(data stored in SCRATCH zone)

EMBL: J03133

ID   J03133; SV 1; linear; mRNA; STD; HUM; 2655 BP.
XX
AC   J03133;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Human transcription factor SP1 mRNA, 3' end.
XX
KW   transcription factor SP1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2655
RA   Kadonaga J.T., Carner K.R., Masiarz F.R., Tjian R.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RX   DOI; 10.1016/0092-8674(87)90594-0.
RX   PUBMED; 3319186.
RA   Kadonaga J.T., Carner K.R., Masiarz F.R., Tjian R.;
RT   "Isolation of cDNA encoding transcription factor Sp1 and functional
RT   analysis of the DNA binding domain";
RL   Cell 51(6):1079-1090(1987).
XX
DR   MD5; a161a3d5252732b8d155426d6a606c58.
DR   Ensembl-Gn; ENSG00000185591; homo_sapiens.
DR   Ensembl-Tr; ENST00000327443; homo_sapiens.
DR   Ensembl-Tr; ENST00000426431; homo_sapiens.
DR   EuropePMC; PMC109697; 9525578.
DR   EuropePMC; PMC1421504; 16582099.
XX
CC   [2]  sites; binding domains.
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by J.T.Kadonaga, 17-NOV-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2655
FT                   /organism="Homo sapiens"
FT                   /map="12q"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..2091
FT                   /codon_start=1
FT                   /gene="SP1"
FT                   /note="transcription factor Sp-1"
FT                   /db_xref="GOA:P08047"
FT                   /db_xref="H-InvDB:HIT000191130.14"
FT                   /db_xref="HGNC:HGNC:11205"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:1SP1"
FT                   /db_xref="PDB:1SP2"
FT                   /db_xref="PDB:1VA1"
FT                   /db_xref="PDB:1VA2"
FT                   /db_xref="PDB:1VA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08047"
FT                   /protein_id="AAA61154.1"
FT                   /translation="TGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGS
FT                   ESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATG
FT                   AQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQY
FT                   VTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLV
FT                   SSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNI
FT                   QQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQA
FT                   ISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQ
FT                   GVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPI
FT                   QGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTC
FT                   PYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGK
FT                   RFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTL
FT                   PLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGN
FT                   GF"
XX
SQ   Sequence 2655 BP; 717 A; 726 C; 630 G; 582 T; 0 other;
     acaggtgagc ttgacctcac agccacacaa ctttcacagg gtgccaatgg ctggcagatc        60
     atctcttcct cctctggggc tacccctacc tcaaaggaac agagtggcag cagtaccaat       120
     ggcagcaatg gcagtgagtc ttccaagaat cgcacagtct ctggtgggca gtatgttgtg       180
     gctgccgctc ccaacttaca gaaccagcaa gttctgacag gactacctgg agtgatgcct       240
     aatattcagt atcaagtaat cccacagttc cagaccgttg atgggcaaca gctgcagttt       300
     gctgccactg gggcccaagt gcagcaggat ggttctggtc aaatacagat cataccaggt       360
     gcaaaccaac agattatcac aaatcgagga agtggaggca acatcattgc tgctatgcca       420
     aacctactcc agcaggctgt ccccctccaa ggcctggcta ataatgtact ctcaggacag       480
     actcagtatg tgaccaatgt accagtggcc ctgaatggga acatcacctt gctacctgtc       540
     aacagcgttt ctgcagctac cttgactccc agctctcagg cagtcacgat cagcagctct       600
     gggtcccagg agagtggctc acagcctgtc acctcaggga ctaccatcag ttctgccagc       660
     ttggtatcat cacaagccag ttccagctcc tttttcacca atgccaatag ctactcaact       720
     actactacca ccagcaacat gggaattatg aactttacta ccagtggatc atcagggacc       780
     aactctcaag gccagacacc ccagagggtc agtgggctac aggggtctga tgctctgaac       840
     atccagcaaa accagacatc tggaggctca ttgcaagcag gccagcaaaa agaaggagag       900
     caaaaccagc agacacagca gcaacaaatt cttatccagc ctcagctagt tcaaggggga       960
     caggccctcc aggccctcca agcagcacca ttgtcagggc agacctttac aactcaagcc      1020
     atctcccagg aaaccctcca gaacctccag cttcaggctg ttccaaactc tggtcccatc      1080
     atcatccgga caccaacagt ggggcccaat ggacaggtca gttggcagac tctacagctg      1140
     cagaacctcc aagttcagaa cccacaagcc caaacaatca ccttagcccc aatgcagggt      1200
     gtttccttgg ggcagaccag cagcagcaac accactctca cacccattgc ctcagctgct      1260
     tccattcctg ctggcacagt cactgtgaat gctgctcaac tctcctccat gccaggcctc      1320
     cagaccatta acctcagtgc attgggtact tcaggaatcc aggtgcaccc aattcaaggc      1380
     ctgccgttgg ctatagcaaa tgccccaggt gatcatggag ctcagcttgg tctccatggg      1440
     gctggtggtg atggaataca tgatgacaca gcaggtggag aggaaggaga aaacagccca      1500
     gatgcccaac cccaagccgg tcggaggacc cggcgggaag catgcacctg cccctactgt      1560
     aaagacagtg aaggaagggg ctcgggggat cctggcaaaa agaaacagca tatttgccac      1620
     atccaaggct gtgggaaagt gtatggcaag acctctcacc tgcgggcaca cttgcgctgg      1680
     catacaggcg agaggccatt tatgtgtacc tggtcatact gtgggaaacg cttcacacgt      1740
     tcggatgagc tacagaggca caaacgtaca cacacaggtg agaagaaatt tgcctgccct      1800
     gagtgtccta agcgcttcat gaggagtgac cacctgtcaa aacatatcaa gacccaccag      1860
     aataagaagg gaggcccagg tgtagctctg agtgtgggca ctttgcccct ggacagtggg      1920
     gcaggttcag aaggcagtgg cactgccact ccttcagccc ttattaccac caatatggta      1980
     gccatggagg ccatctgtcc agagggcatt gcccgtcttg ccaacagtgg catcaacgtc      2040
     atgcaggtgg cagatctgca gtccattaat atcagtggca atggcttctg agatcaggca      2100
     cccggggcca gagacatatg ggccataccc cttaaccccg ggatgcaagg tagcatgggt      2160
     ccaagagaca tggaagagag agccatgaag cattaaaatg catggtgttg agaagaatca      2220
     ggagagggat acaagagagg agatggggtc ccggcaccca tctgtatcat cagtgcctct      2280
     ttgaaggtgg gaaacattag tgaaaattct gttggtgcca cgctttgatg agcatttgtt      2340
     tgaccccagt ttcttcttac acttcttacc ccagcctacc cttcctgcat ttctcttctc      2400
     agctcttcca tgatggattc cccccccttt cctaaagcca tcatgccttg ataaatatat      2460
     atgatcattg aaatactttt taacaaaaaa cagattctat attattatat atatatatat      2520
     atataaagat atatagagat gcattcacag ggttggctgg agaggaagac cattctgtga      2580
     ccaaaatacc ttggtcattt tttttatatt gccttatttc cctatggctg agccttgttg      2640
     tgacacatca agctt                                                       2655
//

If you have problems or comments...

PBIL Back to PBIL home page