(data stored in ACNUC16935 zone)

EMBL: FX116038

ID   FX116038; SV 1; linear; mRNA; TSA; INV; 2150 BP.
XX
AC   FX116038;
XX
PR   Project:PRJDA33427;
XX
DT   17-FEB-2011 (Rel. 107, Created)
DT   17-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   TSA: Cryptosporidium parvum cgd7_2280 mRNA, complete cds, contig:
DE   XCPa012248_2_1_solexa.
XX
KW   Transcriptome Shotgun Assembly; TSA.
XX
OS   Cryptosporidium parvum
OC   Eukaryota; Alveolata; Apicomplexa; Conoidasida; Coccidia; Eucoccidiorida;
OC   Eimeriorina; Cryptosporidiidae; Cryptosporidium.
XX
RN   [1]
RP   1-2150
RA   Yamagishi J., Wakaguri H., Sugano S., Kawano S., Fujisaki K., Sugimoto C.,
RA   Watanabe J., Suzuki Y., Kimata I., Xuan X.;
RT   ;
RL   Submitted (16-FEB-2011) to the INSDC.
RL   Contact:Junya Yamagishi Obihiro University of Agriculture and Veterinary
RL   Medicine, National Research Center for Protozoan Diseases; Inada 2-13,
RL   Obihiro, Hokkaido 080-8555, Japan
XX
RN   [2]
RA   Yamagishi J., Wakaguri H., Sugano S., Kawano S., Fujisaki K., Sugimoto C.,
RA   Watanabe J., Suzuki Y., Kimata I., Xuan X.;
RT   "Construction and analysis of full-length cDNA library of Cryptosporidium
RT   parvum";
RL   Unpublished.
XX
DR   MD5; ab20c4423d98545925db19fbbf7e68bd.
DR   ENA; SRR016084.
XX
CC   ##Assembly-START##
CC   assembly method       :: in-house algorithm supported by Eland
CC   sequencing technology :: Illumina Genome Analyzer
CC   ##Assembly-END##
XX
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2150
FT                   /organism="Cryptosporidium parvum"
FT                   /isolate="HNJ-1"
FT                   /mol_type="mRNA"
FT                   /note="contig: XCPa012248_2_1_solexa"
FT                   /db_xref="taxon:5807"
FT   CDS_pept        1561..1947
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="cgd7_2280"
FT                   /note="URL: http://cryptodb.org/common/downloads/release-
FT                   4.3"
FT                   /note="product information: 60S ribosomal protein L40"
FT                   /note="refrence: CryptoDB release-4.3"
FT                   /db_xref="GOA:F0X6C0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:F0X6C0"
FT                   /protein_id="BAJ78141.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGVIEPSLANLARQYNCEKMICRKCYARLP
FT                   PRATNCRKRKCGRTSQIRPKKKLK"
XX
SQ   Sequence 2150 BP; 734 A; 362 C; 391 G; 663 T; 0 other;
     aaaatataat taagatctga aagttgagct actttttcag cggaacagag actagtgatt        60
     ccggtagtct ctcaatcgaa tatttatggt tggtaacata cattattggg acgcctggta       120
     ttctacgtat gcgcctcttt agttcggtat cattcgttcc cactatgtaa catttatgtt       180
     cagttactct ttgcactatg caatcgtccg cataagtccc tttatgcaga cagtgcagac       240
     gtttgaatct gggatctcta gctagtttca aagccaagtt gtaacggtga cccatctttt       300
     cgagttcccc tattacacaa tcagtaatgc aagggataca cttagctacg aggcaatcca       360
     ttgttccctt aaatatatct agtttatgct gtatagaaaa gttaataaaa ttggtatcga       420
     gtaggatgtg gaagggaggg cccaaattat tgttataatt gaaaaacaag ctagaaggta       480
     catttggcct aaaggaatat tattaagaac ggtttaatag ttttaaaact tacacttctc       540
     ttagtttatc attactatca ttgcgggcat ctactttgtt actttgctta tttctacatg       600
     aaattgaaat atttgctgaa agtgaacttc ttggttaact tactgtttaa ctctactatc       660
     attggggttc aaaatgcgtt tcaccgctgc aaattttcta gttcttttag ctacaccctg       720
     caaattaata ataaaaatct tcagtggact tttttgacat accatttagc ttaaaaacag       780
     aagttaatac aattgaacta tagttataat cattaattta ttttattatc caactatttg       840
     tttgaataat aaatctatca tttctacaga aaatattcag caggtcaagg aaatgtatga       900
     aggatcgagc gggaatgcag ttcaatagaa gaaattaaat ttagcctaga gaagaaaaca       960
     atatcattcg gaattgaaca tattagtaaa gacatataac tagactggcc tatctatttt      1020
     aagaaatctc ataaacatct ggcttctcaa atgaagtgaa taaaaatatt taggagcaat      1080
     aactacctca ataactcaaa tgattaataa ttgggtcctg attactcctt tgaggtggca      1140
     atgtaaaaca aaatgtcacc aattatgttt aatgtcggca tgaatattgc ttagtacaag      1200
     ttgtgaaact tgtataaaca ctcagtttta gtttcagttt ccatcatgaa agtccgatga      1260
     aaccctggga ttcatgccat agataaatgc gcagatggca gtctcaaaat atataaattc      1320
     taaaatgatt acaaaatata attgatctag aataagaaga agaatcactc agttactata      1380
     gaaagaagtt ttaaaaggta tttagcacga cccgccagaa gacgagactc cgagacgcca      1440
     tagtctaagg aactcaacac ggaaaagatg cgggcttgac agtaaattgc ttcaaagcaa      1500
     gacgaattat cattgaagtt gttaatagaa agtttgtttt taaactagga cgcgaagaag      1560
     atgcaaattt ttgtcaaaac tttaacagga aagaccatca cattggaagt tgaaccttcc      1620
     gatactattg agaatgtaaa ggcaaagatc caggataagg agggtattcc tcctgatcaa      1680
     cagcgtctga tctttgctgg aaagcaattg gaagatggta gaactctatc tgactacaat      1740
     atccagaagg agtccacttt gcatttagta ttaagactta gaggcggtgt aattgagcct      1800
     tcacttgcaa acttagcccg tcaatacaat tgtgaaaaga tgatttgcag gaagtgttat      1860
     gcaaggttac caccaagagc aacaaattgc cgtaagcgta aatgtggaag aacgagccaa      1920
     atccgtccaa agaagaagct caaataaact acttaatatg atattaataa tactcggagc      1980
     agagatgcct tgccacctct tatttatcct ttggattagg gttatgacaa accatgagct      2040
     ttacaacggc ttttatcagg aagttggatt taactcttga tccagatctc aggaagtact      2100
     cgtattatga tataatttat atctagaaac tactaactct tatttgaacg                 2150
//

If you have problems or comments...

PBIL Back to PBIL home page