(data stored in SCRATCH zone)

EMBL: L06664

ID   L06664; SV 1; linear; genomic DNA; STD; PRO; 1139 BP.
XX
AC   L06664;
XX
DT   02-DEC-1992 (Rel. 34, Created)
DT   05-JUL-1999 (Rel. 60, Last updated, Version 4)
XX
DE   Bacillus subtilis spoIIM gene, complete cds.
XX
KW   spoIIM gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1139
RX   PUBMED; 8501064.
RA   Smith K., Bayer M.E., Youngman P.;
RT   "Physical and functional characterization of the Bacillus subtilis spoIIM
RT   gene";
RL   J. Bacteriol. 175(11):3607-3617(1993).
XX
DR   MD5; 0c1ba87d44dd78744355beb0dd5ed486.
DR   GOA; P54572.
DR   InterPro; IPR001891; Malic_OxRdtase.
DR   InterPro; IPR002912; ACT_dom.
DR   InterPro; IPR006140; D-isomer_DH_NAD-bd.
DR   InterPro; IPR012301; Malic_N_dom.
DR   InterPro; IPR012302; Malic_NAD-bd.
DR   InterPro; IPR015884; Malic_enzyme_CS.
DR   InterPro; IPR036291; NAD(P)-bd_dom_sf.
DR   InterPro; IPR037062; Malic_N_dom_sf.
DR   UniProtKB/Swiss-Prot; P54572; MAO1_BACSU.
DR   UniProtKB/Swiss-Prot; P54573; YQKK_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1139
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      379..387
FT                   /gene="spoIIM"
FT                   /note="recognized by RNA polymerase + sigma E"
FT                   /regulatory_class="minus_35_signal"
FT   gene            379..1139
FT                   /gene="spoIIM"
FT   regulatory      400..407
FT                   /gene="spoIIM"
FT                   /note="recognized by RNA polymerase + sigma E"
FT                   /regulatory_class="minus_10_signal"
FT   prim_transcript 412..>1139
FT                   /gene="spoIIM"
FT                   /note="base 412 in vivo and in vitro transcription start"
FT   regulatory      436..440
FT                   /gene="spoIIM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        448..1092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIM"
FT                   /db_xref="GOA:P37873"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="InterPro:IPR014196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37873"
FT                   /protein_id="AAA75553.1"
FT                   /translation="MRKISYKDMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTIS
FT                   QKEDLYYYLSQFFGQLSDGKQASSADMFGQSIFHNAKYLGLMWILGISVIGMPIIFIMI
FT                   FLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQL
FT                   FVKRSLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEKLTSRLF"
XX
SQ   Sequence 1139 BP; 323 A; 204 C; 239 G; 373 T; 0 other;
     gcatgcagct cttacagcag tgaaataaat gtagctaaac agcacctgtc gtagcaggtc        60
     ggtcgtgttt ttttcttatc attgttcaat tttgttatca ttactatgaa aataaaaaag       120
     ggagtgatca catggcaaaa agccaagcga aaaagaagcg ggggcatcga ttgagaaacg       180
     gcggacgtga cgtcttatta tcaagaggca gcacaccatc tttcagcaca catggaagaa       240
     tgacaaaaag caaaaaagag attttgaata aacggaagca taagaatcct tatgatcata       300
     cagcagttga tgataaggat ttttttgtgc cccaaaaagc cgcctagcat tcatctctat       360
     tgtttctttt tgaaaaaggg catgtttttc tgtttctttc atacaatcta ttaaatcaaa       420
     tcactagagc gggcgggagg aaacggtatg cgaaaaatct cttataagga catgtttctc       480
     aggcatgtca aagatcatct ctctctttat atatttgtgt cagtgctgtt tttcatgggt       540
     gtcatctttg gcgcgattat tgtcaacagt atgaccatca gccagaaaga agatttatac       600
     tactacttaa gtcaattttt tggacagctt tcggatggaa aacaggcaag ttcagctgat       660
     atgtttgggc aaagtatctt tcataatgca aagtatttag gcctgatgtg gatactggga       720
     atttccgtca ttgggatgcc gattattttc attatgatct ttctgaaagg gatcgtcgtc       780
     ggctttactg tcgggttcct agtcaatcag atgggagtaa gcgggttttt cctatcattt       840
     gtctccgttt tgccgcaaaa tgtgctgctg attccggctt atctcattat gggcacatgt       900
     gcaattgcgt tttctttaaa gttaatcaga cagctgttcg tgaaacgaag cctgcatgac       960
     gcgccgattc aatggttcgg gcggtatgcc tttgtgctgc tggtcattct gtttttagcg      1020
     ctgatttcat ctctctttga agcatactta tctcctgttt taatggaaaa gcttacatct      1080
     agactttttt aaaatcatta ttaaaagaaa accattttat ttatcagttt ataataatt       1139
//

If you have problems or comments...

PBIL Back to PBIL home page