(data stored in ACNUC10243 zone)

EMBL: HM047135

ID   HM047135; SV 1; linear; mRNA; STD; INV; 1782 BP.
XX
AC   HM047135;
XX
DT   06-JUN-2010 (Rel. 105, Created)
DT   06-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Acyrthosiphon pisum strain YR2 Nup98 (Nup98) mRNA, partial cds.
XX
KW   .
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-1782
RA   Cortes T., Martinez-Torres D.;
RT   ;
RL   Submitted (31-MAR-2010) to the INSDC.
RL   Institut Cavanilles de Biodiversitat i Biologia Evolutiva, Universitat de
RL   Valencia, Apdo. Correos 22085, Valencia 46071, Spain
XX
DR   MD5; 08ca2c955df2a17be74cd32f36daec40.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1782
FT                   /organism="Acyrthosiphon pisum"
FT                   /strain="YR2"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adults"
FT                   /note="holocyclic"
FT                   /db_xref="taxon:7029"
FT   gene            1..>1782
FT                   /gene="Nup98"
FT                   /note="Ap-Nup98"
FT   CDS_pept        178..>1782
FT                   /codon_start=1
FT                   /gene="Nup98"
FT                   /product="Nup98"
FT                   /note="constituent of the nuclear pore"
FT                   /db_xref="GOA:D7RA99"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR037637"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="UniProtKB/TrEMBL:D7RA99"
FT                   /protein_id="ADI24739.1"
FT                   /translation="MTGSGSGAFSGATGNTSGFGQSAFGKPAAPAVFGQTNTSLFNQTT
FT                   QPNTGLFGSTAAAPAFGQTPTAQPTFGGFNTGGTSLFGTPTATSASTGGLFGQQNASMG
FT                   GNTGGGLFGSSNPNTSFGQSKPVGTGFAFGTPVAQPTGNIFGTPQASTAGTGMFGASTT
FT                   GTFGATTGFGATSAGGTTIKFNPVTGTDTMVRNGVNQTINTRHQSITVMKEYDTKIFEE
FT                   LRFEDYSANRKVGQQGAVGGGIFGSPKTLFSSTTTTSTGLFGANDNKPLFGATSTTPAL
FT                   GGFGNTGTSNVFGAQNSIFGKPQQPTSAFGTQPSTQPFGMNTTQPNIFGSNTAQTAKPF
FT                   GVAAPQTNIFGSTAPSTFGTQTTGFGQTGFGQPAQNNLFGQNKPAFGLGSTQTTTGFGF
FT                   GTNTSTSANGLFGSKPANTGFQMTTPAFGTNNAFGSTSTAQPATGGLFGSNAFNKAPTT
FT                   SLFNQPTNQQTGVFNNAAKPGGLFGQGTQGSGLFGSSNPSTFGTGGTSFFGNSQQAGGI
FT                   GLFGNTNNVQLSTNQASQ"
XX
SQ   Sequence 1782 BP; 556 A; 348 C; 344 G; 534 T; 0 other;
     atccagtttg accaaaccca gtagactaga atgtttggta agtggtttga gtatttcgtt        60
     attaatagtt attttattac attattatta tacatacatt aagaaatttg ttaaaataat       120
     tgtacaaaat tatatttatc aactttaacg ttatctttat tttatgttgt actaaatatg       180
     acaggttctg gatcaggtgc attctccggc gcgaccggaa acacgtcagg atttggtcag       240
     tcagcatttg gtaagcccgc agcccctgca gtatttggtc aaacaaatac atcactattt       300
     aatcaaacta cacagcctaa tacgggatta tttgggtcta ctgctgctgc gcctgcattt       360
     ggtcagacac ctaccgctca accaacattt ggaggtttca ataccggtgg aacttcactg       420
     tttggaactc ctacagcaac atcggcatct actggagggt tatttggcca gcaaaatgct       480
     tcgatggggg gaaatactgg aggtggatta tttggttcta gtaatcctaa tacttcattt       540
     ggacaatcaa aaccagttgg aacaggattc gcttttggaa caccagtcgc gcagccaact       600
     ggtaatatat ttggtacacc tcaagcgagc actgcaggaa ccggaatgtt tggagcttct       660
     actactggta cctttggtgc tacaacagga tttggagcaa catctgctgg tggcacaacc       720
     ataaaattta atcctgtaac tggtactgat acaatggtca gaaatggtgt aaatcaaaca       780
     attaatacta gacatcaatc aataactgtt atgaaagaat atgacacaaa aatatttgag       840
     gaacttagat ttgaagatta ttctgcaaac cgcaaagttg gacaacaggg tgctgttggc       900
     ggcggaattt tcggatctcc taaaacgttg tttagttcta caacaacgac aagtacgggt       960
     ttatttggag cgaatgataa taaaccactt tttggtgcta cctcaacaac acctgcactt      1020
     ggaggatttg gaaacactgg tacttcaaat gtttttgggg cacaaaatag catatttgga      1080
     aaacctcaac aaccaacatc agcatttggt actcaaccat ctactcaacc atttggtatg      1140
     aatacaactc aaccaaatat ttttggatct aatacagctc aaacagctaa accatttgga      1200
     gttgctgctc ctcagacaaa tatatttgga agtactgctc cttcaacttt tggtactcaa      1260
     actactgggt ttggtcaaac tggattcgga caacccgctc agaacaattt atttggtcaa      1320
     aataaaccag catttggtct tggatcaaca caaacaacaa caggttttgg ttttggaact      1380
     aatacatcta ctagtgcaaa tggtcttttt gggagtaaac ctgctaatac tggttttcaa      1440
     atgactactc cagcttttgg tacaaacaat gcttttggat ctacatctac agcacaacca      1500
     gctactggtg gattatttgg ttctaatgct tttaataagg ctccaaccac atcattgttt      1560
     aatcaaccaa caaatcaaca aacaggtgta tttaataatg cggcaaaacc tggagggtta      1620
     tttggacaag gaacacaagg aagtggactt tttggatctt ctaatcctag tacttttggt      1680
     acaggtggta catcattttt tggtaatagc caacaagctg gtggaattgg actttttgga      1740
     aataccaata acgttcaact atctacaaat caggcatcac ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page