(data stored in ACNUC9306 zone)

EMBL: L02320

ID   L02320; SV 1; linear; mRNA; STD; HUM; 2022 BP.
XX
AC   L02320;
XX
DT   22-JUN-1993 (Rel. 36, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Human radixin mRNA, complete cds.
XX
KW   radixin.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2022
RX   DOI; 10.1006/geno.1993.1159.
RX   PUBMED; 8486357.
RA   Wilgenbus K.K., Milatovich A., Francke U., Furthmayr E.;
RT   "Molecular cloning, cDNA sequence, and chromosomal assignment of the human
RT   radixin gene and two dispersed pseudogenes";
RL   Genomics 16(1):199-206(1993).
XX
DR   MD5; 8c83fa4f30900831630a2abcda5a6951.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000528498; homo_sapiens.
DR   Ensembl-Tr; ENST00000528900; homo_sapiens.
DR   Ensembl-Tr; ENST00000530301; homo_sapiens.
DR   Ensembl-Tr; ENST00000530749; homo_sapiens.
DR   Ensembl-Tr; ENST00000544551; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
DR   Ensembl-Tr; ENST00000647231; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2022
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_lib="Stratagene"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        31..1782
FT                   /codon_start=1
FT                   /product="radixin"
FT                   /db_xref="GOA:P35241"
FT                   /db_xref="H-InvDB:HIT000191480.14"
FT                   /db_xref="HGNC:HGNC:9944"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35241"
FT                   /protein_id="AAA36541.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERI
FT                   EREKEELMERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEA
FT                   KSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEK
FT                   TKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTE
FT                   TQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQR
FT                   IDEFEAM"
XX
SQ   Sequence 2022 BP; 757 A; 354 C; 458 G; 453 T; 0 other;
     aattcggcac gagacaaaaa gagaaagaaa atgccgaaac caatcaacgt aagagtaact        60
     acaatggatg ctgagctgga atttgccatt cagcccaata caactggcaa acaacttttt       120
     gaccaggtgg tgaaaacagt tggtttgcgt gaggtctggt tttttgggct gcagtatgta       180
     gacagcaaag gttattctac atggcttaaa ctaaataaaa aggtaacaca gcaggatgtt       240
     aaaaaagaga atcctttaca gttcaagttt agagctaaat tctttcctga agatgtttct       300
     gaggaattaa ttcaagaaat aacccagaga ctcttcttct tgcaagttaa agaagccatc       360
     ttaaatgatg agatatattg cccgccagaa actgcagttc ttttggcttc ctatgctgtc       420
     caagccaagt atggagatta caataaagag attcataagc caggctacct ggctaatgat       480
     agactcctac cccagcgtgt attggaacaa cacaaactaa caaaagaaca gtgggaagaa       540
     agaatacaga actggcatga agaacataga ggaatgttaa gggaggattc tatgatggaa       600
     tacctgaaga ttgcacaaga tctagaaatg tatggagtca actattttga aataaaaaat       660
     aaaaaaggaa ctgaattgtg gctaggtgtt gatgctttgg gtctgaatat ttatgagcat       720
     gacgacaagt taacacctaa aattggtttt ccctggagtg aaatcagaaa tatttcattt       780
     aatgacaaaa aatttgttat aaagccaatc gacaaaaagg cacctgattt tgtgttttat       840
     gcacctcgtc tgagaatcaa taagcggatt ttggccttat gtatgggaaa ccatgaacta       900
     tacatgcgaa gaaggaagcc tgatactatt gaagtacaac agatgaaggc tcaggctagg       960
     gaggagaaac atcagaagca gttggaaagg gcacaattag agaatgaaaa gaagaaaaga      1020
     gaaatagcag aaaaggaaaa ggaaagaata gaacgtgaaa aggaagagct aatggaacgt      1080
     ctaaaacaaa ttgaagagca gacaattaaa gctcagaaag aactagaaga acagactcga      1140
     aaagctctag aactggatca agaacgaaaa cgagcaaaag aagaagcaga acgacttgaa      1200
     aaggagcgtc gagctgctga agaggcaaag tctgccatag caaaacaagc tgccgaccag      1260
     atgaagaatc aggagcagct agcagcagaa cttgctgaat tcactgccaa gattgcactt      1320
     ctagaggaag ccaagaagaa aaaggaagag gaagcaactg agtggcaaca caaagctttt      1380
     gcagcccagg aagacttgga aaagaccaaa gaagagttaa aaactgtgat gtctgccccc      1440
     cctccacctc caccaccacc agtcattcct ccaacagaaa acgaacatga tgaacacgat      1500
     gagaataatg ctgaagctag tgctgaatta tcaaatgaag gggtaatgaa ccatagaagc      1560
     gaggaagaac gtgtaaccga aacacagaaa aatgagcgtg ttaagaagca acttcaggca      1620
     ttaagttcag aattagccca agccagagat gaaaccaaga aaacacaaaa tgatgttctt      1680
     catgctgaga atgttaaagc aggccgtgat aagtacaaga ctctgcgaca gattcgacaa      1740
     ggcaatacaa agcagcgtat cgatgagttt gaagcaatgt gagagctgtt attttgcata      1800
     tatgttcttc ataagctgaa ccaccaacag agaaaagcag gcctttgcag atatgatgga      1860
     atgcatccca ccttgccaaa gcacttacac cagtttgact gtgctagcta aaagacaaat      1920
     ttaaggggag ctcttcaaca ttaaggcagt atgatatcat gcttggtttt cttttttctt      1980
     ttggtccagg gaatggagaa tggtgttcca ttgcctcttt tt                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page