(data stored in ACNUC27125 zone)

EMBL: J05479

ID   J05479; SV 1; linear; mRNA; STD; MUS; 2194 BP.
XX
AC   J05479;
XX
DT   21-JUL-1990 (Rel. 24, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mouse calcineurin catalytic subunit mRNA, complete cds.
XX
KW   calcineurin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2194
RX   PUBMED; 2162844.
RA   Kincaid R.L., Giri P.R., Higuchi S., Tamura J., Dixon S.C., Marietta C.A.,
RA   Amorese D.A., Martin B.M.;
RT   "Cloning and characterization of molecular isoforms of the catalytic
RT   subunit of calcineurin using nonisotopic methods";
RL   J Biol Chem 265(19):11312-11319(1990).
XX
DR   MD5; 62ce8bb0745f5a30c40af14d47512ae8.
DR   Ensembl-Gn; ENSMUSG00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070198; mus_musculus.
DR   EuropePMC; PMC2185582; 11062266.
XX
CC   Authorin submission for [1] kindly submitted by R.Kincaid,
CC   08-MAY-1990, for release after publication.
CC   Two cDNA isoforms were found that either contained (class 1) or
CC   lacked (class 2) base pairs 1414 to 1443, but otherwise appeared
CC   identical; this region presumably represents an alternatively
CC   spliced exon.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2194
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..2194
FT                   /note="calcineurin catalytic subunit mRNA"
FT   CDS_pept        76..1641
FT                   /codon_start=1
FT                   /note="calcineurin catalytic subunit"
FT                   /db_xref="GOA:P63328"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107164"
FT                   /db_xref="PDB:4ORB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63328"
FT                   /protein_id="AAA37359.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAI
FT                   KGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNS
FT                   SNIQ"
FT   regulatory      1786..1791
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1792..1797
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2194 BP; 624 A; 488 C; 529 G; 553 T; 0 other;
     gcgccggtgc ggtcggggtg tgcagtcgga cgggacgagc agcgcgtcgc tgtccccccc        60
     tcccggtggc tggagatgtc cgagcccaag gcgattgatc ccaagttgtc gacgaccgac       120
     agggtggtga aagccgttcc atttccacca agtcaccggc tgacagcaaa ggaagtgttt       180
     gataatgatg ggaaacctcg tgtggatatc ttaaaagcac atctcatgaa ggagggcagg       240
     ctggaagaaa gtgttgcatt gagaataata acagagggtg cttcgattct ccgacaggaa       300
     aaaaacttgc tggatatcga cgcaccagtc acagtttgtg gggacatcca tggacaattc       360
     tttgacttga tgaagctctt tgaagtggga ggatctcctg ccaacactcg ctacctcttc       420
     ttaggggact atgttgacag agggtacttc agtatcgaat gtgtgctgta tttgtgggcc       480
     ttgaaaattc tttaccccaa aacactgttt ttacttcgcg gaaaccatga atgtaggcac       540
     ctcacagagt atttcacgtt taaacaagaa tgtaaaataa agtattcaga acgcgtttat       600
     gacgcctgta tggatgcctt cgactgcctt cccctggctg cgctaatgaa ccagcagttc       660
     ctgtgtgtac acggtggttt gtctccagag attaacactc tagatgacat cagaaaatta       720
     gaccgattca aagaaccacc tgcttatggg cccatgtgtg acatcctatg gtcagacccc       780
     ctggaggact ttggaaatga gaagactcag gaacatttca ctcacaacac agtcagaggc       840
     tgttcgtact tctacagtta cccagctgtg tgtgacttcc tgcagcacaa taatttgttg       900
     tccatactcc gcgcccacga agcccaggat gcagggtacc gcatgtacag gaaaagccaa       960
     acaacaggct tcccgtctct aattacaatc ttctcggcac caaattactt agatgtgtac      1020
     aataacaaag ctgcagtgtt gaagtacgag aacaatgtga tgaacatcag gcagttcaac      1080
     tgctccccgc atccgtactg gctcccaaat ttcatggatg ttttcacctg gtcgctgcca      1140
     tttgttgggg agaaagtgac tgagatgctg gtcaatgttc tcaacatctg ctccgacgat      1200
     gaactggggt cagaagaaga tggatttgac ggagccacgg ccgcagcccg gaaggaagtc      1260
     atcagaaaca agatccgagc aataggcaaa atggccagag tgttctcagt tctcagagaa      1320
     gagagtgaga gtgtcctgac actgaagggc ctgaccccaa ctggcatgct ccccagcgga      1380
     gtgctctctg gcgggaaaca gactctgcaa agcgctactg ttgaggctat tgaggctgat      1440
     gaagccatca aaggattttc accacaacat aagatcacta gcttcgagga ggccaagggc      1500
     ttagaccgaa ttaacgagag gatgccacct cgcagagacg ccatgccctc tgacgccaac      1560
     cttaactcca tcaacaaggc tctcgcctca gagactaacg gcacggacag caatggcagt      1620
     aatagcagca atatccagtg accacttcct gttcactttt tttttttttt gagctgcagg      1680
     gcatgatggg attgctgcat ctcagcagtt ggatgttctt gcctctgaag gtagcttgtt      1740
     tgctctgggg gccaggaatt ggattcagtt tacactatca tgaaaaataa aaataaaaaa      1800
     agagggagag agataataaa ctatattttg gtgagggtgg tgattaaaca cctcttttgg      1860
     gtatgccttt aaaaaatgct tctagggcaa aaaagtttta aaaagaaagc taatgctagc      1920
     tatactgcaa tgttagggga atgaacgcgt tttcctactg cactggggac ttttagatag      1980
     gttaatgaaa ggcctttatt ctgttactgg acacgaaaac tttgtctaat ttcttatact      2040
     ctattgtacc tttacagtcg cagcactaaa atggaagaca tcaaacattt ttaacagaaa      2100
     aaaaaaaaga tgtaaaaact aactaaggac tatttattaa tgatgttttg ctactcctgt      2160
     cagacaatgg ctataaactg aattaggcag tctt                                  2194
//

If you have problems or comments...

PBIL Back to PBIL home page