(data stored in SCRATCH zone)

EMBL: KY906033

ID   KY906033; SV 1; linear; mRNA; STD; PLN; 1221 BP.
XX
AC   KY906033;
XX
DT   25-APR-2017 (Rel. 132, Created)
DT   25-APR-2017 (Rel. 132, Last updated, Version 1)
XX
DE   Arabidopsis thaliana alpha 1,4-glycosyltransferase family protein
DE   (AT5G01250.1) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1221
RA   Zeng W., Gluza P., Heazlewood J.;
RT   "Arabidopsis glycosyltransfereases: an update";
RL   Unpublished.
XX
RN   [2]
RP   1-1221
RA   Zeng W., Gluza P., Heazlewood J.;
RT   ;
RL   Submitted (05-APR-2017) to the INSDC.
RL   BioSciences, The University of Melbourne, Tin Alley, Melbourne, VIC 3010,
RL   Australia
XX
DR   MD5; 7c4f75f0823d7f39e6038027c181d6b0.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1221
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Col-0"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            1..>1221
FT                   /gene="AT5G01250.1"
FT   CDS_pept        1..>1221
FT                   /codon_start=1
FT                   /gene="AT5G01250.1"
FT                   /product="alpha 1,4-glycosyltransferase family protein"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /protein_id="ARJ31397.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
XX
SQ   Sequence 1221 BP; 381 A; 228 C; 272 G; 340 T; 0 other;
     atggatcgtc atgatataga aaagagattc acggtggtga ttgataacag acgactaaac        60
     caatcaggat catcatcact tttcaccgcc ttcgctatca gctttgtaac tctgatcgtg       120
     gttaccacgt ttactctaat ttctaatttc tcgatgcaac cgcatagaga tttctcagga       180
     gtgaagatag agatcaagag agtgattcca cacttacctc tgagttctga gagagaaggt       240
     gaaagaagtg atctgctcaa acaacagaca caagtaaacg agaagctcca agttatcgaa       300
     gttttcagtg gagataactt gtctgacaag tttcaaaaga gggtaaatga gtttgtcggt       360
     gatggatgcg aagtcaactt cgtcatgaca tggatatcac cagcagattt ctttggcaat       420
     agagaggttt tagctattga aagtgtcttt aagtctcatc cgtatggttg cttgatgatc       480
     ttatccgcaa ccatggattc tcctcaaggt tatgcaactt tgaagccgtt tattgatcgt       540
     ggttacaaag ttcttgcagt cacaccagat ttgccttttc tgctcaaagg aaccgcggga       600
     gagttgtggc tcgacgaaat aaagagcggt aaaagagatc ccggaaagat ttctttagct       660
     cagaatctct caaatctcat gaggcttgct tacttgtaca aatatggagg tgtgtactta       720
     gacacagaca tgattgttct aaaaagcttc aaaggtctga gaaacgtgat tggtgcacaa       780
     acacttgatc cttcatcaac gaattggaca agactaaaca acgcggtact aatattcgac       840
     aagaaccatc ctctgttact caaattcatg gaagagttcg ctaaaacttt caacggaaac       900
     atatggggat acaacggacc ataccttgtt tcacgagtgg ctagagctgt agaaggatca       960
     agtggctata acttcaccgt catgcgacca tctgtgttct attcggtaaa ctggctcgag      1020
     attaagaagt tgttcaaagt gcctaaaaca gagaaagatt cgaaatgggt caaaaccaag      1080
     cttcttcata tgcagaggaa tggttatggt ttgcatctgt ggaataagtt tagcaggaaa      1140
     tacgaaattg aacaaggaag tgccatgtgg aaactggttt cagagcattg cataatctgt      1200
     gaaattagtt ctgtatcatc a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page