(data stored in ACNUC8465 zone)

EMBL: GQ225578

ID   GQ225578; SV 1; linear; mRNA; STD; HUM; 1041 BP.
XX
AC   GQ225578;
XX
DT   14-JUL-2009 (Rel. 101, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens mitogen activated protein kinase kinase 3 (MAP2K3) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1041
RA   Ghazal A., Zaidi N.U.S., Kanwal N., Javed F., Fatima K., Qadri I.;
RT   "Cloning and sequencing of MKK3 gene from blood of normal individuals";
RL   Unpublished.
XX
RN   [2]
RP   1-1041
RA   Ghazal A., Zaidi N.U.S., Kanwal N., Javed F., Fatima K., Qadri I.;
RT   ;
RL   Submitted (28-MAY-2009) to the INSDC.
RL   Nust Center for Virology and Immunology, National University of Science and
RL   Technology, Tmaiz Ud Din Road, Rawalpindi, Punjab 54300, Pakistan
XX
DR   MD5; abf8c83ea10935bfcce0f3ce4575d3d2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1041
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /country="Pakistan"
FT                   /collection_date="Dec-2008"
FT                   /cell_type="leukocytes"
FT                   /db_xref="taxon:9606"
FT   gene            1..1041
FT                   /gene="MAP2K3"
FT                   /gene_synonym="MEK3"
FT                   /gene_synonym="MKK3"
FT   CDS_pept        1..1041
FT                   /codon_start=1
FT                   /gene="MAP2K3"
FT                   /gene_synonym="MEK3"
FT                   /gene_synonym="MKK3"
FT                   /product="mitogen activated protein kinase kinase 3"
FT                   /note="involved in the p38 cascade; preferentially
FT                   phosphorylates p38alpha and p38beta isoforms; activated by
FT                   a plethora of MEKKs which become activated in response to
FT                   various physical and chemical stresses; activated by dual
FT                   phosphorylation of serine and threonine in the activation
FT                   loops"
FT                   /db_xref="GOA:C7DUW4"
FT                   /db_xref="H-InvDB:HIT000647761.2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7DUW4"
FT                   /protein_id="ACT33197.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVR
FT                   DLGEDS"
XX
SQ   Sequence 1041 BP; 248 A; 297 C; 299 G; 197 T; 0 other;
     atggagtcgc ccgcctcgag ccagcccgcc agcatgcccc agtccaaagg aaaatccaag        60
     aggaagaagg atctacggat atcctgcatg tccaagccac ccgcacccaa ccccacaccc       120
     ccccggaacc tggactcccg gaccttcatc accattggag acagaaactt tgaggtggag       180
     gctgatgact tggtgaccat ctcagaactg ggccgtggag cctatggggt ggtagagaag       240
     gtgcggcacg cccagagcgg caccatcatg gccgtgaagc ggatccgggc caccgtgaac       300
     tcacaggagc agaagcggct gctcatggac ctggacatca acatgcgcac ggtcgactgt       360
     ttctacactg tcaccttcta cggggcacta ttcagagagg gagacgtgtg gatctgcatg       420
     gagctcatgg acacatcctt ggacaagttc taccggaagg tgctggataa aaacatgaca       480
     attccagagg acatccttgg ggagattgct gtgtctatcg tgcgggccct ggagcatctg       540
     cacagcaagc tgtcggtgat ccacagagat gtgaagccct ccaatgtcct tatcaacaag       600
     gagggccatg tgaagatgtg tgactttggc atcagtggct acttggtgga ctctgtggcc       660
     aagacgatgg atgccggctg caagccctac atggcccctg agaggatcaa cccagagctg       720
     aaccagaagg gctacaatgt caagtccgac gtctggagcc tgggcatcac catgattgag       780
     atggccatcc tgcggttccc ttacgagtcc tgggggaccc cgttccagca gctgaagcag       840
     gtggtggagg agccgtcccc ccagctccca gccgaccgtt tctcccccga gtttgtggac       900
     ttcactgctc agtgcctgag gaagaacccc gcagagcgta tgagctacct ggagctgatg       960
     gagcacccct tcttcacctt gcacaaaacc aagaagacgg acattgctgc cttcgtgaga      1020
     gatctgggag aagactcata g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page