(data stored in ACNUC16935 zone)

EMBL: HQ318096

ID   HQ318096; SV 1; linear; genomic DNA; STD; MAM; 2191 BP.
XX
AC   HQ318096;
XX
DT   04-APR-2011 (Rel. 108, Created)
DT   04-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Ailuropoda melanoleuca ribosomal protein L40 (Rpl40) gene, complete cds.
XX
KW   .
XX
OS   Ailuropoda melanoleuca (giant panda)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda.
XX
RN   [1]
RP   1-2191
RA   Hou Y., Hou W., Zhang T.;
RT   ;
RL   Submitted (25-SEP-2010) to the INSDC.
RL   College of Life Science, China West Normal University, 44# Yuying Road,
RL   Nanchong, SiChuan 637002, China
XX
DR   MD5; d8d324956388298b06d21b471e4fa842.
DR   Ensembl-Gn; ENSAMEG00000011356; ailuropoda_melanoleuca.
DR   Ensembl-Tr; ENSAMET00000012457; ailuropoda_melanoleuca.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2191
FT                   /organism="Ailuropoda melanoleuca"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9646"
FT   gene            <15..>2188
FT                   /gene="Rpl40"
FT   mRNA            join(<15..117,367..453,1902..2004,2095..>2188)
FT                   /gene="Rpl40"
FT                   /product="ribosomal protein L40"
FT   CDS_pept        join(15..117,367..453,1902..2004,2095..2188)
FT                   /codon_start=1
FT                   /gene="Rpl40"
FT                   /product="ribosomal protein L40"
FT                   /db_xref="GOA:D2GV37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D2GV37"
FT                   /protein_id="AEA39580.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
XX
SQ   Sequence 2191 BP; 493 A; 528 C; 551 G; 619 T; 0 other;
     cagcagacgc agagatgcag atctttgtga agaccctgac gggcaagacc atcacccttg        60
     aggtcgagcc cagtgacacc attgagaatg tcaaagccaa aatccaagac aaggagggtg       120
     agttgggctg agtccaaagg ctgtccctca ggagtcccca gcccagagga gccactgtta       180
     tgtgcaagat gggtgctggg ctcatagtac ttcccctctg tgatcttggg aaggcagctt       240
     gttctctcta ccttagtttc tcttttgaca gattgggggt aatgccagag catccctgtg       300
     gggagaggag aagctgctaa taatatgctt gccagagcct cagtaactga actttcttct       360
     ctccaggcat cccgcctgac caacagcgtc tgatttttgc gggcaaacag ctggaagatg       420
     gccgcactct gtcagactac aatatccaga aaggtactgg gggtagggtg gctggacagg       480
     gccccattaa gtctaggacc gaggctcaag ctttgatggc ctcattggca atgggtggga       540
     ggtggctgtc ttaaggtgaa gatcagatgg tgctgatgag tcgtattttt atgaagtaat       600
     gttttcatcg aggggaggca tcttatggtc tccacttagg tttccaagtg gcagtggttt       660
     ctcatattct tgcttacctt tttttttttt tttttttaag actgttttgt tttaaaatgc       720
     agtaaaacag tatttggctg gctcagtcag taaagcatgg gattcttgat ctcagggttg       780
     tgagttcaag ccccatgtcg ggtgtagaca ttacttaaaa ataaaatcct aaggatgtct       840
     aggtggctca gtaggttaag tatctgcttt tggcttaagt catggtccca ggagtcctgc       900
     attgggctcc ttgctcatca tcagggagcc tgtctccctc tgcctgccgt tcccctgctt       960
     gtacacactc tctctctgac aaataaaatc tttaaaatga taaaatcttg gggaaaaaat      1020
     gatacgagaa attttatcac tataaggaaa attggtgcca cgttttgcgt tgttgttttc      1080
     ttttcccccc aagagtttat tttggggcac gtgggtggct cagtaggtta agcgatggac      1140
     tcttgatttc agctggggtc atgagctcag ggtcctagga ttcagcccca agtcaggctt      1200
     agcagggagt ttgcttggga ttctctctcc cccttcctct accctttccc ctgcttgtgc      1260
     tctctctatc tctaaaataa ataaaagctt ttttaaaaag aaagatttta gggacttctg      1320
     ggtggctagt tggttaagca actgcctttg gttcaggtca tgatctcagg gtatgggatc      1380
     aagacccgta tctggctttt tgcttgcggg aagtctgctt ctccctctgc ctgctgctcc      1440
     ccctgcttgt gcttgcttgc tgacaacaca cacacacaca cactctctct ctctctctct      1500
     ctctgacaaa atcttaaaaa aagtaataat aaatatttta tttttatcag gagtcacatg      1560
     ctctactgaa taagccagct aggtatcccc ttgaagtcac tttttgtagc aactagattt      1620
     attttgctca gcaaagtgaa atcatctttg caccgcttag aaattgcctt gtctgtctgg      1680
     aaaccccagt gcccactata gttggcatat attagcctca gactccccaa gggcaagtgg      1740
     gaagtgacag ggaggttctg tggggtggtg tgagccagtg tgtccatctc cgtgtcgaac      1800
     accccatcac atttgagaag ctctggtctg gaggaccctg ctctgcaccg gaggtgctgg      1860
     ggccgggctc agtcactgcc tctctttaac cctcccttaa gagtccaccc tacacttggt      1920
     gcttcgcctc cggggtggca tcatcgagcc ttccctccgc cagctggccc agaagtacaa      1980
     ctgcgacaag atgatctgcc gcaagtgggt cctcttgggg ggggggtggc tgccttggtg      2040
     gggagggctt ggagttgggg tgtgccctca ccagtcgctc tcatctctgt gcaggtgtta      2100
     tgctcgcctg cacccccgcg ccgtcaactg ccgcaagaag aagtgcggtc acaccaacaa      2160
     cctgcgcccc aaaaagaagg tcaaataagg c                                     2191
//

If you have problems or comments...

PBIL Back to PBIL home page