(data stored in SCRATCH zone)

GenBank: BACPURF

LOCUS       BACPURF                13339 bp    DNA     linear   BCT 26-APR-1993
DEFINITION  B.subtilis pur operon encoding purine biosynthesis enzymes, 12
            genes.
ACCESSION   J02732 K00047
VERSION     J02732.1
KEYWORDS    adenylosuccinate lyase; inosine monophosphate cyclohydrolase;
            phosphoribosyl aminoimidazole carboxylase; phosphoribosyl
            aminoimidazole succinocarboxamide synthetase; phosphoribosyl
            aminoimidazole synthetase; phosphoribosyl glycinamide carboxymide
            formyltransferase; phosphoribosylformyl glycinamidine synthetase;
            phosphoribosylpyrophosphate amidotransferase.
SOURCE      Bacillus subtilis
  ORGANISM  Bacillus subtilis
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 7176 to 8826)
  AUTHORS   Makaroff,C.A., Zalkin,H., Switzer,R.L. and Vollmer,S.J.
  TITLE     Cloning of the Bacillus subtilis glutamine
            phosphoribosylpyrophosphate amidotransferase gene in Escherichia
            coli. Nucleotide sequence determination and properties of the
            plasmid-encoded enzyme
  JOURNAL   J. Biol. Chem. 258 (17), 10586-10593 (1983)
   PUBMED   6411717
REFERENCE   2  (bases 1 to 13339)
  AUTHORS   Ebbole,D.J. and Zalkin,H.
  TITLE     Cloning and characterization of a 12-gene cluster from Bacillus
            subtilis encoding nine enzymes for de novo purine nucleotide
            synthesis
  JOURNAL   J. Biol. Chem. 262 (17), 8274-8287 (1987)
   PUBMED   3036807
REFERENCE   3  (bases 146 to 471)
  AUTHORS   Ebbole,D.J. and Zalkin,H.
  TITLE     Detection of pur operon-attenuated mRNA and accumulated degradation
            intermediates in Bacillus subtilis
  JOURNAL   J. Biol. Chem. 263 (22), 10894-10902 (1988)
   PUBMED   3134353
COMMENT     Original source text: B.subtilis (strain DE1 (prototroph DER. or
            W168)) DNA, clone pPZ2 [1].
            Draft entry and computer-readable sequence for [2] kindly provided
            by D.J.Ebbole, 13-APR-1987.
            The -10 and -35 regions are located at positions 164-169 and
            187-192.  An antiterminator is found at 276-373 and terminators at
            347-394, 8711-8737 and 13246-13339.  Dyad symmetries are positioned
            at 3346-3378 and 3365-3419.
FEATURES             Location/Qualifiers
     source          1..13339
                     /organism="Bacillus subtilis"
                     /mol_type="genomic DNA"
                     /strain="W168"
                     /sub_strain="PY79"
                     /db_xref="taxon:1423"
     mRNA            197..>927
                     /product="PUR mRNA"
     misc_feature    276..373
                     /note="antiterminator dyad"
     misc_feature    377..396
                     /note="terminator dyad"
     CDS_pept        439..927
                     /note="phosphoribosyl aminoimidazole carboxylase I
                     (PUR-E)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22674.1"
                     /translation="MQPLVGIIMGSTSDWETMKHACDILDELNVPYEKKVVSAHRTPD
                     FMFEYAETARERGIKVIIAGAGGAAHLPGMTAAKTTLPVIGVPVQSKALNGMDSLLSI
                     VQMPGGVPVATTSIGKAGAVNAGLLAAQILSAFDEDLARKLDERRENTKQTVLESSDQ
                     LV"
     CDS_pept        920..2059
                     /note="phosphoribosyl aminoimidazole carboxylase II
                     (PUR-K; ttg start codon)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22675.1"
                     /translation="MSKQIIYPGAVIGIIGGGQLGKMMAVSAKQMGYKVAVVDPVKDS
                     PCGQVADVEITAHYNDREAIRKLAEISDIITYEFENIDYDALHWLKDHAYLPQGSELL
                     LITQNRETEKKAIQSAGCEVAPYSIVKTKNELKQAVQELRLPAVLKTCRGGYDGKGQF
                     VIKEEAQMEQAAALLEHGTCILESWVSFKMELSVIVVRSVNGEISTFPTAENIHHNNI
                     LFQSIVPAVEKGIQQKAADLAVKLADELNLVGPLAVEMFLTEDGELLVNELAPRPHNS
                     GHYTLDLCETSQFEQHIRAVCGLPLGKTDLLKPGMMVNLLGDEVKLVEEDPELLKEAK
                     LYIYGKHEIKKGRKMGHITFMKQPEDEWIQEITNKWMNRDGGQAE"
     CDS_pept        2056..3351
                     /note="adenylosuccinate lyase (PUR-B)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22676.1"
                     /translation="MIERYSRPEMSAIWTDENRFQAWLEVEILACEAWAELGVIPKED
                     VKVMRENASFDINRILEIEKDTRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTAL
                     SYLLKQANDILLKDLERFVDIIKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLALWHEE
                     MKRNLERFKQAKAGIEVGKISGAVGTYANIDPFVEQYVCEKLGLKAAPISTQTLQRDR
                     HADYMATLALIATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSEN
                     MTGMARVIRGYMMTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFSNIVKNL
                     TVFPENMKRNMDRTLGLIYSQRVLLALIDTGLTREEAYDTVQPKAMEAWEKQVPFREL
                     VEAEEKITSRLSPEKIADCFDYNYHLKNVDLIFERLGLA"
     CDS_pept        3424..4149
                     /note="phosphoribosyl aminoidazole succinocarboxamide
                     synthetase (PUR-C; gtg start codon)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22677.1"
                     /translation="MNIVKNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAE
                     ISGKGRLNNEISSLIFKHLHAKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGS
                     MSKRLGIPEGTELEQPIIEFYYKDDALGDPLITEDHIWLLKAATPEQVETIKSITTIV
                     NEELQSIFDDCHVRLIDFKLEFGLDAEGQVLLADEISPDTCRLWDKETNEKLDKDLFR
                     RNLGSLTDAYEEIFNRLGGIHHV"
     CDS_pept        4393..5076
                     /note="phosphoribosylformyl glycinamidine synthetase I
                     (PUR-L; gtg start codon)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22678.1"
                     /translation="MKFAVIVLPGSNCDIDMYHAVKDELGHEVEYVWHEETSLDGFDG
                     VLIPGGFSYGDYLRCGAIARFANIMPAVKQAAAEGKPVLGVCNGFQILQELGLLPGAM
                     RRNKDLKFICRPVELIVQNDETLFTASYEKGESITIPVAHGEGNFYCDDETLATLKEN
                     NQIAFTYGSNINGSVSDIAGVVNEKGNVLGMMPHPERAVDELLGSADGLKLFQSIVKN
                     WRETHVTTA"
     CDS_pept        5060..7288
                     /note="phosphoribosylformyl glycinamidine synthetase II
                     (PUR-Q)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22679.1"
                     /translation="MSLLLEPSKEQIKEEKLYQQMGVSDDEFALIESILGRLPNYTEI
                     GIFSVMWSEHCSYKNSKPILRKFPTSGERVLQGPGEGAGIVDIGDNQAVVFKIESHNH
                     PSALEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEEVVAGIAG
                     YGNCIGIPTVGGEVQFDSSYEGNPLVNAMCVGLINHEDIKKGQAKGVGNTVMYVGAKT
                     GRDGIHGATFASEEMSDSSEEKRSAVQVGDPFMEKLLLEACLEVIQCDALVGIQDMGA
                     AGLTSSSAEMASKAGSGIEMNLDLIPQRETGMTAYEMMLSESQERMLLVIERGREQEI
                     IDIFDKYDLEAVSVGHVTDDKMLRLTHKGEVVCELPVDALAEEAPVYHKPSQEPAYYR
                     EFLETDVPAPQIEDANEMLKALLQQPTIASKEWVYDQYDYMVRTNTVVAPGSDAGVLR
                     IRGTKKALAMTTDCNARYLYLDPEVGGKIAVAEAARNIICSGAEPLAVTDNLNFGNPE
                     KPEILWQIEKAADGISEACNVLSTPVIGGNVSLYNESNGTAIYPTPVIGMVGLIEDTA
                     HITTQHFKQAGDLVYVIGETKPEFAGSELQKMTEGRIYGKAPQIDLDVELSRQKALLD
                     AIKKGFVQSAHDVSEGGLGVAIAESVMTTENLGANVTVEGEAALLFSESQSRFVVSVK
                     KEHQAAFEATVKDAVHIGEVTADGILAIQNQDGQQMIHAQTKELERVWKGAIPCLLKS
                     KA"
     CDS_pept        7264..8694
                     /note="phosphoribosylpyrophosphate amidotransferase
                     (PUR-F; EC 2.4.2.14)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22680.1"
                     /translation="MLAEIKGLNEECGVFGIWGHEEAPQITYYGLHSLQHRGQEGAGI
                     VATDGEKLTAHKGQGLITEVFQNGELSKVKGKGAIGHVRYATAGGGGYENVQPLLFRS
                     QNNGSLALAHNGNLVNATQLKQQLENQGSIFQTSSDTEVLAHLIKRSGHFTLKDQIKN
                     SLSMLKGAYAFLIMTETEMIVALDPNGLRPLSIGMMGDAYVVASETCAFDVVGATYLR
                     EVEPGEMLIINDEGMKSERFSMNINRSICSMEYIYFSRPDSNIDGINVHSARKNLGKM
                     LAQESAVEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQALREQ
                     GVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVKISSPPIAHP
                     CFYGIDTSTHEELIASSHSVGEIRQEIGADTLSFLSVEGLLKGIGRKYDDSNCGQCLA
                     CFTGKYPTEIYQDTVLPHVKEAVLTK"
     CDS_pept        8796..9836
                     /note="phosphoribosyl aminoimidazole synthetase (PUR-M)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22681.1"
                     /translation="MSEAYKNAGVDIEAGYEAVKRMKKHVERTKRLGVMGSLGGFGGM
                     FDLSELSYQKPVLISGTDGVGTKLKLAFSMDKHDTIGVDAVAMCVNDVLAQGAEPLFF
                     LDYLAVGKADPVKIEQIVQGVAEGCEQSGSALVGGETAEMPGLYTADEYDIAGFSVGV
                     AEKDEIVTGEKIEEGHLLIGLSSSGLHSNGFSLVRKVLLDDAAWDLDTTYEPFERPLG
                     QELVEPTRIYVKPVLAAVKSGKIDGMAHVTGGGFIENIPRMLPEGLSAEIDHGSWPIP
                     PIFSFLQEYGKLKEEDMFNVFNMGIGFVLAVKEEHLTDVIGTLESHGEKAYLIGRVKK
                     GEGVTFGGAALS"
     CDS_pept        9833..10420
                     /note="phosphoribosyl glycinamide formyltransferase
                     (PUR-N)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22682.1"
                     /translation="MKKFAVFASGNGSNFEAIVTRLKEENWDASRALLVCDKPQAKVI
                     ERAERFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYG
                     GKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEH
                     DTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA"
     CDS_pept        10417..11955
                     /note="phosphoribosyl aminoimidazole carboxy formyl
                     formyltransferase/inosine monophosphate cyclohydrolase
                     (PUR-H(J))"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22683.1"
                     /translation="MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTKKLLQENG
                     VDVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVN
                     LYPFKETISKEDVTYEEAIENIDIGGPGMLRAASKNHQDVTVIVDPADYSPVLNQIKE
                     EGSVSLQKKRELAAKVFRHTAAYDALIADYLTNVVGEKEPEQFTVTFEKKQSLRYGEN
                     PHQEATFYQTALPVKGSIAQAEQLHGKELSYNNIKDADAAVQIVREFTEPAAVAVKHM
                     NPCGVGTGKTIAEAFDRAFEADKTSIFGGIIALNREVDKATAEALHNIFLEIIIAPSF
                     SQEALDVLTAKKNLRLVTLDVSAAVQKEKQLTSVQGGLLIQDLDMHGFDDAEISIPTK
                     REPNEQEWEDLKLAWKVVKHVKSNAIVLAKDNMTVGVGAGQMNRVGSAKIAIEQAGEK
                     AKGSALGSDAYFPMPDTVEEAAKAGVTAIIQPGGSIRDEDSIKKADEYGIAMVFTGIR
                     HFKH"
     CDS_pept        11971..13239
                     /note="phosphoribosyl glycinamide synthetase (PUR-D; gtg
                     start codon)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA22684.1"
                     /translation="MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLV
                     NIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGS
                     KQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEE
                     EAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFD
                     GDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTE
                     NGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASE
                     GYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARD
                     RVYKAVDEIFKPGLFFRKDIGARALKAAQK"
ORIGIN      3 bp upstream of EcoRV site; 18.0 mu on B.subtilis map.
        1 gatatctgcc tgtaaggcga atggaagagc ctatttttat ggaaaaaaag gaaaatgggt
       61 caattcagat cgttccgtgc gggaaaaaaa tcgtatttga agggaaattg atctaaaaca
      121 cgaacattag tagaatgaat ttttgtatcg ttcgataata tcgttgacat tatccatgtc
      181 cgttgttaag ataaacatga aatcaaaaca cgacctcata taatcttggg aatatggccc
      241 ataagtttct acccggcaac cgtaaattgc cggactatgc aggaaagtga tcgataaaac
      301 tgacatggat atatcgcaga agcgaacgac tgacgataca tgtaccatgc ccggtttgta
      361 ttgcttcctc ataagtgcaa tgcagagcgg gtatttttta ttttctgaaa acaaaagcat
      421 tagaaggtgg ggaacagaat gcagccgcta gtaggaatca tcatgggaag cacttccgat
      481 tgggagacaa tgaaacacgc atgcgacata cttgacgaac tcaatgttcc gtacgaaaaa
      541 aaggtcgttt ccgctcaccg gacgcctgat ttcatgtttg aatatgctga aactgctaga
      601 gaaagaggca tcaaggtgat tattgccggt gccggaggag cggcgcatct gccagggatg
      661 acggctgcga aaacaacact gccagtcatt ggagttccgg ttcagtccaa ggcgctgaac
      721 ggaatggatt cacttctttc catcgtccaa atgcctggag gcgtgcctgt tgcgacaaca
      781 tccatcggca aagcgggtgc tgtgaacgca ggcctgttag cggcgcaaat tttgtcagca
      841 tttgacgaag accttgcccg taagctggat gagagaagag aaaatacaaa acagacagtg
      901 ttagaaagca gtgatcagct tgtctaaaca aatcatctat ccgggagctg taatcggcat
      961 tatcggcggc ggccagcttg ggaaaatgat ggctgtgtcc gccaaacaaa tggggtataa
     1021 agtcgcggtc gttgatccgg tgaaagattc gccgtgcggg caggttgcgg atgtcgaaat
     1081 taccgctcat tataatgacc gtgaagcgat tcgaaaattg gctgaaatca gcgatatcat
     1141 cacatatgag tttgaaaaca tcgactatga tgcgctgcat tggctaaaag atcatgcgta
     1201 tctcccgcaa ggaagtgagc tgctgcttat tacccaaaac cgtgaaacag agaaaaaagc
     1261 aattcaatcc gcgggctgtg aagtcgcacc gtacagcatc gtcaaaacaa agaatgaatt
     1321 gaaacaggca gtacaggagc tcaggcttcc ggcagtgctg aaaacatgcc gcggcgggta
     1381 cgacggcaaa ggccaatttg tgataaaaga agaggcgcaa atggagcagg cagccgctct
     1441 gttagaacac ggaacttgca ttcttgaaag ctgggtttct tttaaaatgg aactgtcggt
     1501 gatcgtcgtt agatcggtaa acggtgaaat ttcaacattt ccgacagctg aaaacattca
     1561 ccacaacaat attcttttcc aaagcatcgt gcccgcagta gagaaaggga ttcagcagaa
     1621 ggctgctgat ctcgcagtta agcttgcaga tgagcttaac cttgtcggac cgcttgctgt
     1681 tgagatgttc ctgacagagg acggagagct tttggtcaat gaactggcgc caagaccgca
     1741 caattcaggg cattatacgc tggacctttg cgagacgagc cagtttgagc agcatatcag
     1801 agcggtatgc gggcttccgc ttgggaagac agatttgctg aagccgggca tgatggtgaa
     1861 tcttctcggc gatgaagtga agcttgttga ggaagacccg gagcttttaa aagaggcaaa
     1921 gctatatata tacggaaaac atgaaatcaa aaaaggccgc aaaatggggc atattacatt
     1981 tatgaagcag cctgaagacg aatggattca ggagatcaca aataaatgga tgaatagaga
     2041 cggaggacaa gcagaatgat cgaacgttat tcaagacctg aaatgtccgc gatttggacg
     2101 gatgaaaaca gatttcaagc atggttagag gttgaaattc ttgcctgtga agcgtgggcg
     2161 gagcttggcg tcattccgaa agaagatgta aaggttatgc gcgaaaacgc gtcatttgac
     2221 atcaaccgca ttttagaaat cgaaaaggac acgcgccatg acgttgtcgc ttttacgcgc
     2281 gctgtatccg aatcactggg cgaagaaaga aaatgggtgc attacggctt aacgtcaact
     2341 gacgttgttg atacggctct ttcctactta ttaaaacagg caaacgatat tttgctcaag
     2401 gatcttgaga gatttgttga cattataaaa gaaaaagcga aagaacataa atacacagtc
     2461 atgatggggc gcacacacgg cgtacacgct gagcctacaa cattcggctt aaaacttgcg
     2521 ctttggcatg aagaaatgaa acgtaatctt gagcgcttca aacaagcgaa agcaggcatc
     2581 gaggttggaa agatttccgg tgctgtcggc acatatgcga acattgatcc atttgttgaa
     2641 caatatgtct gtgagaagct cggattgaaa gcagcaccga tttccactca aacccttcag
     2701 cgtgaccgcc atgctgacta tatggcaaca cttgctttga tcgcgacaag catcgagaaa
     2761 ttcgctgtgg aaatccgcgg actgcaaaag agtgaaacac gtgaagtaga ggaatttttc
     2821 gcgaaagggc aaaagggttc atctgcaatg ccgcataaac gaaatccgat tggctctgaa
     2881 aacatgacag gcatggcgcg cgtgatccgc ggctacatga tgacagctta cgaaaatgtt
     2941 ccattatggc atgagcgcga tatttctcat tcttcagcag aacgaattat tcttccggat
     3001 gcgacaattg cgctgaacta catgctgaac cgcttctcca acatcgtgaa gaacttaacg
     3061 gtcttcccgg aaaacatgaa gcgcaacatg gaccgcactc tcggccttat ctattctcag
     3121 cgtgtgctcc ttgctttgat tgacacaggc ctgactcgtg aagaagccta tgatacagtt
     3181 cagccgaaag caatggaagc gtgggaaaaa caagtgccgt tccgcgagct tgtggaagcg
     3241 gaagagaaaa tcacgtcacg tctttctcca gaaaaaattg ctgactgctt tgattacaat
     3301 taccatctga aaaatgttga tctgatcttt gaacgtttag gtttagcata gaagaagctt
     3361 ttacggcttc ttctaagccg ccgcagtttg aaaattccca acattcgggt taggaggcct
     3421 tccgtgaata ttgtgaagaa tgaactttta tacgaaggaa aagcaaaaaa gatctacaaa
     3481 accgatgacg aaaacacgct gtatgtcgtg tataaagact ccgccactgc ctttaacggc
     3541 gagaaaaaag cagaaatcag cggaaaaggg cgcttaaata atgaaatttc aagcctcatt
     3601 ttcaaacacc ttcatgctaa gggcattaac aatcatttta tcgagcgcat ttcggaaacg
     3661 gagcagctca ttaaaaaggt aacgattgtg ccgcttgaag tcgtggtaag aaatgttgtg
     3721 gcaggaagca tgtccaaacg tctcggcatt ccagaaggca cggagcttga gcagccgatt
     3781 atcgagtttt actacaagga tgacgcgctg ggtgatccgc tcatcacaga agatcatatt
     3841 tggcttttga aggcggcgac tcctgagcag gtagaaacca ttaagtccat tacaacaata
     3901 gtaaatgaag agcttcaaag catcttcgac gattgtcatg tcagattaat agatttcaag
     3961 cttgaattcg gtttagatgc agaagggcaa gtgcttttgg cggatgaaat atctcctgac
     4021 acatgccgct tgtgggataa agaaacgaac gaaaagctgg acaaagattt attcagacgc
     4081 aatctgggaa gcttaaccga cgcatacgaa gagattttca atagactggg aggcattcat
     4141 catgtataaa gtaaaagttt atgtcagctt aaaagaaagt gtactagatc cacaagggag
     4201 cgctgtccag catgccttgc acagtatgac ttacaacgaa gttcaagatg tgcgcatcgg
     4261 gaaatacatg gagcttacca ttgaaaaatc tgaccgtgat cttgacgtgc tagtgaaaga
     4321 aatgtgcgaa aaacttcttg cgaacacagt gattgaagat tatagatatg aggttgagga
     4381 ggtagtcgca cagtgaaatt tgcggtgatt gtgttacccg gctccaactg tgatatcgat
     4441 atgtatcatg ctgtaaagga tgagctcggc catgaagtgg aatacgtctg gcatgaggaa
     4501 acaagccttg acggcttcga cggcgtgtta attccgggag gattttctta cggcgattac
     4561 ttaagatgcg gcgccatcgc ccgatttgcg aatattatgc cagctgtcaa acaagcagcg
     4621 gctgaaggaa aacctgttct tggcgtctgt aacggattcc agattttaca ggagcttggg
     4681 ctgctgccag gcgcaatgag acgcaacaaa gatctgaagt tcatttgccg tccggttgaa
     4741 ttgattgttc agaacgacga aaccttattc acagcttcct acgaaaaggg agaatcgatt
     4801 acaatcccgg ttgcccatgg tgaagggaat ttctactgtg atgacgagac gcttgctaca
     4861 ttaaaggaaa acaatcaaat tgctttcaca tacggctcta atattaatgg aagtgtcagc
     4921 gacattgccg gtgtcgtgaa tgagaaaggc aatgtattag gcatgatgcc tcaccctgag
     4981 cgcgcggtcg atgaactgct tggaagcgcc gacggtctta aattgttcca gtctatcgtg
     5041 aaaaattgga gggaaactca tgtcactact gcttgaacca agtaaagaac aaataaaaga
     5101 agagaaactg tatcagcaaa tgggtgtcag tgatgatgag tttgcattga tagaatccat
     5161 tcttggaaga ttgccgaact acacagaaat cggaattttt tctgtcatgt ggtctgagca
     5221 ttgcagctat aaaaactcaa agccgattct gcgtaaattc ccgacaagcg gcgagcgtgt
     5281 gctgcagggg ccgggggaag gcgccggaat cgttgatatc ggtgataacc aagcggttgt
     5341 gttcaaaatt gaatcacata accacccatc agctctcgag ccttaccaag gcgctgcgac
     5401 tggcgtaggc ggaattatcc gtgatgtatt ctcaatgggt gcacgcccaa tcgctgtatt
     5461 gaactctctt cgatttggtg aactgacttc accccgcgtg aagtacttgt ttgaagaagt
     5521 agtagcgggt atcgccggat acggcaactg tatcggcatc ccgacagtcg gcggagaagt
     5581 gcagtttgac agcagctatg aaggaaatcc gctcgtcaac gcaatgtgcg tcggtttaat
     5641 caaccatgaa gacatcaaaa aaggccaggc aaagggtgtc ggcaacacag taatgtacgt
     5701 aggagcgaaa acagggcgtg acggcatcca cggcgctacg tttgcttctg aagaaatgtc
     5761 agactcgtct gaagaaaagc gttctgctgt ccaagtcggc gatccgttta tggagaagct
     5821 tttgcttgaa gcatgtctgg aagtcatcca atgcgacgcc ttagtcggca ttcaggatat
     5881 gggagctgcc ggtttaacaa gctcaagtgc agaaatggca agtaaagccg gttctggcat
     5941 tgaaatgaat cttgacctga ttcctcagcg cgaaacaggc atgaccgcgt atgaaatgat
     6001 gctttctgaa tcacaagaac ggatgctttt ggttattgag cgcggacgtg agcaggaaat
     6061 catcgatatt tttgacaagt atgatcttga agcggtttct gtcggacatg tgacagatga
     6121 taaaatgctt cgcctgacac ataaaggaga ggttgtgtgc gagctgcctg ttgatgcctt
     6181 ggcagaagaa gcaccggttt accataagcc ttctcaagag cctgcttact atcgcgagtt
     6241 tttggaaaca gacgttccgg ctccgcaaat tgaagatgcg aatgaaatgc tgaaggccct
     6301 tcttcagcag ccgacgattg cgagtaaaga gtgggtttat gatcagtatg actacatggt
     6361 gcgcacgaat acagttgtcg ctcctgggtc tgatgctggt gttctcagaa tccgcggaac
     6421 gaaaaaggcg ctggcgatga cgacagactg taacgcgcgt tatctctatc ttgatcctga
     6481 agtcggaggg aaaattgctg tcgctgaagc agcgcgcaac atcatttgct caggcgcaga
     6541 accgcttgcg gtgacagata accttaactt cggaaaccct gagaagccgg aaatcctctg
     6601 gcagatcgaa aaagcggcag acggcataag cgaagcgtgc aatgttctca gcactccggt
     6661 tatcggcggt aacgtatcgc tttataacga atcaaacggc acggcgatct atccgacacc
     6721 agttatcggc atggtcggcc taattgaaga tacagcgcac attacaacac agcatttcaa
     6781 acaagcagga gatctcgtat acgtgatcgg cgaaacaaaa ccagagtttg ccggaagcga
     6841 gctgcaaaaa atgacagaag gccgtattta cggcaaagcg ccgcaaatcg atcttgatgt
     6901 agagctgtct cgtcaaaaag cactgcttga cgcgattaaa aaaggcttcg ttcaatctgc
     6961 gcatgatgtg tctgaaggcg gcttaggcgt agcgattgcg gaaagtgtca tgacgacgga
     7021 aaaccttggc gctaatgtga ctgtagaagg ggaagcggcg ttattattct ctgaatctca
     7081 atctcgcttc gtcgtttcag tgaaaaaaga acatcaagct gcgtttgaag caactgtcaa
     7141 agatgcagtt catattggtg aggtaacagc tgacggaatt ctggcgattc aaaaccaaga
     7201 cggacaacaa atgattcatg cgcaaacgaa agagcttgaa cgcgtatgga aaggagctat
     7261 cccatgcttg ctgaaatcaa aggcttaaat gaagaatgcg gcgtttttgg gatttgggga
     7321 catgaagaag ccccgcaaat cacgtattac ggtctccaca gccttcagca ccgaggacag
     7381 gagggtgctg gcatcgtagc gactgacggt gaaaagctga cggctcacaa aggccaaggt
     7441 ctgatcactg aagtatttca aaacggcgaa ctcagcaaag taaagggaaa aggcgctatc
     7501 gggcacgttc ggtacgcaac ggctggaggc ggcggatacg aaaatgttca gccgctcctc
     7561 ttccgttccc aaaacaacgg cagcctggcg cttgctcata acggaaatct tgtcaacgcc
     7621 actcagctga agcagcagct cgaaaatcaa gggagcatct ttcaaacctc ttcggataca
     7681 gaggttttgg ctcacctgat caaaagaagc ggacacttca cgctgaagga tcaaattaaa
     7741 aactcgcttt ctatgctgaa aggcgcctac gcgttcctga tcatgaccga aacagaaatg
     7801 attgtcgcac ttgatccaaa cgggctgaga ccgctatcca tcggcatgat gggcgacgct
     7861 tatgtggtcg catcagaaac atgcgcattt gacgtcgtcg gcgcaacgta ccttcgcgag
     7921 gtagagccgg gagaaatgct gatcattaat gatgaaggca tgaaatcaga gcgtttttcc
     7981 atgaatatca atcgttccat ttgcagcatg gagtacattt atttctccag accagacagc
     8041 aatattgacg gtattaatgt gcacagtgcc cgtaaaaacc ttgggaaaat gctggctcag
     8101 gaatccgcag ttgaagctga cgtcgtaacc ggggttccgg attccagtat ttcagcggcg
     8161 atcggctatg cagaggcaac aggcattccg tatgagcttg gcttaatcaa aaaccgttat
     8221 gttggcagaa cgtttattca gccgtcccag gctctgcgtg agcaaggcgt cagaatgaag
     8281 ctgtctgcgg tgcgcggggt tgtagaaggc aaacgcgtcg tgatggtgga tgactctatc
     8341 gtgcgaggaa caactagccg ccggattgtc acgatgctaa gagaggcggg tgcgacagag
     8401 gtgcatgtga aaatcagttc accgccgatc gctcatccgt gcttttacgg cattgacact
     8461 tccacacatg aagaactgat cgcgtcttcg cattctgtcg gagaaatccg tcaggaaatc
     8521 ggagccgata ccctctcatt tttgagtgtg gaagggctgc tgaaaggcat cggcagaaaa
     8581 tacgatgact cgaattgcgg acagtgtctc gcttgcttta caggaaaata tccgactgaa
     8641 atttaccagg atacagtgct tcctcacgta aaagaagcag tattaaccaa ataaaacttg
     8701 aaaaatgaca taaaggcagc gcagttcggc tgcctttctc tttctgccct cgttcgggga
     8761 gatattttga aaagcgcctt aaaggagtga ataggatgtc tgaagcatat aaaaacgcag
     8821 gagttgacat cgaagccgga tatgaagctg taaaacgaat gaaaaaacac gtggagcgca
     8881 cgaaacggct tggcgttatg ggcagccttg gcggttttgg cggcatgttt gacctgtctg
     8941 agctttctta tcaaaaacca gttctcattt cgggaacgga cggtgtcggc acaaaattaa
     9001 agctcgcttt ttccatggat aagcatgaca cgattggcgt ggatgctgtt gcaatgtgtg
     9061 tcaatgacgt gctggcacaa ggtgcagagc cgctgttttt cctcgattat ttagcggttg
     9121 gcaaagcgga cccagtgaaa attgaacaga ttgtacaagg tgttgcggaa ggctgtgagc
     9181 agtcaggttc agccttagtc ggcggtgaaa cggctgaaat gccggggctc tatacagctg
     9241 atgaatacga tattgccggt ttctcagtcg gagtggcaga aaaggacgaa atcgtgactg
     9301 gagaaaaaat tgaagagggc catctgttga tcggcctcag ctccagcggc cttcacagca
     9361 acggcttttc ccttgtcaga aaagtgcttc tggatgatgc ggcgtgggac ctcgatacaa
     9421 catatgagcc gtttgaacgc ccgcttgggc aggaattggt tgaaccgaca aggatttacg
     9481 tgaagcctgt gcttgccgcg gtcaaaagcg gaaaaatcga cggcatggcg cacgtgacag
     9541 gcggaggatt tattgaaaat attccgcgta tgcttccgga aggcttaagt gcggaaattg
     9601 atcatggctc atggccgatc ccgccgattt tttctttctt gcaagagtac ggcaagctaa
     9661 aggaagaaga catgttcaac gtctttaata tgggtatcgg ttttgttttg gcagtcaaag
     9721 aagagcatct gacagatgtg atcggaacgc ttgaaagcca tggcgaaaaa gcctatttaa
     9781 tcgggcgtgt gaaaaaaggt gaaggcgtca cattcggcgg tgcggcactt tcatgaaaaa
     9841 gtttgcggta tttgcatcag gaaacggttc aaacttcgaa gccatcgtca cgcgtttgaa
     9901 ggaggagaac tgggatgcgt cacgagcgct cctcgtttgc gacaaaccgc aggcgaaagt
     9961 catcgaacgg gcggaacgat tccacattcc atccttcgca tttgagccga agtcttatga
    10021 aaacaaggct gcatttgaac aagccatcat tgaacagctt cgtcttcacg aggttgaatt
    10081 gattgctctt gccggctata tgaggctgat cggtgatacg ctccttcaag catatggggg
    10141 aaaaatcatt aacattcacc catcgcttct tccggcgttt cctggaatcg acgcagtcgg
    10201 acaggcgttc cgggcgggtg tgaaggtggc cggaatcacc gtgcattatg tcgatgaagg
    10261 aatggataca ggtccgatca tcgctcaaaa ggcaatcgaa attgatgaac atgatacatt
    10321 ggaaacaatc gaacagcgaa ttcacaagct tgagcataaa tggtatccga gtgtgattaa
    10381 acagctatta ggattaaata acagaggtga aaaggcatga ccattaaacg tgcattaatc
    10441 agtgtttcag ataaaacaaa tctcgttcct ttcgtaaaag aactgacaga gcttggcgtt
    10501 gaagtcatct ccacaggcgg aacgaaaaag cttcttcaag aaaacggtgt ggatgtgatc
    10561 ggaatttctg aagtgacagg ctttcctgaa attatggacg gccggttaaa aaccctacac
    10621 ccgaatattc acggcggcct tctggcggtt cgcggcaatg aagagcatat ggcgcagatc
    10681 aatgaacacg ggattcagcc gattgacctc gttgtcgtca acctctatcc atttaaagaa
    10741 acgatttcta aagaagacgt cacgtatgaa gaagcgatcg aaaatatcga catcggcgga
    10801 cctggcatgc tgcgcgcggc atcaaagaac catcaggatg tcacggttat cgtcgatccg
    10861 gccgattaca gcccagtgct aaatcaaatc aaagaagaag gcagcgtatc tcttcagaaa
    10921 aaacgcgagc tcgcggcaaa agtattccgt catactgcgg catatgatgc actgatcgct
    10981 gactatctga caaatgttgt cggtgaaaaa gaaccagagc aattcactgt gacatttgag
    11041 aaaaaacaat cgcttcgcta tggagaaaac ccgcatcagg aagcaacttt ctatcaaaca
    11101 gctcttcctg tcaaaggctc cattgcgcaa gcagaacagc ttcacggaaa agagctttct
    11161 tacaacaaca ttaaagacgc ggatgctgca gttcaaatcg ttcgtgaatt cactgaaccg
    11221 gctgctgttg ctgtgaagca tatgaacccg tgcggcgtgg gaacaggaaa aacgatcgca
    11281 gaagcgtttg acagagcgtt tgaagcggat aaaacatcta tcttcggcgg cattatcgcg
    11341 ctgaaccgtg aagtggacaa ggcaactgcc gaagcgcttc acaacatttt cttagaaatc
    11401 atcattgcgc cttcattcag ccaagaagcg ctcgacgtcc tgactgcgaa gaaaaatctc
    11461 cgtctcgtga cgcttgacgt atccgccgct gttcaaaagg aaaaacagct gacatccgtt
    11521 caaggcgggc tgctgattca agatttagat atgcacggct tcgatgatgc tgagattagc
    11581 attccgacaa aaagagagcc gaacgagcaa gagtgggaag acttgaagct tgcttggaaa
    11641 gtcgtgaagc atgtgaaatc aaatgcgatt gttctcgcga aggacaacat gacagtcggc
    11701 gtgggagcag gccaaatgaa ccgcgtcgga tcggcaaaaa tcgcaatcga gcaagcaggg
    11761 gaaaaagcga agggcagcgc gctcggttcg gatgcatatt tcccaatgcc agatactgtc
    11821 gaagaagcgg caaaagcggg cgttacagcc atcattcagc caggcggatc gatccgagat
    11881 gaggattcca tcaaaaaagc ggatgaatac ggcattgcca tggtattcac cggcatcaga
    11941 cacttcaaac attaagggga tgaaaacgac gtgaatgtat taattatcgg taaaggcgga
    12001 agagaacata cgctggcgtg gaaggcagcg caaagcagcc tcgtcgagaa tgtatttgcc
    12061 gctcccggaa atgacggcat ggcagcttcc gctcagcttg taaacattga ggaaagcgac
    12121 cacgcagggc ttgtctcatt tgcaaaacaa aatcaggtcg gcctgaccat tgtcggccct
    12181 gaggttcctt taattgaagg tctggtggat gaattcgaaa aagcgggctt acatgtgttc
    12241 ggtccgtcaa aagctgcggc gatcatcgaa ggaagcaaac agttcgctaa ggatttaatg
    12301 aagaaatacg acattccgac cgcagaatac gagacgttta catcctttga tgaggcgaag
    12361 gcatatgtgc aggaaaaagg tgctccgatt gtgataaaag cagatggact tgcagctgga
    12421 aaaggcgtta ctgtggctat gacagaggaa gaagcaattg cgtgcttgca tgactttctt
    12481 gaagatgaaa agttcggtga tgcgagcgcg tccgttgtca ttgaagaata tctttctggt
    12541 gaagaatttt ctctaatggc ctttgtcaaa ggggaaaagg tgtatccgat ggtgattgcc
    12601 caggatcaca agcgggcgtt tgacggagac aaaggcccga atacaggcgg catgggcgcc
    12661 tactcgccag ttccgcaaat ttcggaagaa acggtccgcc atgctgtaga aacgatcgtt
    12721 aagccggctg caaaagcaat ggtacaagaa ggccgttcct tcactggcgt tttgtacgct
    12781 ggattgatgc ttactgaaaa cggctcgaag gtcattgaat ttaatgcccg tttcggcgat
    12841 ccggaaacac aggtcgtgct tccgcgcatg gaatctgatc tggtacaggt gcttcttgat
    12901 cttttagatg ataaggaagt tgacttaaga tggaaggata ccgcggcagt gagtgttgtg
    12961 cttgcatcag aagggtatcc ggaaagctat gcaaaaggca cgccgatcgg cagccttgca
    13021 gcagaaactg agcaggtcgt ggtcttccat gccggaacga aagcagaagg tggagagttc
    13081 gttacaaacg gggggcgcgt cgccaatgtg acggcttttg atgaaacgtt tgaagcggct
    13141 agagaccgag tgtacaaagc ggttgatgaa attttcaaac cgggactctt tttcagaaaa
    13201 gacattgggg cacgcgcttt aaaggctgcc caaaaataag tgaggaaaac ccgcagaata
    13261 gctgcgggtt ttttgttatc aaaaagcggg atggcagcta gaagaagaaa gcacaacgag
    13321 cgtggttggt tttccatgg
//

If you have problems or comments...

PBIL Back to PBIL home page