(data stored in ACNUC7820 zone)

EMBL: GU139533

ID   GU139533; SV 1; linear; mRNA; STD; MAM; 993 BP.
XX
AC   GU139533;
XX
DT   29-NOV-2009 (Rel. 103, Created)
DT   29-NOV-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Gorilla gorilla olfactory receptor family 7 subfamily D member 1 (OR7D1)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Gorilla gorilla (western gorilla)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Gorilla.
XX
RN   [1]
RP   1-993
RX   DOI; 10.1073/pnas.0808378106.
RX   PUBMED; 19955411.
RA   Zhuang H., Chien M.-S., Matsunami H.;
RT   "Dynamic functional evolution of an odorant receptor for
RT   sex-steroid-derived odors in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(50):21247-21251(2009).
XX
RN   [2]
RP   1-993
RA   Zhuang H., Chien M.-S., Matsunami H.;
RT   ;
RL   Submitted (29-OCT-2009) to the INSDC.
RL   Department of Molecular Genetics and Microbiology, Duke University, 264
RL   CARL Building, Research Drive, Durham, NC 27710, USA
XX
DR   MD5; 28012564ebcdf8e287c0f03d0012e002.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..993
FT                   /organism="Gorilla gorilla"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9593"
FT   gene            1..993
FT                   /gene="OR7D1"
FT   CDS_pept        1..993
FT                   /codon_start=1
FT                   /gene="OR7D1"
FT                   /product="olfactory receptor family 7 subfamily D member 1"
FT                   /db_xref="GOA:D1MF95"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:D1MF95"
FT                   /protein_id="ACZ52475.1"
FT                   /translation="MEAENLTELSEFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLI
FT                   ILAISSDSHLHTPMYFFLSNLSFVDTCFISTTVPKMLVNIQARSKDISYMGCLTQVYFL
FT                   MMFAGMDTFLLAVMAYDRFVAICHPLQYMVIMNPHLCGLLVLASWFIIFWVSLVHILLM
FT                   KRLAFSTGTEIPHFFCELAQVLKVARSDTLLINIVLYVATALLGVFPVAGILFSYSQIV
FT                   SSLMRMSSTEGKYKAFSTCGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSMASVMYAMV
FT                   TPMLNPFIYSLRNKDVKGALGRLLSRAASCLLRDTTSELRGCYGSLKQM"
XX
SQ   Sequence 993 BP; 196 A; 293 C; 223 G; 281 T; 0 other;
     atggaagcag aaaaccttac agaattatca gaattcctcc tcctgggact ctcagatgat        60
     cctgaactgc agcccgtcct ctttgggctg ttcctgtcca tgtacctggt cacggtgctg       120
     gggaacctgc tcatcatcct ggccatcagc tctgactccc acctccacac ccccatgtac       180
     ttcttcctct ccaacctgtc ctttgtggac acctgtttca tctccaccac agtccccaag       240
     atgctagtga acatccaggc acggagcaaa gacatctcct acatggggtg cctcactcag       300
     gtgtattttt taatgatgtt tgctggaatg gatactttcc tactggctgt gatggcctat       360
     gaccggtttg tggccatctg ccacccactg cagtacatgg tcatcatgaa cccccacctc       420
     tgtggcctcc tggttctggc atcttggttc atcattttct gggtctccct ggttcatatt       480
     ctactgatga agaggctggc cttctccaca ggcactgaga ttccgcattt cttctgtgaa       540
     ctggctcagg tcctcaaggt ggcccgctct gatactctcc tcattaacat tgtcttatat       600
     gtggccacgg cactgctggg tgtgtttcct gtagctggga tcctcttctc ctactctcag       660
     attgtctcct ccttaatgag aatgtcctcc accgagggca agtacaaagc cttttccacc       720
     tgtggatctc acctctgtgt ggtctccttg ttctatggaa caggacttgg ggtctatctg       780
     agttctgctg tgacccattc ttcccagagc agctccatgg cctcagtgat gtacgccatg       840
     gtcaccccca tgctgaaccc cttcatctac agcctgagga acaaggatgt gaagggggcc       900
     ctggggagac tccttagcag ggcagcctct tgtctcttac gggacacaac ctcagaacta       960
     agaggatgct atgggtccct taagcaaatg tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page