(data stored in ACNUC18020 zone)

EMBL: L08165

ID   L08165; SV 1; linear; mRNA; STD; VRT; 1736 BP.
XX
AC   L08165;
XX
DT   02-JAN-1993 (Rel. 34, Created)
DT   29-JUN-2018 (Rel. 137, Last updated, Version 4)
XX
DE   Gallus gallus beta-actin mRNA, complete cds.
XX
KW   beta-actin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RA   Wang H., Morais R.;
RT   "Nucleotide sequence of a beta-actin cDNA from mitochondrial DNA-depleted
RT   chicken cells";
RL   Unpublished.
XX
DR   MD5; 9f57f59178c115200fed898e48d3c37b.
DR   Ensembl-Gn; ENSGALG00000009621; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000015673; gallus_gallus.
DR   EuropePMC; PMC1074395; 15809226.
DR   EuropePMC; PMC1087448; 15784580.
DR   EuropePMC; PMC1304924; 15377515.
DR   EuropePMC; PMC135797; 11773382.
DR   EuropePMC; PMC2280032; 10448217.
DR   EuropePMC; PMC2667621; 12716922.
DR   EuropePMC; PMC3022683; 21192783.
DR   EuropePMC; PMC3031370; 21266463.
DR   EuropePMC; PMC313076; 11116100.
DR   EuropePMC; PMC3294599; 22237893.
DR   EuropePMC; PMC3322132; 22496769.
DR   EuropePMC; PMC3339409; 22190409.
DR   EuropePMC; PMC3354442; 22645433.
DR   EuropePMC; PMC3467396; 23000578.
DR   EuropePMC; PMC3550730; 23637518.
DR   EuropePMC; PMC3597177; 23011740.
DR   EuropePMC; PMC3789878; 23636703.
DR   EuropePMC; PMC4147078; 24390730.
DR   EuropePMC; PMC4263458; 25318671.
DR   EuropePMC; PMC4340924; 25714089.
DR   EuropePMC; PMC4395973; 25889399.
DR   EuropePMC; PMC4759766; 26900465.
DR   EuropePMC; PMC4765117; 26912252.
DR   EuropePMC; PMC4802587; 27006768.
DR   EuropePMC; PMC4848999; 27077853.
DR   EuropePMC; PMC4957392; 27453780.
DR   EuropePMC; PMC5324292; 28250798.
DR   EuropePMC; PMC5395752; 28435688.
DR   EuropePMC; PMC5480149; 28637471.
DR   EuropePMC; PMC5661052; 29118744.
DR   EuropePMC; PMC5739405; 29267351.
DR   EuropePMC; PMC5789014; 29379099.
DR   EuropePMC; PMC5870167; 29599973.
DR   EuropePMC; PMC6105744; 29887536.
DR   EuropePMC; PMC6268861; 23222903.
DR   EuropePMC; PMC6448132; 30590788.
DR   EuropePMC; PMC6598363; 31297194.
DR   EuropePMC; PMC98188; 11254616.
XX
CC   Original source text: Gallus gallus (strain White Leghorn,
CC   sub_species domesticus) liver cDNA to mRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1736
FT                   /organism="Gallus gallus"
FT                   /sub_species="domesticus"
FT                   /strain="White Leghorn"
FT                   /mol_type="mRNA"
FT                   /cell_line="DUS3"
FT                   /cell_type="epitheleoid"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        69..1196
FT                   /codon_start=1
FT                   /product="beta-actin"
FT                   /db_xref="GOA:P60706"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="PDB:3J0S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60706"
FT                   /protein_id="AAA48615.1"
FT                   /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD
FT                   FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS
FT                   IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW
FT                   IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
XX
SQ   Sequence 1736 BP; 430 A; 449 C; 434 G; 421 T; 2 other;
     ggaacaacnn ggccgcctcg cgccgcccgc cccggctctg actgaccgcg ttactcccac        60
     agccagccat ggatgatgat attgctgcgc tcgttgttga caatggctcc ggtatgtgca       120
     aggccggttt cgccggggac gatgcccccc gtgctgtgtt cccatctatc gtgggtcgcc       180
     ccagacatca gggtgtgatg gttggtatgg gccagaaaga cagctacgtt ggtgatgaag       240
     cccagagcaa aagaggtatc ctgaccctga agtaccccat tgaacacggt attgtcacca       300
     actgggatga tatggagaag atctggcacc acactttcta caatgagctg agagtagccc       360
     ctgaggagca ccctgtgctg ctcacagagg ctcccctgaa ccccaaagcc aacagagaga       420
     agatgacaca gatcatgttt gagaccttca acaccccagc catgtatgta gccatccagg       480
     ctgtgctgtc cctgtatgcc tctggtcgta ccactggtat tgtgatggac tctggtgatg       540
     gtgttaccca cactgtgccc atctatgaag gctacgccct cccccatgcc atcctccgtc       600
     tggatctggc tggccgtgac ctgacggact acctcatgaa gatcctgaca gagagaggct       660
     acagcttcac caccacagcc gagagagaaa ttgtgcgtga catcaaggag aagctgtgct       720
     acgtcgcact ggatttcgag caggagatgg ccacagctgc ctctagctct tccctggaga       780
     agagctatga actccctgat ggtcaggtca tcaccattgg caatgagagg ttcaggtgcc       840
     ccgaggccct cttccagcca tctttcttgg gtatggagtc ctgtggtatc catgaaacta       900
     ccttcaactc catcatgaag tgtgatgtgg atatccgtaa ggatctgtat gccaacacag       960
     tgctgtctgg tggtaccaca atgtaccctg gcattgctga caggatgcag aaggagatca      1020
     cagccctggc acctagcaca atgaaaatca agatcattgc cccacctgag cgcaagtact      1080
     ctgtctggat tggaggctct atcctggcct ccctgtccac cttccagcag atgtggatca      1140
     gcaagcagga gtacgatgaa tccggaccct ccattgtcca ccgcaaatgc ttctaaaccg      1200
     gactgttacc aacacccaca cccctgtgat gaaacaaaac ccataaatgc gcataaaaca      1260
     agacgagatt ggcatggctt tatttgtttt ttcttttggc gcttgactca ggattaaaaa      1320
     actggaatgg tgaaggtgtc agcagcagtc ttaaaatgaa acatgttgga gcgaacgccc      1380
     ccaaagttct acaatgcatc tgaggacttt gattgtacat ttgtttcttt tttaatagtc      1440
     attccaaata ttgttataat gcattgttac aggaagttac tcgcctctgt gaaggcaaca      1500
     gcccagctgg gaggagccgg taccaattac tggtgttaga tgataattgc ttgtctgtaa      1560
     attatgtaac ccaacaagtg tctttttgta tcttccgcct taaaaacaaa acacacttga      1620
     tcctttttgg tttgtcaagc aagcgggctg tgttccccag tgatagatgt gaatgaaggc      1680
     tttacagtcc cccacagtct aggagtaaag tgccagtatg tgggggaggg aggggg          1736
//

If you have problems or comments...

PBIL Back to PBIL home page