVIASRRSKSVYIVWATVD
FT                   PAARFAMEPQLHRLNHWVQRLIMERVRTRPNIPQIAWICNGGRLERELPRELKEEMQAY
FT                   ASDNSSTLEMRVRYLKEMDTVNQRMRNIPWFMPYLWSKEEKAGKTRRMRKDLEEYEQRC
FT                   LAAKKDQRESERDMSGRSVAPQIGAPPAYVR"
FT   CDS_pept        complement(2028512..2030449)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5320"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26391"
FT                   /db_xref="GeneDB:LMXM.36.5320"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW6"
FT                   /protein_id="CBZ26391.1"
FT                   /translation="MSGRPTATPFRVFGSPYTLSLHQHVTYLRLKQLPFRVYCRSFTTT
FT                   LLYSLYYRARSVFCTLTPSGSSPLQVWQLAEVAELDEDVEAIARSAKGEVSYAGKDRSG
FT                   RCGVPHVSGAATAAPRTQRLLVRKETHPQLHLASWCVVVYTCWWLAKTGAMFRYIRGDA
FT                   LDVLEGYVRYFFPIPGIGFARSMAPRFREAMKQLLSATGASEVTAPFMEDHFQRFCAAL
FT                   EAHLREHPNEHFLLCTPHPTLADVTLGAAFSSLFLMDDPPSSMLADKFPCVTEYVERVT
FT                   GWSGATFVGTTEDVALTSEDASVGSAATDTDTIANSFAASAADRNTDYPDTVPESLAPC
FT                   FELITEVLPFLMSQCASFNAFMAGDGVRTLRCEPLEGEWKGCTGYLMPQLANVRSLMIV
FT                   DDNISSVQARSQDLEIAFLAAREVLDDTLHDFGRREDGSHSASPHDLNARGVNEPAPHT
FT                   SAAAASGIAQNTAASAYRDAGDSQHLVPALQECAAVNGAATRTEESEPRRQVVEESAAQ
FT                   FREPLDPRTMRAEEADFYRAYTAATRHNVVGTAASLSDVVPPARQATSTGSTAVVVRGP
FT                   VKEHLQTLYEMLAKMSCPQYTLTSLHHGRRIYVAVIPEYEVAKVRRARQEAAKKSTAAS
FT                   SDVEYVTQLG"
FT   CDS_pept        complement(2032045..2035275)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5330"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26392"
FT                   /db_xref="GeneDB:LMXM.36.5330"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW7"
FT                   /protein_id="CBZ26392.1"
FT                   /translation="MSADARAPLLPSGTEVAVEKCFPVDDAPARSADCISWGPHNVLQV
FT                   CTRWAVSMYLASLLTPACQRSVCHHPLVHRSDVESVEVVVGAKWSTALLPEVYYPATAR
FT                   LCVQTTSNLVVYRVSRHGTSRVVASHGIGIACSRGGLAQLPAHSDSTVAVASPSERPLS
FT                   RFPAAERPSIGKRNKGAAKTSVKVTSKSKAKPAMKKTSAAARRKRRRQGSCSTANSSSD
FT                   DESASSSSSSDASSSSGSQPLASRFAPRSRMSAAGAGKGSSSHESAMPTLVGVGNPDRE
FT                   RTATDAVEADSASTENDDVGSVVDYMWLDQDDLLVLTTQGLHLVALAGNLLDNDGPVTR
FT                   SLPPPLYRWGGEDEVAQLGFRGPAPLCMTHLFTDGLVASTVTAAALARLRRIVVVASPY
FT                   MLRVIHVTRSSPANAAAEMHLAYTVEVPSLTSVPTSVCAAAVRRTGQTAARAADPPPPG
FT                   PEVDVVVFVSAPGAVLRGRFALAALSSSSESALPSSCRRIVFQVDAHYGSDILVGDVCL
FT                   RRLMVVPFVADSRVAGANVGDEGARINSSSTELDDAAVAILGIGEKSVYEFLACGPSST
FT                   VLLQCPLLAGCSEMPPRRCAGIAGVALHPSGTLAVAAVQTGQANHEPTHLWAVSVDTRG
FT                   GWLRRLVELGALVPDAVAGKPHEDSAFGGTVEAYEASGSIVQSMLLQQASASFFLYEQL
FT                   LPGSVVQSSEIHRYAQAHQQARQLPTKEMLHDYRRSMMPGCVASSRMPSLADMPARRRY
FT                   MHLRTQYGVDLFLRWPLQSPTVAGDAASGASSVFASPPSMEAMQASWPWWRLLQHIWAI
FT                   CPWDRPVLSELVLSSAVQILAKRYRYASMTLEGSESLRDCAATVAESARCSTKPDALDV
FT                   DGAIAFMEAYIKAQKIAVRKANRSTQAASFSSLRLITAADCAEPAGPGGDNETPPRKAA
FT                   RDASQLAAQVHWCVSPSWVSSLEAFLEATAYSHRRSAGVSSAVGGNVSETSLPHLFPCS
FT                   LCDRPACVPLLLSLSSTSTHVPAGDDPEVKRGASATTPASHTTLFSGSTLSPLSFFSED
FT                   YVLARCLACGLSDFADGPWCRVCGGMLE"
FT   CDS_pept        complement(2037420..2040011)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5340"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26393"
FT                   /db_xref="GeneDB:LMXM.36.5340"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW8"
FT                   /protein_id="CBZ26393.1"
FT                   /translation="MPAKKTGRAKSSLALAAREAELAQEAELLRQETEKGRLRNEECEL
FT                   RHLIEEEWRKLLEAHRNRERDVRNTLAEVERKAYYDAKEREMAASVAQKVQELQEAQAT
FT                   LALKVQENDLLEKDKTSALRRVGLLTNELELTQLRHTDSQQRMAAADQAHQEAQRKLEA
FT                   EYDALQQAHQELEMKCATLELEKAKAMSAAEATAAAAAAEEEDTRAKKSAAVAPSDDEE
FT                   TVMLLRVMQAETERYKATATELQEEVDHVRKQEEKSNLLVGILNTQLESVREDNKRLHE
FT                   LAQKRQAELEAAGQLRRDAEAARQSALTEMMEALSAAAVQQRQLELELGVHRTEAEKLN
FT                   VELSEARQECVALKGELTSVSHKAAQQAQTDHATNTAMQAELANQKKDLEIALKAKETA
FT                   DDDKFNHKILTRAEIDSLKTRLQRLQETMERKDREAFETIAVLKADIAKQESASAQLLR
FT                   EHELDMNALRTQLTTTETERSFLRSTLDSLQESSTKREHELYEQLTEVTARHTTASEEL
FT                   ERLRADTARKDSEYIHNTIYLNAECENLRTKISEMTETATQQRRIHTNHVEELRVEAEQ
FT                   LKSRLTEEFHTEQSAHAKECERADMAERNVRRLQERIREMEQEARLAGLKHDEAVKALQ
FT                   AESRDLRCELLIAKRTIERLECAIGDQAGYRQLTELNDKLTKELQAYQRNVSTLRDKTV
FT                   ALQVEAETMGGYKVKKAQEEKELMERQLQQTERRYRLLVPLFAQLRDLVENYLASYLHP
FT                   ELYAALKDYDRQTSLLPFNSTKGSFKDAGAALDTAVTAATTEITAPAATAALQERCTAT
FT                   TPAVLQPRRPSSSNTACTRLLKNHSIRSSLIVTGTDVDYAACGRLPPISNV"
FT   CDS_pept        complement(2041782..2045549)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5350"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5350"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26394"
FT                   /db_xref="GOA:E9ATW9"
FT                   /db_xref="GeneDB:LMXM.36.5350"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATW9"
FT                   /protein_id="CBZ26394.1"
FT                   /translation="MSHFCGSLSRTPPRGGAISMPRDLSQTPAISRLGSTVKTPHIQKC
FT                   VVDQAEDDDHPLEHMTVYFEEEELRVVTTGLLGKGGFGKVFDAVSNSGEAYALKVSSKR
FT                   MSENDWKRLKEEVTLMSHFSRHPNIVKFYGAGRDEDRAYVVMERCAGKSLHDVIASRSL
FT                   DVPEILWIGWALVNTISYIHSKGCIHRDLKPQNLLFDNEGNLKITDFGLSSRISEAHPR
FT                   KTVAGTAMYMAPEMATEVYKRMTKNSEAPSLSYGKEVDTWSIGVVLYVLLTRMNPYLEA
FT                   IEQKGMRQLDKEHKSLALFNAVAGAAWSWPREWRGDPQLCGLVERMLHREPSRRATLME
FT                   VLEDSVWNRRPLSCPLSLLQKLNLLEPSPSSGLPLNNLAENLQFRPKRSAEAVLREGLE
FT                   RVEATEQRGRAQLELEYYETYNVLWSLLTLARAEEDARADILQSEEVQRGKLRNQSLAR
FT                   QSARRRCGSVSLVSEVADREEAAPRTSRSVRRSVSLTEQERGRLVRSSPVQYAVVYPGR
FT                   DTATRWNLRAVVSLPRDMTDEIEREFKCMNGHVMTKLTSMPHGYNGFDCNVCDRGILTI
FT                   TAESPAFRCYKCDYDVCMKCAYSGKFKDVNFVCVTCAKRFTSTAKLQGHSLRCRGPSES
FT                   PSPRRSSRMNTMLWDEPKRPSLLEVQLPEAPQSERKLRASRCRSGRPTYNRTSTGGRIS
FT                   IGDSNAHSVVDFDAMVASHREADFPKVSTRASATGRESSQRRERTGSGRGRPSTSSSGS
FT                   LSLDLPPQVQVPSKESRPQVQPRSSAELRDIMEEVEQRKQALPRDPLLSAPATPPQYNC
FT                   NGEIIGISARRRAESLEMARAEVITIRAEVADRPRELQHQPRVPRSASSSRAEKGLPSP
FT                   HKRRREEWQQPAHAPSPSGTAKRAAVEEHVVKQAIMPPQVPRGRAQQPRAPSVSGHTAQ
FT                   GGPPLPRRGPAAPSPAAALKAHLSPFQAPAAIPPKNFASILQSRYSMTNAMAPTCNTST
FT                   TRPAGGAGAATAALGQGGAPTYSHALSRPNGAFLALPREERNRQQFLDDFLSGGWVRFY
FT                   SFTNEDTVVMYYSLQPGRYGAMFPTEAGVGTAVLDVYSKLVLYVPCMNNESTNRSQPHP
FT                   HVQTFYDEEARILSLPEAQRYLGGVLRCITGFVDEFSRLKAEGLTPAAVHAAYIHHRSM
FT                   SHVPRDTKFVYIRKVFPDPAGSFTLFRLSNLRSQVVCNAMVDIRWQSDRRHNVGQKYYI
FT                   NADGTAEPFLVDQTGILSQLETVLNNNFRR"
FT   CDS_pept        complement(2046447..2047313)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5360"
FT                   /product="ubiquinone biosynthesis
FT                   methyltransferase,putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5360"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26395"
FT                   /db_xref="GOA:E9ATX0"
FT                   /db_xref="GeneDB:LMXM.36.5360"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX0"
FT                   /protein_id="CBZ26395.1"
FT                   /translation="MLHYTRLGRNMGLGDAYVKKIFDSVASKYDMMNDVLSLGIHRVWK
FT                   KHLVEDCVCPLPGGKFLDVAGGTGDIAFRITDSIRAREQSFDMVPKTLDDTKVVVCDIN
FT                   AMMLKEGQKRAEREGYMDIDWVCASGEELPFEDGVFDSYTVSFGIRNFSDRPKALREAF
FT                   RVLKVGGALHVLEFSKVTCPLLSVPYDLWSYGFMPQAGRMLADEESYRYLVDSIRAFPD
FT                   QETFAQMIRDAGFGYVRYENLTGGIACIHTGVKTTPTPITPKTASDILTQNASEATSEV
FT                   KPEPNSA"
FT   CDS_pept        complement(2047768..2049405)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5365"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26396"
FT                   /db_xref="GeneDB:LMXM.36.5365"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX1"
FT                   /protein_id="CBZ26396.1"
FT                   /translation="MQTTLFPFIGSAQRVALPIKRETEATKDTMKQRRDGEYADSYPVG
FT                   SQVAKTLASQLRHLRPHLCSGFFAHSKYGRRSHPWNAFALGKPPAIRTVVSSLHPARNS
FT                   DDGELLVSPVDTFRNSILSTAWDPRDEYIIAAQRSGFQLFGASSWLEDCNVPCETSKPV
FT                   LELKSTTVQARLGGENRISFGLLVAQFLGSSLNTICGYSGAQQLDIFDLEDLDEATGEP
FT                   LRTYNLRALQFDSCCPLVNGISATTAVVTVSDTVAVAALSNGCTALVDVRAASPVLCTE
FT                   APPPPAILSACNPGTRRVAQGTAITAVEVADRSNCVQLLTGTKDGMLVLWDLRKRNEPV
FT                   AISSVGGEIEALHVIDPSLSCRCGAPTLWLNTDSGNIACFSIGVSSFEEVTRVSTSDSR
FT                   RTQLSASLSPPKLSVMPLLDCLIYPHISSNSILFYDIGRPISAAESHSTAGVSKCSLTG
FT                   AQKNKQTSFMGDFKAARVLLPERESDDDCAFLPSDLKKSTWSPSLLFSCPFSDWSHQLC
FT                   SVSASNKHSTICVGGDDGDLHVLFDSAS"
FT   CDS_pept        complement(2052527..2054008)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5370"
FT                   /product="putative tyrosine specific protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5370"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26397"
FT                   /db_xref="GOA:E9ATX2"
FT                   /db_xref="GeneDB:LMXM.36.5370"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX2"
FT                   /protein_id="CBZ26397.1"
FT                   /translation="MREKKLKEKQRFDVHLRRLGERVYPSIEDGFDRELAKLRRVDAYV
FT                   RSNLDEYYSASLGSSMAKNRFPDVKPNEGTIVRLDETSSQGDGTYINANYIDARERFKV
FT                   PFVYIATQAPLKNTVLDFWRMVYENDSAFIVMLCAVKENGKIKSETYWPSRGATYDMGV
FT                   LSVTLVAENMRPDSVHRRLLLRSVRGAEKEVYHMQYVAWPDQGVPQSSVTLMEMINTIA
FT                   KSPRSTQSPIVVHCSGGIGRTGVFIGLHIALAQFQLGHANINIPCIVRHLKACRTGMVQ
FT                   RKDQYIFLYYAVQREMERMILSQKTGVNLLDSRPRLTAAAATRAEPAPTQITSPLIMPM
FT                   PVQTRGWHVFSIPKPLRSSTSACPTELPSAPIQVPENRNAEDDAATMENYLQRVGSSPS
FT                   LGRSPSLSNPVDRSFSMEALHHPFRQTSLSPTSLSNSITREPEIHWRPVDTSRSSPSYM
FT                   SESTAPLLRATSLLQEELARQQQANRVKRFSPSFV"
FT   CDS_pept        complement(2056663..2058237)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5380"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5380"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26398"
FT                   /db_xref="GOA:E9ATX3"
FT                   /db_xref="GeneDB:LMXM.36.5380"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX3"
FT                   /protein_id="CBZ26398.1"
FT                   /translation="MLRSTLRRLTKPNVVVLGTGWAGCYAAHHIDPNLCNIHVISTRNH
FT                   MVFTPLLPQTTTGTLEFRSVCEPITNIQPALAKLPHRFLRSVIYDVDFDEKQVKCVGVG
FT                   VVGGSENVPVNTFSVPYDYLIMAYGARPNTFNIPGVEEKAFFLREVNEARGIRKRLVQN
FT                   IMTANLPTTSIAEAKRLLHTVVVGGGPTGIEFAANLAEFFREDIKNVNTSLLPYCKVTV
FT                   LEAGEVLGSFDTALRRYGQLRLNQLGVEIRKTAVVGVTDEEVFTKSGEVLPTGLVVWST
FT                   GVGSCPVTKALNCDKTNRGRISIDDHLRVLRDGKPILNVFAAGDCAASNERPLPTLAAV
FT                   ASRQGRYIGKEMNNLLKGKQMSKPFAYRSLGSMASIGNRSAIVSLGNKFKFDLNGFTAL
FT                   WVWKSAYLTILGSIRSKLYVIVNWAGSQIFGRDITYIGDLAEDRMYSALAVEEVSKEMS
FT                   RKAPEMLHAVNPESIYTPAVEKEGANKRFLPRKPGESTPLAPHGQAMEGSQEAHAAPAA
FT                   TSTEPKM"
FT   CDS_pept        complement(2059865..2060941)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5390"
FT                   /product="putative phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5390"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26399"
FT                   /db_xref="GOA:E9ATX4"
FT                   /db_xref="GeneDB:LMXM.36.5390"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX4"
FT                   /protein_id="CBZ26399.1"
FT                   /translation="MESCNSRNGSLRVVHGNANPKLAEDVCRYLSIPVTASRVGSFANG
FT                   ETIVKILESIRGDDIFVIQPTCGNGAGTNVNQAVMELLLIIHTLKLSSARRVIAVIPHY
FT                   GYARQDRKHTGRVPISASAVARMVTEMGVNGVVTMDLHCGQIQGFFHGCPVADISPSSE
FT                   FAEYVKQKNFTPNNLVVVAPDAGAVNRARRMCDRIGASRIVTILKRRVVANQIESMQLV
FT                   GEVDECVCIIVDDMIDTAGTLCKAAEVLKEYGAKEVHAYATHGIFTDPACERLTQCDAL
FT                   VEVVVTDSIPQEESRQKCKKIKVISIAKLLADAIYRMHSEESLETVGQPEHFMPKHEDD
FT                   LQVLESLVEEDEWSRCNE"
FT   CDS_pept        complement(2062100..2063905)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5400"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26400"
FT                   /db_xref="GOA:E9ATX5"
FT                   /db_xref="GeneDB:LMXM.36.5400"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX5"
FT                   /protein_id="CBZ26400.1"
FT                   /translation="MQRYVRVAARWIRAPVSQHSSLTRCGAYSAHQALRVARRHFGMPH
FT                   PSDLLTPPMGLAALLYRRTGNVGSVPLGTASPTPDGSDPQPRRGRERRRARQQQQGGGG
FT                   PSSDRSSDQERHSGEDGKTEPSSSAFGSKQATTLAVAVFLLSILWDLFTAQKSVMWHAI
FT                   KNTCVTTLEVRSSSQEFAMIMDWMGRQPRGQRIRNLGLKPITVQDEQKTVWGEMPSPLS
FT                   GDVAATADVDARVMLVPGYGSHLLRFESTWIYITRAEDPSKQKAAAANRVDRENDKLTL
FT                   TFFTRRRAVVQQFMTHVQESWRANVRNTVHIYLSEGYGPRWHLLSERIRRPLSTLYLPA
FT                   DTKAVVEEARLFLQLKDTYAALGIPWRRGYLLEGPPGTGKTSFVMALAGELGLPVHILS
FT                   LRSDNMDDDALLSLTSSLPRRSILLIEDLENVLKTPPGTGRSSLYPSGSDTPAVAAAET
FT                   SAASPASPYSTDIGGGPRSAMSLSALLNALDGVSSSEGRLLLITTNDTSRIPFAEVLLR
FT                   PGRIDRRIRFQPLHAEQLREMEASFQQALQGSPCSAVENLRLPSASLSAHEDDHSVACT
FT                   PAQYQQRLLDAVYASLTSGPRAESK"
FT   CDS_pept        complement(2064234..2065430)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5410"
FT                   /product="putative selenophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5410"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26401"
FT                   /db_xref="GOA:E9ATX6"
FT                   /db_xref="GeneDB:LMXM.36.5410"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX6"
FT                   /protein_id="CBZ26401.1"
FT                   /translation="MSHKRPQSSAGKSNGAADLKKPRFDPVSLGLPAEFQLTDYTRLKG
FT                   CSCKLPQPKLLALLQELSTTPGQKDVGVDCSIVPLHHTNSKGEALFLVSTTDFFFPSVS
FT                   DPFLQGQIGAANVLSDLYSMGIPDCDTMLMLLAASTEMDEHERLITTREIMKGFAERAR
FT                   LATTTVTGGQTVMNPWPLIGGVAMAVVSEAEMVRPTGLLRAGDILVLTKPLGCQVAVNL
FT                   KQWLLRPSPLYEETIAGHISPEEIEELYNMATDSMRRLNREGARLMRKHGAHGATDVTG
FT                   FGILGHANNFGAAQTVGDAPRSLCLVLERLPMFKTAVAASKRMNDKYRLLEGYSAETSG
FT                   GLLVAFPSTTSAEAFCAELTEIDGGCPSWIVGYVEDRAANALDGVYARLKDGCEIVEV"
FT   CDS_pept        complement(2065955..2066824)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5420"
FT                   /product="putative branch point binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5420"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26402"
FT                   /db_xref="GOA:E9ATX7"
FT                   /db_xref="GeneDB:LMXM.36.5420"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR032570"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX7"
FT                   /protein_id="CBZ26402.1"
FT                   /translation="MPKETASRWSESRYTNLQVPSYVPSEALMHEDGQFLRAFLLRVLA
FT                   NDMQRMLATNTCAAYFRNIPLEPEYDANGNRTNTPENVVMEKRLHVMDDISKLLRTYVE
FT                   RAEYAANKSKDINRRIYFTAEQIETGDYGALIGPRGLVHQQLEKETNCHIVLVGRGITN
FT                   PLKDTNPNAAAMALEDPHVRITATTEEDLQTAAERIEWILSDEPEAVEFRENNRRRMAQ
FT                   VDGRYDPRTWMTAAEKRKKAAAEKAAAAGGAAAGEDETGAEKGRKREREEAPVEEEDTE
FT                   LNEFLEDL"
FT   CDS_pept        complement(2067311..2068471)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5430"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26403"
FT                   /db_xref="GeneDB:LMXM.36.5430"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX8"
FT                   /protein_id="CBZ26403.1"
FT                   /translation="MWRTTPLCCAVAAATVEKCLRDIHHGRVAAALPRLNELKAASCTV
FT                   QGIDYARALCFLVDKEKGNLLAARQSLLEELRLHPHHHEAQTLLHQINNTARLLLAPPT
FT                   EVRKQYPLFALLFDALLDSTMLTWPRLLHLYQATDRLARLGTKSSASGDAGHVVECGTA
FT                   GGGSAVLMAVVLAEAEVSSGIGTSPKRRVFALDSFTGMPPPTAKDCLASAPVGTSSSSQ
FT                   LKPQRSRDEATVSWGAGTCRSPAAHVQQLARHFSVEDRLVVIEGLFTDSIPAQLLSRSD
FT                   VQRDGIALLHIDADWYASTRTALELLVPVMRHRKADDSGVGVGPCPQRVVQVDDYHYWQ
FT                   GCREAVDEYMAKWGVAPPHIDDVDDNAVWFAVSRDGGDVTHSTACQ"
FT   CDS_pept        complement(join(2069249..2070321,2070425..2071178))
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5440"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26404"
FT                   /db_xref="GeneDB:LMXM.36.5440"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036241"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATX9"
FT                   /protein_id="CBZ26404.1"
FT                   /translation="MSNGRRRASKPSGSPQLFRANPPKKDGGLSDPLLLSPDVLDDATR
FT                   RELLQDVLRHRRASPSSVDRPSNPGAVPGDAHSDKEPFAHQLRTRVRSGSNSNSDILVT
FT                   AMAARLKDLESQHKAYQAELKELHAKYRQLNDKYQRERQLREEAETAVLTLYDEKELLE
FT                   AELREMEAAHACASSAKSNHPLSPHNRAEKFTQDTRASPSHSPPTPSRAVKADLFSGDF
FT                   TDGSTNDGAKATEKEGPTHFVNTARPDTVQKAGGLPSNRQAASAVAGSSAQPPCRQYSV
FT                   SSMDMELLTKNARILSDYVGWKGVFKQGNQAGIRERDVVRVVVYKNGICVNQGPFRPYG
FT                   WALCDAFLDDLIEGFYPYEFKEKYPDGFPIEVVDRTGETCETDRTGAVHGKEAASQANA
FT                   GPLFPNEGGRRLGAAPQNPGRNPVRVHTLGETKNIGYTPIRVEEFLKKIPAQKVTASGQ
FT                   LLSVRDGVAAFMGVGATGASNTSAPRALGTIKHVSAAEAAYRRRVAQQQQSASSVTGAS
FT                   GAVSSMFVGNLIAVLIRLPDGQKITLHMAPEDTVASLRKEFAAAAPSFREVRYELCQAF
FT                   PLKQEWNEHQRTFASLGVEKSCTLMVKLIKQA"
FT   gap             2070324..2070423
FT                   /estimated_length=unknown
FT   CDS_pept        complement(2071933..2073237)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5450"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26405"
FT                   /db_xref="GeneDB:LMXM.36.5450"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY0"
FT                   /protein_id="CBZ26405.1"
FT                   /translation="MLAPSPLPSAAARAAVALLFLMFGLAHIANGWSGADAYTIVLLNG
FT                   FDTDVVLQDQFYNAPNGTLLTIARSGYRLMDGGLAPSTSAPTLAATKEVPALVRETAFM
FT                   PVGALDEHLSTAMAYQGMKAVGGPLPFRCRLSGEWVVWSKERPRRSGVDAQPRGKGAEE
FT                   EPVLLHCRLPLPQNRMEQALQQRRYIARNRAAMSAALEDWWHTAASEQSSRCLYGDGEK
FT                   ALTGRERYYELCPAGVVYRVQHQRLKRLLQQPSPHRDTEGATTKAKDTQTVLDFLHTMH
FT                   HSLSSRQAILQNPRYNGVFEQIGRYHSRISKPRWNTEYLVWESWYPSTNPCATHYTVLS
FT                   DFAGTGIGNKNVTARTRRAPRAVRPQDAYWKTVVRFRCPAHRSANETHKASLWTVTEAR
FT                   QLCEYHVEVMSDLVCGWEQELDSFNVNPVPCVVVD"
FT   CDS_pept        complement(2074186..2075754)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5460"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26406"
FT                   /db_xref="GOA:E9ATY1"
FT                   /db_xref="GeneDB:LMXM.36.5460"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY1"
FT                   /protein_id="CBZ26406.1"
FT                   /translation="MASVVGKVFSGMSQVAVVCGLAGAVYYRREYGSMATDDASTAHSL
FT                   ITFSKDDRRDIYDVAIVGGGIVGVATAREIRQKYPRKRVILIEREADVAQHQSGHNSGC
FT                   LHAGMFYPPGSAMARLCPRGHSLIIDYCKKNKLPYELCGKIIVAMEDSQRPTVQRMYDW
FT                   GVANGVKGLEILEGEEAIKKKEPLVTGVSALWSPVSGIIDFSEVTRCMLREMTAHAKNN
FT                   FATQFQFDAQDFVGVSVTKSKGAGAEEMVLIRGREKNHLGPEKTILAKNIITCCGLDSD
FT                   VVAKHSGGIVEWLGKRVVQTYGFRGRYYQLTPERRNMVHMHVYPCPDNRKGLSVGVHFT
FT                   PTVDVRRGRQVIVGPGSALALDRYGYTPYAIDLEYCFNCAFSKGGWVSLVSNFDVLFQT
FT                   YYMDISKRQFLREAQKLIPSIEAKDIVDSYCGVMAVGVAEDGTLSMDLAMEFARPRVTV
FT                   PATMDKKMMLEAVKDAPRSGTTLETSSISKPLILNVRNAPSPAATASMAIAEDIVKAAS
FT                   SRFQW"
FT   CDS_pept        complement(2076796..2079693)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5470"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26407"
FT                   /db_xref="GeneDB:LMXM.36.5470"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY2"
FT                   /protein_id="CBZ26407.1"
FT                   /translation="MEFSKRVGELAHLTRRLSRVQTDEARSRRLLASACSAPNVVENEA
FT                   GLRISASQQRVRSPASVHHHTLSGCAAAQNQLLLRRIPLSVSLVERSWWKLECRQQQRE
FT                   AQRGAAPGTIAGSASSPPASSADVSTPSSAPVLQPEKSKTLSIVQSSPAASRQHLDAVA
FT                   LLLKLLHSVEEARRQVLRRKERTAQRRCAAADDKWRKFQEELAPQLRRRNWKSGKQNDV
FT                   RSEDSVALLRGTANMLQERCRAAKEDESLLRASLLARSFVSARLWELLLRKTVWTAAVV
FT                   EHKRAVAATSSESSLTAPQATRLLLMCLAFTRLSLGVLRDYVEGGCFSRHAPRFVVSMP
FT                   SRSWQSRKRKVDICSLDGDAALRAAAADTSVEAGDGARDSKDRSSVDTAPGSNQEDALF
FT                   SMLQESLQAPGSAAADVAPAASAPRAHDSASNSTKRKRRPGRVASMRWIPPHTAHVIPL
FT                   ASQTLALHSLVLPEMDVPALLRLGCAAELVDLCVTLQRLASCVLVLSPQQTPSLADSTQ
FT                   AAKSLQHALHCLEDAITMVGRQVKTHLVTEQSVRLSSEPIAVATTPGRLQPADAARLAV
FT                   QLHRLRLLPVGDADAALLLSQLLRDMFPELRTKTSRILREKARQSSLLAFATRPHRMKL
FT                   YVQHGRRGAEGYVLGTIVQQARLQQRQLAAALRAQHISEVHVQQLGAFAESLPPNELVR
FT                   LIQLCASHAHSSHVMQQRALSAEAFDTPVTGCLFLAEALLISGALQTTPDQPSTLSLQE
FT                   LAILWDAATLLYPLIRARRAQQLVGGAGRSRLSHAAKTESVIWATFTEHVLVMVNGALA
FT                   QRLQSLEKLRQHESTAMRRARVTSGRKAASDVAVAERETALIDSRITADGLVSLAAGVL
FT                   EYAEHDESVSTRSATARTHSSSLPVQKLVQVLARLLQELVFHDRQLWHSLSILPATQRN
FT                   AVERQLVMCFQTMGMLDETTTRALDALSRRSHVEL"
FT   CDS_pept        complement(2085885..2087876)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5480"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26408"
FT                   /db_xref="GeneDB:LMXM.36.5480"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY3"
FT                   /protein_id="CBZ26408.1"
FT                   /translation="MDSSLIDVECERGIIGAPMSFSLPQVFQSFPPDTSITVSLNESTG
FT                   QHQQQQLQHQSPYSQQSLGHFHKTPLQLAPQYGTARSPSKEGDAGIEGWSNSGSSGVQP
FT                   NVPVSAAQTTEEASGAVTSADARVAASHVPQPDALHPNPIVSVAASESPAAAAPEKEES
FT                   PERVHVLVVFDKVFCVCFVPAALRATLKVGELVLCEYTHGENIGTIVADVSTIVAKVMQ
FT                   QHQSTMSMEAVEQAFTPPCERIVRTAGTPASSVVEGHSSGLFVATTAMCTEKARSGLPA
FT                   DQRLRRLPCVLRRGTNRDKKRMYFARLRSNDALAAVLRILRSESLVAQSAEYQVNFACV
FT                   TIYLGGERSQCGWSAHQFQQLGNTLVDPLRSEAVEFRFVCDHHHEELDLTRAITGLGLS
FT                   EILYAVVADHHKRQSGKGGQGSRGGAPNGAAVNRPGQLIQHSQQQQQQQQKAGQLFGSQ
FT                   SSIVTTYTGSSMWPQSAAALTPGNYVTPASPQQKHAMSYTLAPCVYVPQQQQQQQTNVH
FT                   TITLPSQTVTNTQPATQSLSLVQVHYPPISQVNPAPGIYWANVSTPPQPQRLEAQQQQL
FT                   SIAHSGVAEPTYYYVVSSAQQPQQQQSVAPQHSSAPQRGPNLLQATTLAAPSHVQQPTF
FT                   VKVPVMNTGSYQTVSYPFVLPSNATSYS"
FT   CDS_pept        complement(2097854..2098741)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5490"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26409"
FT                   /db_xref="GeneDB:LMXM.36.5490"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY4"
FT                   /protein_id="CBZ26409.1"
FT                   /translation="MQEETPSTSLTAAVPAGRIVARLSATLQQTEQACAELSRLERLLS
FT                   SLSSGAADLIRASTTPVDTGTTEPLQMTRNVDERTEEVYSLLEATGEPSTCESEAWGAW
FT                   CSTSEVNNAFHSSGLSTSFSALERSVSDAMVLALPSKLQRITEKVTQLCSILGERARRA
FT                   RQKQVLPHVRARWVCEAVRALHQIAHTPLEPEYAEAATFSVAVPCDPLPSTPEEADNCG
FT                   KSRALPAANDAVWWELQAGFHSVLHRTAPSSTSLALGKREEVAEGRLELQRHRLLALLE
FT                   EMTMWLVDDTSVTR"
FT   CDS_pept        complement(2100132..2101223)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5500"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26410"
FT                   /db_xref="GOA:E9ATY5"
FT                   /db_xref="GeneDB:LMXM.36.5500"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY5"
FT                   /protein_id="CBZ26410.1"
FT                   /translation="MVSRKSSSSASKSPSPHRRRVDASLSTAQNPTSGACTPSNLTHEK
FT                   KVQLARKQANCDHATPYNNDSTLPLYVIEDVPMYLRDNRYILRGYRAYYTWKQCFTSLL
FT                   RMHNETINIWTHLLGVFFFLGLMVQLFTRHIIPDYLAGNVLYHENRTARPVPVKNVRTA
FT                   WPFIIFGTFSLACVMCMLCSACFHTFLCHMNEDFYHRMHALDYYGITFLVVGSFLPFCF
FT                   YTMSCAPEWRNAYLSMIGSFGVVGFIGPFFRHWTSEAFATKKIIFYVCMVGSGIIPTIH
FT                   LSQMIPLHISGPYVKGLLTMLALYGVGVFVYAFRIPEALSPGTFDFYFSSHQIWHLCVL
FT                   GAATTHFYNCVAMYLSRETLVCV"
FT   CDS_pept        complement(2102298..2103791)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5510"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26411"
FT                   /db_xref="GOA:E9ATY6"
FT                   /db_xref="GeneDB:LMXM.36.5510"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY6"
FT                   /protein_id="CBZ26411.1"
FT                   /translation="MSLKATDITLADGAPRRSTLEPNREDPLVLCNSRENVDLLPFALL
FT                   PCVHDTRTLPTRTSEQQHHMFERSESAQLNFPAHASTEMVVTPPFIPRDREHRVFMKDA
FT                   DSQGVDDGDAHRAVRPELDRAQRSTVTFDAAVTSSAETHDTTDVSTAASFDVSTTALEL
FT                   HGTPRQLEQPATHAKAAEHDSPESERRFSLVVKAPTFDATREQQRNLIVMGLDGALPLY
FT                   KFEEIPPWQRYNPYIRSRYRAFYTVEMCFKSLLGWHNETINVYSHFLTFVAFLVLTALL
FT                   YTTVLSKAITAPSLSASKLIYGIFCFGSLMCMLNSTIYHLFNSHCNCRVMAAMGRLDFI
FT                   GITVLIVSSFLPPLYVMFHCHPVARTVYITAILVLSTAGIIGPWTDLFRKLVWVRLGVF
FT                   LGLGFSGLAPALHSLAIMPMNAASVSTLLGICLMVVLYCSGVAFYVTQFPESRYPGHFD
FT                   CWLSSHQLWHFFVSMAALVHYCNCVSMYQMWQVSDGMCG"
FT   CDS_pept        complement(2107319..2108332)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5520"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26412"
FT                   /db_xref="GOA:E9ATY7"
FT                   /db_xref="GeneDB:LMXM.36.5520"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY7"
FT                   /protein_id="CBZ26412.1"
FT                   /translation="MGDTLTSYEARVRCRDIAQTKTAAITTKNVGEAASKLLETAHRRL
FT                   SFNPGPPTTTWCRDLPLYDLSSIPEWLKGNPFILRYYRAGYTTKQCFKSVFALHNETLS
FT                   IWTHLVGLLIVLVLSLHILLNLGLHRTQDYLVFSVFQLGSMVMLGGSSVYHTLSAHHSE
FT                   QVHNIALAIDYFGITSMIVGSFYPPVFYLFSCLAVVRAVYLISITLLGILGLMGPFFTF
FT                   FNTQTFYWPRMILYSSLTSIGILPTIHMFFGLPANEQTLPLYKGMFLMLVTYCVGIVIY
FT                   IFKVPERWYPGRFDVWLHSHQLWHFFVLCAAVVHYFTCIGAFQMWHVTRGVGGECA"
FT   CDS_pept        complement(2109515..2111488)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5530"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26413"
FT                   /db_xref="GOA:E9ATY8"
FT                   /db_xref="GeneDB:LMXM.36.5530"
FT                   /db_xref="InterPro:IPR022035"
FT                   /db_xref="InterPro:IPR039881"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY8"
FT                   /protein_id="CBZ26413.1"
FT                   /translation="MKSALEEILRYRAALAVQEELERLCKARPPASSSLDAKGLLPSAI
FT                   FEGHQSLAATIAHSSDVRHRECVQQAREWVHPILDVRRQADVVEVSQAATTTATRLRLV
FT                   AVQYVQGDILGVVEPAEFTADAAAETCAPSSSRSVSVRNLRLATPEPFYHDALLPALEA
FT                   IEPHHASKNLLDLWLNKLCGVANKMDTSFNQKRKAAWQMTDEATYIFYAVRKQLAERIG
FT                   IVRMHNGHNAGERPWKVKVHLQTGDAHLLAALSSVAASTGGSGESAETAVVIDLVGRAV
FT                   DCSEWLSLRDWLTLSTPSQGEALASHEQSGVEWTVLSGAALRLRIPIRPAVVLRLHTRY
FT                   VARQTAETSATTDSFLHALARLLLRYHGLCGGRMEKESGWQAAVPPPVMDVFERHHQGS
FT                   LSSQRPTVTVECFASPFNATRPFFFSVFHDTDAVFGSLGNFFACCDAAACVAAADAAVG
FT                   SSCGVARAPEEPSASCASGDDVAEASLASQPHRLLRLECNPPFVHEVIAAAFAHLLRWL
FT                   ESASSTTAVSILIIIPDSRQAHAATVRATIEESRFCRWVRSLAPPECLYVHGANHQDHS
FT                   GSGEPPLHLEGRKRPRDTDSAATAPSWLAVDAGSLVRLSCPTRLMVVQDDEAEHACTGA
FT                   TIGTEVCAAWSRLSHAVSSAVQ"
FT   CDS_pept        complement(2112027..2113388)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5540"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26414"
FT                   /db_xref="GeneDB:LMXM.36.5540"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATY9"
FT                   /protein_id="CBZ26414.1"
FT                   /translation="MAHAPSSPLSPHPSALLFLVTGIPAAGKSTFLAAAQRHVVQRDTV
FT                   SGIVPLFGGRCHGRMCAVLQLDKVLADLEAATVHEKDPAASAGERKFSPRLWRRATRRL
FT                   LELTRSALRTCIVDTVDGDATENAVVPMVFVEDNMHYRSMRERYYQMCRTLESEEYSLQ
FT                   WPHEDPTAAAQSRQTLIVLFELRFATPLAVCLARNAQRRDPREGSGKEQACASAWVPPP
FT                   VICSMDALFDHCYATADLVDHAVWEPCHWNGWQWTATTQPWGLLVHATQGAEAEEICPA
FT                   LVSETAAGFFDVALQRPEAWDACQKQCQNIARSRPQRLRDDGQMDETTRLQRAAEAVES
FT                   HTHQLDLQLRGVVHAFLHQRNQQKAYGTDDASSPPRAALFRKRIAVAKKEAAQQFKVQL
FT                   RQLSAAKNELTGTVAIDLLGGGIDGIQEYVIQQFQQHLLDLWREFESQVLPTSR"
FT   CDS_pept        complement(2114130..2118035)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5550"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26415"
FT                   /db_xref="GeneDB:LMXM.36.5550"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ0"
FT                   /protein_id="CBZ26415.1"
FT                   /translation="MVRYNTAVIALLKRMGPRKERGLGQLPDSLLRDVARTTQNMLARF
FT                   SFDWESEKTHRAREAQAEKMAAGKGVTHLDRIPESNRVSLAAQIPCILLFLQLAPPKLH
FT                   TSCASILSRFVLFSIPVRGRSPQANALFTAIISHLLPRPYTAVPTINLIISVITVGATR
FT                   IADNEAEKLMRRKLASRVPKWVLEQNAEVEACLAGLPRWLQALVPKDVTLDFAEIIDEI
FT                   ARRLPPADEGLPGDYVDVLAARKDGEAAKYEYGVALKAMYNESTTNAVTPAELSMLVPK
FT                   LLDFSVKFNRMRVAAQIAQNVRLLDFSPPVSHETLYSAFACTALRGALSNLSLLRHTEK
FT                   ILAVRQLSPYEWLFIISIVTGREKAWAPTAYTAMRSALRIAEERRRDEIERSGKTEREV
FT                   SLLGSMDPNRRLMLLAHYSTGLCDLRFNDDLFSAALECTEPLIREYFRALEVDTTPSLR
FT                   TLDSSYRIRQMLSVVTRADNVSVSHVGEESEDMADENDVTAEWTRVEEAKATTGNATNS
FT                   LLRALEKFFADPSSACSSAAVAPATSVPQKCRSGFARTNLPDQRCGAAIALEGLPTDEL
FT                   ILRMHIVECAIVYCLQLHEQKANRHGASSELVELSLRSARRMQRIVGVQLRNVSSIIQS
FT                   SQWKSQAASVAGGMSSDTTAETVIVDGVMGEKKSLQLSWITMKLLVALTLLKDLSAAAR
FT                   ADVASIAAAFMSDFAIFMDSIGDHRALPATVNRSIAMLHRWYASHKNMLKSSAVSEDAP
FT                   PFRDADESARKVVLSSLGVVQRILPSRHHQRRLTGVGSGLSFGFHTKLVVVRAFDSALS
FT                   MALTVNMTLDELPNIFDSMEKTVDTVREASQMALQESPSNTERYEAEKKLRSSLLPKLT
FT                   HLLHHICILSINDESCLTVAAAALDACAREDQIAFLSWKKRESILSMTLYIYRALAERF
FT                   AHSRASRDLAHQILIMVSRLALDRLEYKEYEFTVQGEKRWLSESEVELRHLVWAVLIWQ
FT                   ISCAVASTFLQSAPIDKYLRVMHTYVKRHFVISMSAQAMEDSSIIGTEAELEYCEQVLA
FT                   ESGPSARSLIYWEPETTKKAVILRCNLAVRDVFSAMKFMATLLYKDSSTSANPAFRARW
FT                   VSQMELACGLLKQYQRWIAPSVWYSIWRELVTTSIVMRIGYLNSIPVQEATEVTAQRLL
FT                   LFSKIRDNKGVWIHPRGSHAAPSQEDDGADAGTSAVKRHAERESELISFSDASRIFQVQ
FT                   ERLTDVNLRLYLAQLTDRLSREQEDHALNQADSRTNLEGERRIRLNGLSETQAEIHERN
FT                   LRTARISILFTCRRMRS"
FT   CDS_pept        complement(2118902..2121367)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5560"
FT                   /product="putative aminopeptidase P1"
FT                   /product="metallo-peptidase, Clan MG, Family M24"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5560"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26416"
FT                   /db_xref="GOA:E9ATZ1"
FT                   /db_xref="GeneDB:LMXM.36.5560"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ1"
FT                   /protein_id="CBZ26416.1"
FT                   /translation="MLRRAWRTAPVQRLSVSVTLGLARWIGGATAVAEEVSAQEYAERR
FT                   RWFLECLPDNSVVLLPAADESLYSHDILWPHRQDSLWYHLFGMRVPMRRQLAPPSSAIT
FT                   EDVRVTIAAFAKGMKGAPAQTLLCVPPATTDTATLVWGSEAVPLSQYKRLLCADADGGM
FT                   LSPRTHENVVTTNEVGTVCAAVHRLITDMAQQQVKEWAEDSDLELSALPGGGGGVQAGR
FT                   LLPLGVLPRVFAAYPQQLRWDGRGYRLRQPAASMLLAKTQDAAHSSSVFHHPLEAFFST
FT                   LSAMPFVVHLPRPLLLATAAAPGQQSACSVVTFRYSAVAGHTPGLVPCTLRRPNSPTAV
FT                   ATASENAGNEPDATMQLSLPIRRSDAYAWLYRQVKGPSQLRQHLRSARATEDAFLQLMH
FT                   RASATLSEHVLYCAFQRTVCDISEHAGAAAQVRSAYIPVVASGVRGSEIHFTDNDGVAA
FT                   PGDVVRVDAGVEVDGVPTDCTRTLPIGSSRFPSSYVPLYEGLLEIQRKLLQCMRPGVSV
FT                   RDMAGMHIDETRALLCSLGVDVRRAAPSSAAQSPFPHESATATSSQEQQVPLALVRSCF
FT                   CAHSFGHFFGLDIHEELSSVLRPLKTAAAKEKVTRRQRSTPRILQGGMMHTVEPGVYVP
FT                   SAQRAALFGLEKAHLPIAFHGGVGVQIEDDVLVLPSPDGEDVDVCKGDEPLVHCPWSRG
FT                   DYLQHALAAFHRYYGSGDAGWMPSLLVSVCDAHVPTARGGRMTAATQNVLRFLFAQRVA
FT                   MEGLPKAKASLATDVCAIQQQTFVPNPAYVDGPPVPHAAVSDWYPYSSIVLTATIPKDI
FT                   ALIEGVMRQ"
FT   CDS_pept        complement(2122228..2122935)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5570"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26417"
FT                   /db_xref="GOA:E9ATZ2"
FT                   /db_xref="GeneDB:LMXM.36.5570"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ2"
FT                   /protein_id="CBZ26417.1"
FT                   /translation="MTTASRVLALATVCLLCVLCASVDAATSVHAGVYAKLLPGKEFCA
FT                   DYHAFRDPQSDPVPVTFHHRCIDPRLAGITTKLYGPSSEPLKRGPEIPLSESIDTFGDI
FT                   SQIFFYAEKTGIYKLCFLLPLRKPAMRFEMSFSAANDIVEPPKVEDDAFVVDKPPEMAD
FT                   YADRLRMLNLSVETTVDELRMYQTRRYFFDKTVNSAFYVCVFSVLLNIAIAVGLSLWSE
FT                   TYLKRYFVKQKIA"
FT   CDS_pept        complement(2124209..2125327)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5580"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26418"
FT                   /db_xref="GeneDB:LMXM.36.5580"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ3"
FT                   /protein_id="CBZ26418.1"
FT                   /translation="MATINTELSLVRRFHALLQNYDSRPAVARRNTLPTLSRFLRSKDR
FT                   QIRKLSLEAVYLLAEHHENLELLGNDQDLVEGVAEIYDGAQYDDPELYDLSNKTLDLLA
FT                   QTFRCGDPREVVARRAEQDAVVASAGAVPRFPTPLLDAGSSSELPDLSNAVREYDTIIG
FT                   DGHAEAVGDFDQLSVISGGTGFEMASSSSYLTRRMTDPALRPSEVIRGVGKDCPLSIVL
FT                   EIPALDAMTDTSHIEEILQTTRGIMSYTITASAHQIRVFLSAFAQAPLQNMLTEAGYEN
FT                   ILTSAERMRYQGSDIGNQSLNGSFFYDQQSKRPSYVQSAKNFASNLFNSVMVYSDPRNN
FT                   SLAARIRQQRAAKEEGGNTTADRIAQAFSRWW"
FT   gap             2126650..2126749
FT                   /estimated_length=unknown
FT   CDS_pept        complement(2128242..2129939)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5600"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26419"
FT                   /db_xref="GeneDB:LMXM.36.5600"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ4"
FT                   /protein_id="CBZ26419.1"
FT                   /translation="MLARTPFRFWTPRYFRGQAGAGRYLGKRRVRAVDGAPPHCSTGAA
FT                   KVGETVTLCALPTRAPPPQKPASKSPTEGAPSSPSVGQNLHQPRISGLHSPPPDALHAS
FT                   NPLVQRAQELLHELATVDYSQSSLTPEAAKGFAEFSTRRDVLGPLRGLLPPPATMSGGG
FT                   SANPASRQRFRLVPVVGSGPIAPPRGPPMTAAADFSLSDLVLFLRLYDSANVEDGQLLM
FT                   QLMNEIRRQLFALAEAAADAAAARGGSSAPSVAGVTVGEHDQEAANRGVKGISQAPSAS
FT                   LLPLPAMLYTMSSLGIVEEAVLDVVTSCAVHDGACGRRGLLYSQLRLYSVADLLQLLVA
FT                   LHRFGHQQQPSTKAVAKALRASLYSTPTNASRFHRRARSLKKALAARPRTPSSGEGRVG
FT                   ATAAVADTGGVAAMIAEDEELSSLAFGLECPLFLLLEALTATATTVHRRTDVVAFLSDL
FT                   IAVTAVTELMTAVHESRGRRSPAGCEDLALEAQGFVFAVSHQLLRAAKLTECMELPQIL
FT                   LSNVFAWSTTLSGRGVVVDGGEDRAVPSDRVAYYDHVTADLIKANSAE"
FT   CDS_pept        complement(2130610..2132187)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5610"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26420"
FT                   /db_xref="GeneDB:LMXM.36.5610"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ5"
FT                   /protein_id="CBZ26420.1"
FT                   /translation="MPFFYLGLHCCFHRLSHLSPFLPPPTAHPLSSADIYFLFRRTPSR
FT                   HGAPLATHSRCCFVPAYWHLLLPPCTCVAESSLRSGAGAHGMNTVLSLLDDTVYTLLGI
FT                   TTVLLCAVAFRLSRNVYRETLRAQAQSKLRREDLLTHEQQNFLRSMQAEEKVEAVLRKA
FT                   GWTDVFLRRRVAVARVGHNREIDVVAVGPIILVVEVKNWQGFVWSNGPRWYQCRNRKRM
FT                   DTLEFEDVQEDNVEKAAALRRYIENARRVELPDSHLIQSDAVLFGQDTGTNGKRATWYS
FT                   DKSIHKVCGKCVVPVVVFTHPRVKLDPATVKAKKYVFTLDTFGVFASHAIRGNIDLEAL
FT                   NDVATASWWSSWLPFMRIPRPLATTSAAAAVFLTEEQRNNVAGVVDVLRTWDLVYLLDH
FT                   RLITGDLEKIDVPSAFCMYNRKHLLDINVRWNRGAVGLIKTLLTNSVGSVELVLTTAKR
FT                   LAKKRKERKPRNAEGNIVFPMRPKKNKENGYLVMKMAGTGKLETVLLCDVDRISLSRHL
FT                   YESEKQLE"
FT   CDS_pept        complement(2134373..2137672)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5620"
FT                   /product="putative isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5620"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26421"
FT                   /db_xref="GOA:E9ATZ6"
FT                   /db_xref="GeneDB:LMXM.36.5620"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ6"
FT                   /protein_id="CBZ26421.1"
FT                   /translation="MAGEDKQQKQDPPAGLPGVPVKSYPDVLDFSKMEEEVLAMWREKD
FT                   CFRTSMKLSEGRKPFSFYDGPPFATGLPHYGHILAGTIKDMVTRFAYQTNHHVIRRFGW
FT                   DCHGLPVEYEIDKMLGIKTSHDVSKLGIDKYNDECKKIVTRYVDEWRKTVERVGRWIDF
FT                   DNDYKTMHLSYMESIWWVFSQLWEKKMVYRGFRVMPYSTACTTPLSNFEANSNYKEVSD
FT                   IAVTVAFQARADPNTYFLAWTTTPWTLPSNLSLCVHPELDYVKVLDTKSKRHYWLAEAR
FT                   LAEVYPKKDSKKASKAKGGDNAAEADAAPYTVVEKVKGAQLVGEKYVPLFPYFESSMSA
FT                   TAFRVIAGTYVTTDAGTGIVHQAPAFGEDDYQACLDAGIFEKGGKFVCPVDENGMFTSE
FT                   VTDFAGKHVKEADPEIIKALEAEGHLFHKASIVHSYPFCWRSDTPLIYKAVESWFVNVE
FT                   AFRDRLIECNEKTYWVPDFVKTRRFSNWLAEARDWNVSRNRYWGTPMPVWHSEDWEEVV
FT                   CVSSIKQLEELSGVTGITDIHRQFVDDITIPSKRPGMPPLKRVPMVFDCWFESGSMPYA
FT                   QEHFPFENQDKFKSLFPADFVSEGLDQTRGWFYTLLVLGVALFDVSPFRNVAVSGLVLA
FT                   EDGKKMSKRLKNYPEPRVVIDTYGADALRMYMISSPVVRAEPLRFREAGVKGVVKDILL
FT                   PLFNAAKFFISNTNYCIAAGGQVSLQVRSTNEMDRWILASCQSLLRYVKAEMRLYHLYN
FT                   VVPGILRFVVDLSNWYVRMNRRRMKNATDSEDRSQALSTMLYILFSVSRIVGHIAPFVA
FT                   EMLYQQIKPLLPATEHVDSVHYLMIPDEDASLDDPELERAMSRMMNIVDLVRVLRDQMV
FT                   IPIKRPVRQVVIVHPDPQYIDDVRKVAGYIKDEVNAFEIVMSSGENYLETKLDANFEVL
FT                   GKKYRKEMPAIRKGIQAMTHEEVTKFLHDKKGVVVGKELTIEDVKVLRQVKEGITDFQS
FT                   NTDNDVVVLVDKRQDQELIDSWRAREFVNRVQQLRKKAKLVVTDEVDVYFEAEEADLTA
FT                   SILHSKDQINQTLRGVWTTMDQKPNDAELVAEEDTSISGVAVRLVLAKPKA"
FT   CDS_pept        complement(2139135..2139842)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5630"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26422"
FT                   /db_xref="GOA:E9ATZ7"
FT                   /db_xref="GeneDB:LMXM.36.5630"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ7"
FT                   /protein_id="CBZ26422.1"
FT                   /translation="MNTAMATFSRAAEDYPALITRAVLDAYAQYVVAGSNSSDTLRPDG
FT                   VVGAEAHGVPKSIEEALAPLEILYGKTALSAIGIALHGTEPVIRYVEGAEVDLSDDDES
FT                   VKASDDDVECVHHEAQRARRSGADAVSSTARSNTVSQKDDQGSAAAVSSQVPVHRARCL
FT                   YQVGEHTLFSPYYCPCSAYAYQSIQRQEVWCCKHMLALQLALRIEATGVVQDSLSVRIV
FT                   SPAEYEQLLLRSL"
FT   CDS_pept        complement(2140691..2142175)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5640"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26423"
FT                   /db_xref="GeneDB:LMXM.36.5640"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ8"
FT                   /protein_id="CBZ26423.1"
FT                   /translation="MTDAAARDAYTAYGVDLIRTAGLLLRTTPSTIYRASILFQRFEAS
FT                   VETHFRSQYISALDMPAYRNGLNEDLKRAQLELLAASSPNGSPSMTEKTCDAASKPAYP
FT                   AGVEYLVPNHVQLKMRTGLVPLVDLHAPLDYCIHHLSDHEDIMYLVAACLLIATKMEDP
FT                   STRIRAVVNICMRLSLRRSGTPVNEQSKPSPPRYEDFKACVVEAEEVVLHQLGFQTFVE
FT                   SPYKYVLLYLNILVEPARDDAQSAIGAVRGDPSAGANGTTRPSVTAAAKAARPPAALTQ
FT                   WMIRAVQVVNDLPRCRRLLAVPADALAIYAIQQSCPPDLTLPNKWSTAFGVSERLLKAI
FT                   SYRYGVYSSNSAGNRPATAALADARALSTVPLYRTVAERDQYNLAMEQLKVARETAAEA
FT                   SAKTSLSVSPAPPPPSSSGAAGPLPSSFANPASIEELRDLIGASLPSDAVHDSSRRRSR
FT                   HDDDENILVRKSKHEKRHHRHHTDDGELRRRRHHRK"
FT   CDS_pept        complement(2142920..2143909)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5650"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26424"
FT                   /db_xref="GeneDB:LMXM.36.5650"
FT                   /db_xref="UniProtKB/TrEMBL:E9ATZ9"
FT                   /protein_id="CBZ26424.1"
FT                   /translation="MPCCSPSSHVAPTRPLVTTALLLLVCVVVAVVGCASARKQLPLNT
FT                   PYPPIVQNALRCDVCSFIVVNALYQVEAKREERQRKRLQVREDDVLEEVENMCIPFKDQ
FT                   GQWIRQVALQVEEVAPSRRDADRPAAATPRYHMSVGVVDYYSKCGRICETVAVLCEEWM
FT                   DSGYMDGFSSRLVKEANAGRNISDAAHRDAVFDSFCAPSPHCENHATFARKLDVTLMKD
FT                   AELRESIDADRPQEIETEEREMETMLHRLTREQGQSADVFSRDEIRRMKEAFVTGNKED
FT                   LQAVDPTAFDLTDDEFSTLQDYMRGEDRKQQQQQRQRRPSAPSDADDL"
FT   CDS_pept        complement(2144727..2146880)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5660"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26425"
FT                   /db_xref="GOA:E9AU00"
FT                   /db_xref="GeneDB:LMXM.36.5660"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E9AU00"
FT                   /protein_id="CBZ26425.1"
FT                   /translation="MGQRGSRMPPVVTSASDSPPSNPTERLSLVAPSAAVVGAGVAGVH
FT                   VAYELAKLGFKVTVFERRGDIAGGETRFSLPFVGVGLIEPSLARTAFRTEVLRGMLFPT
FT                   ACPDLIAREHLFNTLLNPVVYRWMWGRLRSCFSDSEVMTYTNNLSCVSHSVVCELVSKY
FT                   PHLHQHVFAGPVTVLNERKEAAVTAHGEPLMVDPVGWTRALAEVCRRDYDVQFALGERL
FT                   EDAVTYLKYDVESTRSIRVSKPDPLHPEQRLFASEGYDVVVLAAGASTGTMTLPNSRLP
FT                   VLGLSGLSAVVQQPSGALKDAIWSLFQCKPHRSTAAAATSSSPEVYAPSSHDGVTDFLA
FT                   RPAPGTLALLSSHCSLYGYTWPSSLMFSENRDGGPPSRSSAVASMMQSKVLPTPQDVVL
FT                   QGLLSLDSTFKTKTHALVSRQLHRLESYLRVKCGWSVPLSSSSTSAGAGCGSNVVRVRE
FT                   YVRAFTPDGVPIVDRNGSSFNCFVCCGFGDHAMDLAPGAAKVLGKLVEHQAQQLREEDI
FT                   ENAKTWGLLTSKLSPSRRTAVEEELQLLFNGADPDEVIGKGSRKPSEASALTLLRFEDN
FT                   PYSTNRFVNMVRKEVKMDSSLPTLSRLCALEDVFLTHLEPLRRRFHAKATELALRENTP
FT                   DWLRTLVFCFMYEEDDDPVAQERKKQHVRNLQRLASQYEAPVPDAKTTDDGAEEVSLTP
FT                   AEQSKRKQAELERRAREVFAKRV"
FT   CDS_pept        complement(2148034..2150127)
FT                   /transl_table=1
FT                   /locus_tag="LMXM_36_5670"
FT                   /product="putative RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LMXM_36_5670"
FT                   /db_xref="EnsemblGenomes-Tr:CBZ26426"
FT                   /db_xref="GOA:E9AU01"
FT                   /db_xref="GeneDB:LMXM.36.5670"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E9AU01"
FT                   /protein_id="CBZ26426.1"
FT                   /translation="MASSSPELPVTEARASIVRMIRKNQAVIVVGETGSGKTTQIPQYV
FT                   WDDILSKRPGAGIVGCTQPRRVAAVSIARHVARQRGGNV