(data stored in ACNUC27125 zone)

EMBL: J04134

ID   J04134; SV 1; linear; mRNA; STD; MUS; 1111 BP.
XX
AC   J04134;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mouse brain calmodulin-dependent phosphatase (calcineurin) catalytic
DE   subunit mRNA, 3' end.
XX
KW   calcineurin; calmodulin-dependent phosphatase; neuronotypic enzyme;
KW   phosphoprotein phosphatase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1111
RX   DOI; 10.1073/pnas.85.23.8983.
RX   PUBMED; 2848250.
RA   Kincaid R.L., Nightingale M.S., Martin B.M.;
RT   "Characterization of a cDNA clone encoding the calmodulin-binding domain of
RT   mouse brain calcineurin";
RL   Proc. Natl. Acad. Sci. U.S.A. 85(23):8983-8987(1988).
XX
RN   [2]
RP   171-171
RA   Kincaid R.L.;
RT   ;
RL   Unpublished.
XX
DR   MD5; df22e98202b5841b7502274cfe681e4b.
DR   Ensembl-Gn; ENSMUSG00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070198; mus_musculus.
XX
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by R.Kincaid, 09-DEC-1988.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1111
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..924
FT                   /note="calcineurin"
FT                   /db_xref="GOA:P63328"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107164"
FT                   /db_xref="PDB:4ORB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63328"
FT                   /protein_id="AAA37432.1"
FT                   /translation="LDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYF
FT                   YSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNK
FT                   AAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDEL
FT                   GSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGV
FT                   LSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDAN
FT                   LNSINKALASETNGTDSNGSNSSNIQ"
XX
SQ   Sequence 1111 BP; 315 A; 269 C; 271 G; 256 T; 0 other;
     ctagaccgat tcaaagaacc accggcttat gggcccatgt gtgacatcct atggtcagac        60
     cccctggagg actttggaaa tgagaagact caggaacatt tcactcacaa cacagtcaga       120
     ggctgttcgt acttctacag ttacccagct gtgtgtgact tcctgcagca caataatttg       180
     ttgtccatac tccgcgccca cgaagcccag gatgcagggt accgcatgta caggaaaagc       240
     caaacaacag gcttcccgtc tctaattaca atcttctcgg caccaaatta cttagatgtg       300
     tacaataaca aagctgcagt gttgaagtac gagaacaatg tgatgaacat caggcagttc       360
     aactgctccc cgcatccgta ctggctccca aatttcatgg atgttttcac ctggtcgctg       420
     ccatttgttg gggagaaagt gactgagatg ctggtcaatg ttctcaacat ctgctccgac       480
     gatgaactgg ggtcagaaga agatggattt gacggagcca cggccgcagc ccggaaggaa       540
     gtcatcagaa acaagatccg agcaataggc aaaatggcca gagtgttctc agttctcaga       600
     gaagagagtg agagtgtcct gacactgaag ggcctgaccc caactggcat gctccccagc       660
     ggagtgctct ctggcgggaa acagactctg caaagcgcta ctgttgaggc tattgaggct       720
     gatgaagcca tcaaaggatt ttcaccacaa cataagatca ctagcttcga ggaggccaag       780
     ggcttagacc gaattaacga gaggatgcca cctcgcagag acgccatgcc ctctgacgcc       840
     aaccttaact ccatcaacaa ggctctcgcc tcagagacta acggcacgga cagcaatggc       900
     agtaatagca gcaatatcca gtgaccactt cctgttcact tttttttttt tttgagctgc       960
     agggcatgat gggattgctg catctcagca gttggatgtt cttgcctctg aaggtagctt      1020
     gtttgctctg ggggccagga attggattca gtttacacta tcatgaaaaa taaaaataaa      1080
     aaaagaggga gagagataat aaactatatt g                                     1111
//

If you have problems or comments...

PBIL Back to PBIL home page