(data stored in ACNUC18020 zone)

EMBL: K02173

ID   K02173; SV 1; linear; mRNA; STD; VRT; 264 BP.
XX
AC   K02173;
XX
DT   07-NOV-1985 (Rel. 07, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 6)
XX
DE   Chicken embryonic cytoplasmic beta-actin mRNA.
XX
KW   actin; beta-actin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-264
RX   DOI; 10.1126/science.6729461.
RX   PUBMED; 6729461.
RA   Paterson B.M., Eldridge J.D.;
RT   "alpha-Cardiac actin is the major sarcomeric isoform expressed in embryonic
RT   avian skeletal muscle";
RL   Science, e1252229 224(4656):1436-1438(1984).
XX
DR   MD5; 807ba27f57517a9a650d7e3d9287ed08.
XX
CC   Original source text: Gallus gallus (clone:  pA-1) cDNA to mRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /clone="pA-1"
FT                   /db_xref="taxon:9031"
FT   mRNA            <1..>264
FT                   /product="beta-actin"
FT   CDS_pept        7..>264
FT                   /codon_start=1
FT                   /product="beta-actin"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="UniProtKB/TrEMBL:Q90736"
FT                   /protein_id="AAA98513.1"
FT                   /translation="MDDDIAALVVDNGSAMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIW"
XX
SQ   Sequence 264 BP; 59 A; 64 C; 80 G; 61 T; 0 other;
     ccagccatgg atgatgatat tgctgcgctc gttgttgaca atggctccgc tatgtgcaag        60
     gccggtttcg ccggggacga tgccccccgt gctgtgttcc catctatcgt gggtcgcccc       120
     agacatcagg gtgtgatggt tggtatgggc cagaaagaca gctacgttgg tgatgaagcc       180
     cagagcaaaa gaggtatcct gaccctgaag taccccattg aacacggtat tgtcaccaac       240
     tgggatgata tggagaagat ctgg                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page