(data stored in ACNUC22857 zone)

EMBL: L13939

ID   L13939; SV 1; linear; mRNA; STD; HUM; 3859 BP.
XX
AC   L13939;
XX
DT   11-AUG-1994 (Rel. 40, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens beta-prime-adaptin (AP1B1) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3859
RX   DOI; 10.1093/hmg/3.8.1393.
RX   PUBMED; 7987321.
RA   Peyrard M., Fransson I., Xie Y.G., Han F.Y., Ruttledge M.H., Swahn S.,
RA   Collins J.E., Dunham I., Collins V.P., Dumanski J.P.;
RT   "Characterization of a new member of the human beta-adaptin gene family
RT   from chromosome 22q12, a candidate meningioma gene";
RL   Hum. Mol. Genet. 3(8):1393-1399(1994).
XX
RN   [2]
RP   1-3859
RA   Peyrard M.;
RT   ;
RL   Submitted (03-AUG-1994) to the INSDC.
RL   Dept. of Molecular Medicine, Karolinska Hospital, CMM building L8:00,
RL   Stockholm S-171 76, Sweden
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3859
RA   Peyrard M.;
RT   ;
RL   Submitted (30-DEC-1998) to the INSDC.
RL   Dept. of Molecular Medicine, Karolinska Hospital, CMM building L8:00,
RL   Stockholm S-171 76, Sweden
XX
DR   MD5; 4e728bacb4074912b88cc8693b61e1bc.
XX
CC   On Dec 30, 1998 this sequence version replaced gi:520827.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3859
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        47..2896
FT                   /codon_start=1
FT                   /gene="AP1B1"
FT                   /product="beta-prime-adaptin"
FT                   /note="candidate meningioma tumor suppressor"
FT                   /db_xref="GOA:Q10567"
FT                   /db_xref="H-InvDB:HIT000192232.14"
FT                   /db_xref="HGNC:HGNC:554"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="PDB:4HMY"
FT                   /db_xref="PDB:4P6Z"
FT                   /db_xref="PDB:6CM9"
FT                   /db_xref="PDB:6CRI"
FT                   /db_xref="PDB:6D83"
FT                   /db_xref="PDB:6D84"
FT                   /db_xref="PDB:6DFF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10567"
FT                   /protein_id="AAC98702.1"
FT                   /translation="MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGK
FT                   DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLD
FT                   TLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFI
FT                   LDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLL
FT                   KKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHK
FT                   PPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNL
FT                   DLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAP
FT                   IGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTN
FT                   KALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNL
FT                   QVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAE
FT                   AASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKC
FT                   RAPEVSQHVYQAYETILKN"
XX
SQ   Sequence 3859 BP; 833 A; 1179 C; 1120 G; 727 T; 0 other;
     gagctattgg gacctgcgga agcctggcta cagataaggg accaaaatga ctgactcaaa        60
     atatttcacc acgaccaaga aaggggagat cttcgagctg aaggcagagc tcaacagtga       120
     caagaaggag aagaagaagg aggcagtgaa gaaagtgatt gcatcgatga ccgtgggcaa       180
     agatgtcagt gccctcttcc ccgatgtggt caactgcatg cagacggaca acctggagct       240
     gaagaagctg gtatacctct acttgatgaa ttacgccaag agtcagcctg acatggccat       300
     tatggccgtc aacacctttg tgaaggactg tgaggacccc aaccccctca tccgagccct       360
     ggcagtgcgg accatgggct gcatccgcgt tgacaagatc acagagtacc tgtgcgagcc       420
     actccggaag tgcctgaagg acgaggatcc atatgtgcgc aagacagcag ctgtgtgcgt       480
     ggccaagctc cacgacatca acgcccagct ggtggaggac cagggcttcc tggacaccct       540
     taaagacctc atctccgact ctaaccccat ggtggtggcc aatgcagtgg cagcgctctc       600
     agaaattgcc gagtctcacc ccagcagcaa cctgctcgat ctgaacccac agtccatcaa       660
     caagctgctg acagccctca atgagtgcac cgagtggggc cagatcttca tcctggactg       720
     cctcgccaac tatatgccca aggacgaccg cgaggcccag agcatctgtg agcgggtcac       780
     ccccaggctc tcccatgcca actccgctgt ggtgctctct gctgtgaagg tgctgatgaa       840
     gttcatggag atgttgtcta aggacttgga ctactacggc acactgctca agaagctggc       900
     cccacccctg gtcacactgc tgtcagccga gccagagctg cagtatgtgg ccctgcgcaa       960
     catcaatctc atcgtgcaga aaaggcctga gatcctgaag catgagatga aggtgttctt      1020
     cgtgaagtac aacgacccta tctacgtgaa gctggagaag ctggacatca tgatccgcct      1080
     ggcctctcag gccaacatcg cccaggtgtt ggcagagctg aaagagtacg caacagaagt      1140
     ggatgtggac tttgtacgga aggctgtgcg tgctattggc cgctgcgcca tcaaggtgga      1200
     gcaatctgcg gagcgctgtg tgagcacgct gctcgacctc atccagacca aggtcaacta      1260
     tgtggtccag gaggccatcg tggtcatcaa ggacatcttc cgcaagtacc ccaacaagta      1320
     tgagagtgtg attgccacac tgtgtgagaa tctggactcc ctggatgagc ctgaggcccg      1380
     ggctgccatg atctggattg tgggcgagta cgcggaacgg atcgacaacg cagatgagct      1440
     gctggagagc ttcctcgagg gcttccatga cgagagcaca caggtccagc tgcagctgct      1500
     gacagccatt gtgaaactct ttctaaagaa gccaacagag acccaggagc tggtgcagca      1560
     ggtcctcagt ttggccactc aggactcaga taacccagac ctgcgggacc gtggctacat      1620
     ctactggcgc ctgctgtcca cggacccggt ggcagccaag gaggtggtgt tggctgagaa      1680
     gccactcatc tctgaagaga cggacctcat cgagcccaca ctgttagacg agcttatctg      1740
     ctacatcggc acgctggctt ccgtctacca taagcctccc agtgcctttg tggagggggg      1800
     ccggggcgtc gtgcacaaga gcctgccacc tcgcacggcc tcgagtgaga gcgcagagag      1860
     ccctgagaca gcccctactg gagcacctcc tggggagcag ccagatgtca tccccgccca      1920
     gggcgacctg ctgggtgacc tcctcaacct ggacctcggc cccccagtga gcggcccacc      1980
     cctggccacc tcctcggtgc agatgggagc tgtggacctt cttggcggtg gccttgacag      2040
     cctgatgggg gatgagcctg aagggattgg gggcaccaac ttcgtggcac ctccaacagc      2100
     agcagtacca gccaatcttg gagcacccat cggcagtggc ctgagtgacc tctttgacct      2160
     gaccagtggc gtgggcaccc tgtcaggatc atatgtggcc cccaaagcag tctggctccc      2220
     agccatgaag gctaaggggc tggagatctc aggcaccttc acccgccagg tgggctccat      2280
     ctccatggac ctgcagctga ccaacaaggc cttgcaggtc atgaccgact ttgccatcca      2340
     gttcaaccgc aacagctttg gcctggcccc cgccgccccc ctccaggtcc acgcgccact      2400
     cagccccaac cagacagtgg agatctccct gcctctcagc acggtgggct cggtcatgaa      2460
     gatggagcct ctgaacaacc tccaggtggc cgtgaagaac aacatcgatg tcttctactt      2520
     cagcaccttg tacccactgc acatcctctt tgtggaggac gggaagatgg accggcagat      2580
     gttcctggcc acatggaagg atattcccaa tgagaatgag gcccagttcc agatcagaga      2640
     ctgccccctc aatgcagagg ctgcgagcag caagctgcag agcagcaaca tcttcactgt      2700
     cgccaagagg aacgtggagg gccaggacat gctctaccag tccctgaagc tgaccaacgg      2760
     catctgggtg ctggcggagc tgcggatcca gccgggcaac cccagctgca cggacttaga      2820
     gctgtccctg aagtgtcgag caccagaggt gtcccagcac gtgtaccagg cctacgagac      2880
     catcctcaag aactgagacc ccggccagcg cccaccccag ccttctgccc gccccatcga      2940
     ggaggcccct cgggggcagc acatcttcct cctcgcagga gggaccaggc ggggctccag      3000
     gccactcagt gggctccctg gtcctgatgg cagaacccac ccgatccctg gggtagggca      3060
     ccaccccctc ctggggtgag agcgcagtgc actcccgtgc tctgggacac ccctgctcct      3120
     gtggctgtga tgtggggtta agtgaggtgg ggaccaaagg aaacagagcc agagcagcca      3180
     cagaagctgt gcctgaaggg tgagtgtgga gcttgcccct ccggctcaca gccccggcag      3240
     cccctggctc cttggtctct ccggttggtg ttaaagggcc ctccactgcc acctctcatg      3300
     ggatggaccc tgccaacctg gcctgggtgt gcagggaggg gttccccttg gtaccaggag      3360
     agctgctcac ttagggcctg gggctcaagg agctgtaggt gccggcagag gggcagagct      3420
     aggctgggag gagcccaggg cctgcaccac ccacttgcaa ccaccaggct ggtgccctgc      3480
     agctgtgcca gttgggccac agcctcccga gtgctgaccc acatggtcaa gaccaggcag      3540
     aagctcccag agcccctgtc tcgggctccc caccgactgg cagctgcact atccccaact      3600
     ccccacttct gccccaaggg tggtcactgc ctgtgataca ttcctcagtg tcgcctctga      3660
     gcccaggcct cctgccacaa agactgggcc gagagatggg gctgggtaag cgggtgcgcc      3720
     tcctgtttgg gtttcttcgg ggtttctctg tagtgtctgc tgccctcctc ctggcctccc      3780
     aggtttcagt tgtgtctgac agagcattag gttttcctgt tactgctgtg taataataaa      3840
     gaaagattcg gcttttggc                                                   3859
//

If you have problems or comments...

PBIL Back to PBIL home page