(data stored in SCRATCH zone)

EMBL: L13856

ID   L13856; SV 1; linear; mRNA; STD; ROD; 5098 BP.
XX
AC   L13856;
XX
DT   01-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mesocricetus auratus DNA binding protein (BZP) mRNA, complete cds.
XX
KW   DNA-binding protein; zinc-finger motif.
XX
OS   Mesocricetus auratus (golden hamster)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Cricetidae; Cricetinae; Mesocricetus.
XX
RN   [1]
RP   1-5098
RX   PUBMED; 7935395.
RA   Franklin A.J., Jetton T.L., Shelton K.D., Magnuson M.A.;
RT   "BZP, a novel serum-responsive zinc finger protein that inhibits gene
RT   transcription";
RL   Mol. Cell. Biol. 14(10):6773-6788(1994).
XX
DR   EuropePMC; PMC359208; 7935395.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5098
FT                   /organism="Mesocricetus auratus"
FT                   /mol_type="mRNA"
FT                   /cell_line="M2.2.2"
FT                   /tissue_lib="lambda ZAP IIXR"
FT                   /tissue_type="insulinoma tumor"
FT                   /db_xref="taxon:10036"
FT   5'UTR           1..122
FT   CDS_pept        123..3254
FT                   /codon_start=1
FT                   /gene="BZP"
FT                   /product="DNA-binding protein"
FT                   /note="serum responsive"
FT                   /db_xref="GOA:Q60542"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60542"
FT                   /protein_id="AAC37667.1"
FT                   /translation="MPEDELPADQTVLPGGSDREGGAKNCWQDDVKDDECDSDAENEQN
FT                   HDPNVEEFLQQQDTAIIYPEAPEEDQRQGTPEASGQDENGAADAFSQLLTCPYCDRGYK
FT                   RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRK
FT                   FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPV
FT                   NGRPRSGLKTSQCPSPSLSASPGSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKP
FT                   IVVASGINCSTPLQNGVFSGGGQLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVL
FT                   KVALDGNVIRQVLENNQASLASKEQEAVNASSIQQGGHSVISAISLPLVDQDGTTKIII
FT                   NYSLEQPSQLQVVPQNLKIENPAPTNSCKSEKLPEDLTVKSEKDKGFDGAVDGSTCLLY
FT                   DDCPGDLNALPELKKHYDPEHPAQPPPPAPEAEKPEASASSARDGDLSPSQPPLKNLLS
FT                   LLKAYYALNAQPNSEELSKIADSVNLPLDVVKKWFEKMQAGQIPGQSPEPPSPETGTVN
FT                   IPAKSDEQPQPADGSEPQEDSASGQSPLKMTSSPVLPVGSAINGSRSCTSPPSPLNLSS
FT                   ARSLQGYFCVADGAQEEPQVEPLDLSLPKQQGELLERSTISSVYQNSVYSVQEEPLNLS
FT                   CVKKEPQEDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALA
FT                   ANKQTILIPQVAYTYATTVSPAMQEPPVKVIQPNGNQDERQDTSSEGVSTVEDQNDSDS
FT                   TPPKKKTRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLI
FT                   EHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDGTEQEQEEAGLEA
FT                   LMNEHVGARASPSQADSDERESLTREEDEDSEKEEEEEEDKEMEELQEEKECGNAQAEE
FT                   EEEEEEEEMDGAKDEAAAKTDGAVENGAAPQAGSLEQKASESSEQLSEETTNEA"
FT   3'UTR           3255..5098
FT   polyA_site      5098
XX
SQ   Sequence 5098 BP; 1544 A; 1121 C; 1158 G; 1275 T; 0 other;
     ggcgcaataa cgttacaaat tataacactg tggtagaagc aaattccgat tctgacgatg        60
     aagacaaact ccacattgtg gaagaagaaa gcatcgctga tgcaggtgac tgtgaaggtg       120
     gcatgcccga ggatgagctg ccggctgacc agacagtctt accaggaggc agtgacaggg       180
     aaggcggtgc caagaactgc tggcaagatg acgtaaaaga tgatgagtgt gactcagatg       240
     cagaaaatga gcaaaaccat gaccctaatg tggaagagtt cctgcaacag caagacaccg       300
     ccatcattta ccccgaggca cccgaggagg accagcggca gggcacgcca gaggccagtg       360
     gtcaggacga aaacggagca gcagatgcat tttcccaatt gctaacctgc ccatattgcg       420
     atagaggcta caagcgcttt acctctttga aagagcacat taagtaccgc catgaaaaga       480
     acgaagacaa tttcagctgc tccctgtgca gttacacctt tgcatacaga acccagcttg       540
     aacgccacat gacatcacat aagtcaggaa gagagcaaag acatgtgacg cagtctgggg       600
     gcaaccgtaa attcaagtgc actgagtgtg gaaaagcctt caaatataaa caccacctaa       660
     aagagcactt acgaattcac agtggagaga agccatatga atgcccaaac tgcaagaaac       720
     gtttttccca ttctggttcc tatagctcac acataagcag taagaagtgt attagcttga       780
     tgcctgtgaa tgggaggcct agatcaggac tcaagacatc gcagtgtccc tcaccatctc       840
     tttcggcatc accaggcagt cccacgcgcc cacagatacg gcagaagata gagaataaac       900
     cccttcaaga accgctttct gtaaaccaaa tcaaaactga acctgtggat tatgagttca       960
     aacccatagt ggttgcttca ggaatcaact gttcaacccc tttacaaaac ggggttttta      1020
     gcggtggtgg ccaattgcag gcaaccagtt ctcctcaggg tgtggtgcaa gctgttgttc      1080
     tgccaacagt cggtttggta tctcccataa gtatcaattt aagtgacatt cagaatgtac      1140
     ttaaagtggc actagacggt aacgtaatac ggcaagtttt ggaaaataat caagccagtc      1200
     ttgcatccaa agagcaagaa gcagttaatg cttcatccat ccagcagggt ggtcattctg      1260
     ttatttctgc catcagtctt cctttagttg atcaagatgg aacaaccaaa atcatcatca      1320
     actacagtct tgagcagccc agccaacttc aggttgttcc tcagaattta aagatagaaa      1380
     acccagcccc tacaaatagc tgcaaaagtg agaagttacc agaagacctt actgttaaat      1440
     cagaaaagga caaaggcttt gatggggctg tggatggtag cacttgcctt ctgtatgatg      1500
     attgcccagg agacctcaat gcacttccag aactaaaaaa gcactatgac ccagagcacc      1560
     ctgcccagcc tccaccccct gcccccgaag ccgagaagcc cgaggcctct gcttcatcag      1620
     ccagggatgg cgatttgtct cccagtcagc cacctttaaa gaacctccta tcgctcttaa      1680
     aagcctacta tgctctgaac gcacagccaa actcagaaga gctctcaaag attgccgact      1740
     ctgtgaacct acccctggat gtagttaaaa agtggtttga aaagatgcaa gctggacaga      1800
     ttccagggca gtctcctgag ccaccgtctc cagaaacggg cacagtaaac atccctgcaa      1860
     agagcgatga acagcctcaa cctgcagatg gaagtgagcc ccaggaagac agcgcaagtg      1920
     gacagagtcc tctcaagatg actagctccc cggttttacc agtaggatca gccatcaatg      1980
     gttccagaag ttgcacatca cccccatcac ctctaaacct ttcctcggcc aggagcctgc      2040
     agggttactt ttgtgtggca gacggtgccc aggaggagcc ccaagtagaa cctcttgatc      2100
     tctcactacc aaagcaacag ggagagttac tggaaaggtc gactatcagc agtgtttacc      2160
     agaacagtgt ttattctgtc caggaagaac ccttgaactt gtcttgtgta aaaaaggagc      2220
     cacaagagga cagctgtgtt acagactcag aaccagttgt aaatgtaatc ccaccaagtg      2280
     ccaaccccat aaatattgct attcctacag tcactgccca gttacccacc atcgtggcca      2340
     ttgctgacca gaacagtgtt ccctgcttac gtgcactggc tgccaacaag cagactattc      2400
     tgattcccca ggtggcttat acatacgcta ctacagtcag ccctgcaatg caggaaccac      2460
     cggtgaaggt aatccagcca aatggaaacc aggatgaaag gcaagacact agctcagaag      2520
     gagtctccac agtggaggac cagaacgact ctgactctac accacccaaa aagaaaactc      2580
     ggaagacaga gaatggaatg tatgcatgtg acctatgtga caagatattt cagaagagca      2640
     gctcactgct gagacacaag tatgaacaca caggtaaaag accccatgag tgtggaatct      2700
     gtaaaaaggc atttaaacac aaacatcatt tgattgaaca catgagatta cactctggag      2760
     aaaagcccta tcaatgtgac aagtgtggca agcgcttctc acactcggga tcttattctc      2820
     agcacatgaa tcaccgctac tcctactgca agagagaagc agaagaaaga gatggcacgg      2880
     agcaggagca ggaagaggct gggctggaag ccctgatgaa tgagcatgtg ggtgcgcggg      2940
     catctccctc acaggctgac tcggatgaga gagaaagttt gacaagggag gaggatgaag      3000
     acagtgaaaa ggaggaagag gaggaggagg ataaagagat ggaagaattg caggaagaaa      3060
     aggaatgtgg gaatgcacag gcggaggagg aggaggagga ggaagaggag gagatggatg      3120
     gagccaagga tgaggcagca gccaagactg atggtgccgt ggagaatggg gctgctccgc      3180
     aggcaggcag cttagagcag aaggcaagcg agagcagcga gcaactgtca gaggagacga      3240
     caaatgaagc ctaggagctc ttctagaagg aaattctact tggtaatgaa atttgctcta      3300
     tattacccac gcttttcatg gaaacacggc ccctgtgccg tggttcctgc tcactactgt      3360
     gtaatgtcag aactgaaaaa aaaatacaaa aaaaaaaatc cgggtgtgcc tgaacctcag      3420
     acctagtaat ttttcatgca gttttcagag ttaggaacac atatgtaaca tgaagcagaa      3480
     tagaaaactt cagagactga gaagcaggtt tcttagcagg ttacagggag ctggatgggc      3540
     atctggcatg gttatcagta ttatcactct tacgttggtt cattcttaag ctgtacaatg      3600
     ggagaaattt tataattttt attggtaaac atatgctaaa gccgcttcag tattttatta      3660
     tgttttttta aaatgtgaga acttctgcac tacagaattc ccttcacaga gcagtagaaa      3720
     gcagttccaa ccgtgctgac tacctgttac caagtcagtc aggaggtagg acctctacgt      3780
     tagacgccat gttgtcattt aacatgtatt gctagcctta aggaagcagc cgagagaaga      3840
     actgaagttt cttactcatg tgattttaaa tggagttcaa aggttgtcgt tgagttctga      3900
     ctgcagggac gaacagtatt gatgtggtga ggacgacaga gtctgcagaa tcagtgttcg      3960
     tgattgtgtt tgcgtacgtg gtagcaacta tgaaggatct ataggaagcg ttatgtctcc      4020
     tttggcctta agcaagacct gtgtgctgta agtgccattc tcagtatttc aaggctctaa      4080
     ctgccttcat tcagtgtgtg gcctacaata actagcattt gttgatttgt ttgatgtttc      4140
     aaaattccca aacaaaactc aaaaccactg actctgtcag agaagctgaa gcactgggac      4200
     atctcatacc ttggttcctc agtattcatt ttacgttgat tgactttcgg aaatctctac      4260
     agaaacaaaa gggaaattct ctaaactact taatccatgt actttcgtgt cagacatgga      4320
     taagccatta gtatttggct tacaaccatt tccaaatgtt agttattacg gacccagttg      4380
     atgaacaaca ttagctgatt tttacctatc agtattattt tatttctttt agtttataga      4440
     tctgtgcaac atttttgtac tgtatgtctt caagcctggc agtattaata cccttcttac      4500
     tgacacgtac ttttagtttt agaaaacttt tatatttatg tgtcttattt ttatatttct      4560
     ttatttatta cacagtgtag tgtataatac tgtagtttgt attaatacaa taatatattt      4620
     tagtatgaaa ttttggaaag ttgataagat ttaaagtaga gatgcaattg gttctcgtgc      4680
     attgagattt gatttaacag tgttctgtta acatttatac tcgccttggg ctgtagagca      4740
     gagtttaaat gggaatgtat tagttttaca actacaatca agtcattctc cctttaccca      4800
     gtttttaata tgaaactctt cactttgaaa ctcactgtgt gactcatagc atgatgctct      4860
     gcagttcttc tgttaagagt tggcccagcc ataacccatt cccttagcaa gccaaattag      4920
     aattgccttc tgtaaacagt gttgggaaca atgtttaaca tgttgtgcca atttgttcct      4980
     gtatccatgt atgtaagcta ccaatccgac tcttcctttt aagttccttg ttacaccatg      5040
     gtcattttct agttttttac cagactcccc agctcacaat aaaatgcatc aacaagcc        5098
//

If you have problems or comments...

PBIL Back to PBIL home page