(data stored in ACNUC16935 zone)

EMBL: HQ318095

ID   HQ318095; SV 1; linear; mRNA; STD; MAM; 404 BP.
XX
AC   HQ318095;
XX
DT   04-APR-2011 (Rel. 108, Created)
DT   04-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Ailuropoda melanoleuca ribosomal protein L40 (Rpl40) mRNA, complete cds.
XX
KW   .
XX
OS   Ailuropoda melanoleuca (giant panda)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda.
XX
RN   [1]
RP   1-404
RA   Hou Y., Hou W.;
RT   ;
RL   Submitted (25-SEP-2010) to the INSDC.
RL   College of Life Science, China West Normal University, 44# Yuying Road,
RL   Nanchong, SiChuan 637002, China
XX
DR   MD5; 346b5c20d9e3a83b597d39d96b7015b6.
DR   Ensembl-Gn; ENSAMEG00000011356; ailuropoda_melanoleuca.
DR   Ensembl-Tr; ENSAMET00000012457; ailuropoda_melanoleuca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..404
FT                   /organism="Ailuropoda melanoleuca"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9646"
FT   gene            1..404
FT                   /gene="Rpl40"
FT   CDS_pept        15..401
FT                   /codon_start=1
FT                   /gene="Rpl40"
FT                   /product="ribosomal protein L40"
FT                   /db_xref="GOA:D2GV37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D2GV37"
FT                   /protein_id="AEA39530.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
XX
SQ   Sequence 404 BP; 112 A; 125 C; 100 G; 67 T; 0 other;
     cagcagacgc agagatgcag atctttgtga agaccctgac gggcaagacc atcacccttg        60
     aggtcgagcc cagtgacacc attgagaatg tcaaagccaa aatccaagac aaggagggca       120
     tcccgcctga ccaacagcgt ctgatttttg cgggcaaaca gctggaagat ggccgcactc       180
     tgtcagacta caatatccag aaagagtcca ccctacactt ggtgcttcgc ctccggggtg       240
     gcatcatcga gccttccctc cgccagctgg cccagaagta caactgcgac aagatgatct       300
     gccgcaagtg ttatgctcgc ctgcaccccc gcgccgtcaa ctgccgcaag aagaagtgcg       360
     gtcacaccaa caacctgcgc cccaaaaaga aggtcaaata aggc                        404
//

If you have problems or comments...

PBIL Back to PBIL home page