(data stored in SCRATCH zone)

EMBL: J03779

ID   J03779; SV 1; linear; mRNA; STD; HUM; 5508 BP.
XX
AC   J03779;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 3)
XX
DE   Human common acute lymphoblastic leukemia antigen (CALLA) mRNA, complete
DE   cds.
XX
KW   common acute lymphoblastic leukemia antigen; integral membrane protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5508
RX   DOI; 10.1073/pnas.85.13.4819.
RX   PUBMED; 2968607.
RA   Shipp M.A., Richardson N.E., Sayre P.H., Brown N.R., Masteller E.L.,
RA   Clayton L.K., Ritz J., Reinherz E.L.;
RT   "Molecular cloning of the common acute lymphoblastic leukemia antigen
RT   (CALLA) identifies a type II integral membrane protein";
RL   Proc. Natl. Acad. Sci. U.S.A. 85(13):4819-4823(1988).
XX
DR   MD5; bdc5ca5d0264f8495c7b89ef5d7d6e1c.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
DR   EuropePMC; PMC123659; 11917104.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5508
FT                   /organism="Homo sapiens"
FT                   /map="3q21-q27"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..5508
FT                   /note="CALLA mRNA"
FT   gene            12..2264
FT                   /gene="MME"
FT   CDS_pept        12..2264
FT                   /codon_start=1
FT                   /gene="MME"
FT                   /note="common acute lymphoblastic leukemia antigen
FT                   precursor"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000191199.13"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="AAA51915.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTRLEISLSVLVLLLTIIAVRM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCRDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMRLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
FT   mat_peptide     15..2261
FT                   /gene="MME"
FT                   /note="common acute lymphoblastic leukemia antigen"
XX
SQ   Sequence 5508 BP; 1760 A; 1031 C; 1075 G; 1642 T; 0 other;
     gattttaggt gatgggcaag tcagaaagtc agatggatat aactgatatc aacactccaa        60
     agccaaagaa gaaacagcga tggactcgac tggagatcag cctctcggtc cttgtcctgc       120
     tcctcaccat catagctgtg agaatgatcg cactctatgc aacctacgat gatggtattt       180
     gcaagtcatc agactgcata aaatcagctg ctcgactgat ccaaaacatg gatgccacca       240
     ctgagccttg tagagacttt ttcaaatatg cttgcggagg ctggttgaaa cgtaatgtca       300
     ttcccgagac cagctcccgt tacggcaact ttgacatttt aagagatgaa ctagaagtcg       360
     ttttgaaaga tgtccttcaa gaacccaaaa ctgaagatat agtagcagtg cagaaagcaa       420
     aagcattgta caggtcttgt ataaatgaat ctgctattga tagcagaggt ggagaacctc       480
     tactcaaact gttaccagac atatatgggt ggccagtagc aacagaaaac tgggagcaaa       540
     aatatggtgc ttcttggaca gctgaaaaag ctattgcaca actgaattct aaatatggga       600
     aaaaagtcct tattaatttg tttgttggca ctgatgataa gaattctgtg aatcatgtaa       660
     ttcatattga ccaacctcga cttggcctcc cttctagaga ttactatgaa tgcactggaa       720
     tctataaaga ggcttgtaca gcatatgtgg attttatgat ttctgtggcc agattgattc       780
     gtcaggaaga aagattgccc atcgatgaaa accagcttgc tttggaaatg aataaagtta       840
     tggaattgga aaaagaaatt gccaatgcta cggctaaacc tgaagatcga aatgatccaa       900
     tgcttctgta taacaagatg agattggccc agatccaaaa taacttttca ctagagatca       960
     atgggaagcc attcagctgg ttgaatttca caaatgaaat catgtcaact gtgaatatta      1020
     gtattacaaa tgaggaagat gtggttgttt atgctccaga atatttaacc aaacttaagc      1080
     ccattcttac caaatattct gccagagatc ttcaaaattt aatgtcctgg agattcataa      1140
     tggatcttgt aagcagcctc agccgaacct acaaggagtc cagaaatgct ttccgcaagg      1200
     ccctttatgg tacaacctca gaaacagcaa cttggagacg ttgtgcaaac tatgtcaatg      1260
     ggaatatgga aaatgctgtg gggaggcttt atgtggaagc agcatttgct ggagagagta      1320
     aacatgtggt cgaggatttg attgcacaga tccgagaagt ttttattcag actttagatg      1380
     acctcacttg gatggatgcc gagacaaaaa agagagctga agaaaaggcc ttagcaatta      1440
     aagaaaggat cggctatcct gatgacattg tttcaaatga taacaaactg aataatgagt      1500
     acctcgagtt gaactacaaa gaagatgaat acttcgagaa cataattcaa aatttgaaat      1560
     tcagccaaag taaacaactg aagaagctcc gagaaaaggt ggacaaagat gagtggataa      1620
     gtggagcagc tgtagtcaat gcattttact cttcaggaag aaatcagata gtcttcccag      1680
     ccggcattct gcagcccccc ttctttagtg cccagcagtc caactcattg aactatgggg      1740
     gcatcggcat ggtcatagga cacgaaatca cccatggctt cgatgacaat ggcagaaact      1800
     ttaacaaaga tggagacctc gttgactggt ggactcaaca gtctgcaagt aactttaagg      1860
     agcaatccca gtgcatggtg tatcagtatg gaaacttttc ctgggacctg gcaggtggac      1920
     agcaccttaa tggaattaat acactgggag aaaacattgc tgataatgga ggtcttggtc      1980
     aagcatacag agcctatcag aattatatta aaaagaatgg cgaagaaaaa ttacttcctg      2040
     gacttgacct aaatcacaaa caactatttt tcttgaactt tgcacaggtg tggtgtggaa      2100
     cctataggcc agagtatgcg gttaactcca ttaaaacaga tgtgcacagt ccaggcaatt      2160
     tcaggattat tgggactttg cagaactctg cagagttttc agaagccttt cactgccgca      2220
     agaattcata catgaatcca gaaaagaagt gccgggtttg gtgatcttca aaagaagcat      2280
     tgcagccctt ggctagactt gccaacacca cagaaatggg gaattctcta atcgaaagaa      2340
     aatgggccct aggggtcact gtactgactt gagggtgatt aacagagagg gcaccatcac      2400
     aatacagata acattaggtt gtcctagaaa gggtgtggag ggaggaaggg ggtctaaggt      2460
     ctatcaagtc aatcatttct cactgtgtac ataatgctta atttctaaag ataatattac      2520
     tgtttatttc tgtttctcat atggtctacc agtttgctga tgtccctaga aaacaatgca      2580
     aaacctttga ggtagaccag gatttctaat caaaagggaa aagaagatgt tgaagaatag      2640
     agttaggcac cagaagaaga gtaggtgaca ctatagttta aaacacattg cctaactact      2700
     agtttttact tttatttgca acatttacag tccttcaaaa tccttccaaa gaattcttat      2760
     acacattggg gccttggagc ttacatagtt ttaaactcat ttttgccata catcagttat      2820
     tcattctgtg atcatttatt ttaagcactc ttaaagcaaa aaatgaatgt ctaaaattgt      2880
     tttttgttgt acctgctttg actgatgctg agattcttca ggcttcctgc aattttctaa      2940
     gcaatttctt gctctatctc tcaaaacttg gtatttttca gagatttata taaatgtaaa      3000
     aataataatt tttatattta attattaact acatttatga gtaactatta ttataggtaa      3060
     tcaatgaata ttgaagtttc agcttaaaat aaacagttgt gaaccaagat ctataaagcg      3120
     atatacagat gaaaatttga gactatttaa acttataaat catattgatg aaaagattta      3180
     agcacaaact ttagggtaaa aattgcgatt ggacagttgt ctagagatat atatacttgt      3240
     ggttttcaaa ttggactttc aaaattaaat ctgtccctga gagtgtctct gataaaaggg      3300
     caaatctgca cctatgtagc tctgcatctc ctgtcttttc aggtttgtca tcagatggaa      3360
     atattttgat aataaattga aattgtgaac tcattgctcc ctaagactgt gacaactgtc      3420
     taactttaga agtgcatttc tgaatagaaa tgggaggcct ctgatggacc ttctagaatt      3480
     ataagtcaca aagagttctg gaaaagaact gtttactgct tgataggaat tcatcttttg      3540
     aggcttctgt tcctctcttt tcctgttgta ttgactattt tcgttcatta cttgattaag      3600
     attttacaaa agaggagcac ttccaaaatt cttatttttc ctaacaaaag atgaaagcag      3660
     ggaatttcta tctaaatgat gagtattagt tccctgtctc ttgaaaaatg cccatttgcc      3720
     tttaaaaaaa aaagttacag aaatactata acatatgtac ataaattgca taaagcataa      3780
     gtatacagtt caataaactt aactttaact gaacaatggc cctgtagcca gcacctgtaa      3840
     gaaacagagc agtaccagcg ctctaaaagc acctccttgt cactttatta ctcccagaac      3900
     aacaactatc ctgacttcta atatcattca ctagctttgc ctggttttgt cttttatgca      3960
     gatagaatca atcagtatgt attcttttgt gcctggcttc tttctctcag ccttacattt      4020
     gtgagattcc tctgtattgt gctgattgtg gatcttttca ttctcattgc agaataatgt      4080
     tctattgtgg gacttattac aatttgttca tcctattgtt gatgggcact tgagaacttt      4140
     ccattttggc gctattacaa atagtgcaac tatgaatgta ctgcatgtta ccatcttact      4200
     tgagccttta atggacttat ttcttcaaat ccttccaaaa attattataa gcattgaaat      4260
     tatagtttca agccaactgt ggataccctt accctttcct cctttatcac aaccaccgtt      4320
     acaagtatac ttatatttcc ctaaaataca tttaaaactt acctaagtga catttgtagt      4380
     tggagtaata ggagcttcca gctctaataa aacagctgtc tctaacttat tttatttcca      4440
     tcatgtcaga gcaggtgaag agccagaagt gaagagtgac tagtacaaat tataaaaagc      4500
     cactagactc ttcactgtta gctttttaaa acattaggct cccatcccta tggaggaaca      4560
     actctccagt gcctggatcc cctctgtcta caaatataag attttctggg cctaaaggat      4620
     agatcaaagt caaaaatagc aatgcctccc tatccctcac acatccagac atcatgaatt      4680
     ttacatggta ctcttgttga gttctataga gccttctgat gtctctaaag cactaccgat      4740
     tctttggagt tgtcacatca gataagacat atctctaatt ccatccataa atccagttct      4800
     actatggctg agttctggtc aaagaaagaa agtttagaag ctgagacaca aagggttggg      4860
     agctgatgaa actcacaaat gatggtagga agaagctctc gacaataccc gttggcaagg      4920
     agtctgcctc catgctgcag tgttcgagtg gattgtaggt gcaagatgga aaggattgta      4980
     ggtgcaagct gtccagagaa aagagtcctt gttccagccc tattctgcca ctcctgacag      5040
     ggtgaccttg ggtatttgca atattccttt gggcctctgc ttctctcacc taaaaaaaga      5100
     gaattagatt atattggtgg ttctcagcaa gagaaggagt atgtgtccaa tgctgccttc      5160
     ccatgaatct gtctcccagt tatgaatcag tgggcaggat aaactgaaaa ctcccattta      5220
     agtgtctgaa tcgagtgaga caaaatttta gtccaaataa caagtaccaa agttttatca      5280
     agtttgggtc tgtgctgctg ttactgttaa ccatttaagt ggggcaaaac cttgctaatt      5340
     ttctcaaaag catttatcat tcttgttgcc acagctggag ctctcaaact aaaagacatt      5400
     tgttattttg gaaagaagaa agactctatt ctcaaagttt cctaatcaga aatttttatc      5460
     agtttccagt ctcaaaaata caaaataaaa acaaacgttt ttaatact                   5508
//

If you have problems or comments...

PBIL Back to PBIL home page