(data stored in SCRATCH zone)

GenBank: ECOFOLK

LOCUS       ECOFOLK                 1012 bp    DNA     linear   BCT 02-MAY-1997
DEFINITION  Escherichia coli hydroxymethylpterin pyrophosphokinase (folK) gene,
            complete cds.
ACCESSION   L06495
VERSION     L06495.1
KEYWORDS    .
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1012)
  AUTHORS   Talarico,T.L., Ray,P.H., Dev,I.K., Merrill,B.M. and Dallas,W.S.
  TITLE     Cloning, sequence analysis, and overexpression of Escherichia coli
            folK, the gene coding for
            7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  JOURNAL   J. Bacteriol. 174 (18), 5971-5977 (1992)
   PUBMED   1325970
FEATURES             Location/Qualifiers
     source          1..1012
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
                     /tissue_lib="MC4100"
     gene            133..612
                     /gene="folK"
     CDS_pept        133..612
                     /gene="folK"
                     /EC_number="2.7.6.3"
                     /standard_name="7,
                     8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethyldihydropterin pyrophosphokinase"
                     /protein_id="AAB53446.1"
                     /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTP
                     PLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLF
                     GNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW"
ORIGIN
        1 atggtggggt gagttccagg tttccgcgcc accagaccaa aaagggatcg tcaacgagct
       61 ggatgaagaa ccgtcaccgc gtcagtcgta ctcgtcgtcc acgcaaacgc gcaccacgtc
      121 gtagggtacc gcatgacagt ggcgtatatt gccataggca gcaatctggc ctctccgctg
      181 gagcaggtca atgctgccct gaaagcatta ggcgatatcc ctgaaagcca cattcttacc
      241 gtttcttcgt tttaccgcac cccaccgctg ggcccgcaag atcaacccga ttacttaaac
      301 gcagccgtgg cgctggaaac ctctcttgca cctgaagagc tactcaatca cacacagcgt
      361 attgaattgc agcaaggtcg cgtccgcaaa gctgaacgct ggggaccacg cacgctggat
      421 ctcgacatca tgctgtttgg taatgaagtg ataaatactg aacgcctgac cgttccgcac
      481 tacgatatga agaatcgtgg atttatgctg tggccgctgt ttgaaatcgc gccggagttg
      541 gtgtttcctg atggggagat gttgcgtcaa atcttacata caagagcatt tgacaaatta
      601 aacaaatggt aatttattta tattgcgaat ataaatattt tctgaaaatc atatctcatc
      661 tctttgcctt aattacgatt ttagtttaaa catctctttg cggaaataat ataacttcct
      721 ataaataaat atcaatccca tctccatacc ctaaccaatt gcacttgtga acttattttt
      781 acttaatttt gaattaagta aatttaattt gttcaaaagc ttctaaagtg cacaataggc
      841 gacctaatga acaatggttg taaatttggg taacaagtaa tccagcggat aacacgtgaa
      901 atcttcgaaa acttgtttaa tttaaatgaa ttaagtttta attcattttt attcaagtgt
      961 tcacgttaac caatcccata cctctaccct aactataaat aaatatcctt ca
//

If you have problems or comments...

PBIL Back to PBIL home page