(data stored in ACNUC7820 zone)

EMBL: GU139542

ID   GU139542; SV 1; linear; mRNA; STD; MAM; 939 BP.
XX
AC   GU139542;
XX
DT   29-NOV-2009 (Rel. 103, Created)
DT   29-NOV-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Gorilla gorilla olfactory receptor family 7 subfamily D member 4 (OR7D4)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Gorilla gorilla (western gorilla)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Gorilla.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1073/pnas.0808378106.
RX   PUBMED; 19955411.
RA   Zhuang H., Chien M.-S., Matsunami H.;
RT   "Dynamic functional evolution of an odorant receptor for
RT   sex-steroid-derived odors in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(50):21247-21251(2009).
XX
RN   [2]
RP   1-939
RA   Zhuang H., Chien M.-S., Matsunami H.;
RT   ;
RL   Submitted (29-OCT-2009) to the INSDC.
RL   Department of Molecular Genetics and Microbiology, Duke University, 264
RL   CARL Building, Research Drive, Durham, NC 27710, USA
XX
DR   MD5; ae2fe24c532c05b2ada62001f31e2dbb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Gorilla gorilla"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9593"
FT   gene            1..939
FT                   /gene="OR7D4"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /gene="OR7D4"
FT                   /product="olfactory receptor family 7 subfamily D member 4"
FT                   /db_xref="GOA:D1MFA3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:D1MFA3"
FT                   /protein_id="ACZ52483.1"
FT                   /translation="MEAENLTELSKFLLLGFSDDPELQPVLFGLFLSMYLVTVLGNLLI
FT                   ILAVSSDSHLHTPMYFFLSNLSFVDICFISTTVPKMLVNIQARIKDISYMGCLTQVYFL
FT                   MMFAGMDTFLLAVMAYDRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHVLLM
FT                   KRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIV
FT                   SSLMRTSSTKGKYKAFSTCGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSMASVMYAMV
FT                   TPMLNPFIYSLRNKDVKGALERLLSRADSCP"
XX
SQ   Sequence 939 BP; 183 A; 284 C; 204 G; 268 T; 0 other;
     atggaagcag aaaaccttac agaactatca aaatttctcc tcctgggatt ctcagatgat        60
     cctgaactgc agcccgtcct ctttgggctg ttcctgtcca tgtacctggt cacagtgcta       120
     gggaacctgc tcatcatcct ggccgtcagc tctgactccc acctccacac ccccatgtac       180
     ttcttcctct ccaacctgtc ctttgtggac atctgtttca tctccaccac agtccccaag       240
     atgctagtga acatccaggc acggatcaaa gacatctcct acatggggtg cctcactcag       300
     gtgtattttt taatgatgtt tgctggaatg gatactttcc tactggccgt gatggcctat       360
     gaccggtttg tggccatctg ccaccccctg cactacacgg tcatcatgaa cccctgcctc       420
     tgtggcctcc tggttctggc atcttggttc atcattttct ggttctcgct ggttcatgtt       480
     ctactgatga agaggttgac cttctccaca ggcactgaga ttccgcattt cttctgtgaa       540
     ccggctcagg tcctcaaggt ggcctgctct aacaccctcc tcaataacat tgtcttgtat       600
     gtggccacgg cactgctggg tgtgtttcct gtagctggga tcctcttctc ctactctcag       660
     attgtctcct ccttaatgag aacgtcctcc accaagggca agtacaaagc cttttccacc       720
     tgtggatctc acctctgtgt ggtctccttg ttctatggaa caggacttgg ggtctatctg       780
     agttctgctg tgacccattc ttcccagagc agctccatgg cctcagtgat gtacgccatg       840
     gtcaccccca tgctgaaccc cttcatctac agcctgagga acaaggatgt gaagggggcc       900
     ctggaaagac tcctcagcag ggccgactct tgtccatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page