(data stored in SCRATCH zone)

EMBL: L14580

ID   L14580; SV 1; linear; genomic DNA; STD; PRO; 6357 BP.
XX
AC   L14580;
XX
DT   21-APR-1993 (Rel. 35, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   Bacillus subtilis glutamyl-tRNA transferase (gltX), serine
DE   acetyltransferase (cysE), and cysteinyl-tRNA synthetase (cysS) genes,
DE   complete cds's.
XX
KW   cysE gene; cysS gene; cysteinyl-tRNA synthetase; gltX gene;
KW   glutamyl-tRNA synthetase; serine acetyltransferase; T-box; transfer RNA;
KW   tRNA synthetase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-6357
RX   PUBMED; 2120226.
RA   Breton R., Watson D., Yaguchi M., Lapointe J.;
RT   "Glutamyl-tRNA synthetases of Bacillus subtilis 168T and of Bacillus
RT   stearothermophilus. Cloning and sequencing of the gltX genes and comparison
RT   with other aminoacyl-tRNA synthetases";
RL   J Biol Chem 265(30):18248-18255(1990).
XX
RN   [2]
RX   PUBMED; 1735721.
RA   Henkin T.M., Glass B.L., Grundy F.J.;
RT   "Analysis of the Bacillus subtilis tyrS gene: conservation of a regulatory
RT   sequence in multiple tRNA synthetase genes";
RL   J. Bacteriol. 174(4):1299-1306(1992).
XX
RN   [3]
RP   1-6357
RX   PUBMED; 7510287.
RA   Gagnon Y., Breton R., Putzer H., Pelchat M., Grunberg-Manago M.,
RA   Lapointe J.;
RT   "Clustering and co-transcription of the Bacillus subtilis genes encoding
RT   the aminoacyl-tRNA synthetases specific for glutamate and for cysteine and
RT   the first enzyme for cysteine biosynthesis";
RL   J Biol Chem 269(10):7473-7482(1994).
XX
DR   MD5; 58e47c40ca53d440555017c39b4a3dca.
DR   EuropePMC; PMC123842; 11916687.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6357
FT                   /organism="Bacillus subtilis"
FT                   /map="11-16 degrees"
FT                   /strain="168T"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /db_xref="GOA:Q06754"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06754"
FT                   /protein_id="AAA21793.1"
FT                   /translation="DILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTN
FT                   DFNLNKVCELQKVAVLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMI
FT                   VVEEGRNYIGKHIDVLVTSVLQTAAGRMIFAKPKLLEKAL"
FT   CDS_pept        448..1146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /db_xref="GOA:Q06755"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="PDB:5DDT"
FT                   /db_xref="PDB:5DDV"
FT                   /db_xref="PDB:5HS2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06755"
FT                   /protein_id="AAA21794.1"
FT                   /translation="MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQ
FT                   CDKIILVINEQDREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHD
FT                   GARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQA
FT                   FRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAI
FT                   MESESGNKHV"
FT   CDS_pept        1139..1615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /db_xref="GOA:Q06756"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="PDB:5IWX"
FT                   /db_xref="PDB:5IWY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06756"
FT                   /protein_id="AAA21795.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKP
FT                   KMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG"
FT   regulatory      1622..1627
FT                   /gene="gltX"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      1643..1648
FT                   /gene="gltX"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      1688..1698
FT                   /gene="gltX"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1706..3157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="GOA:P22250"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22250"
FT                   /protein_id="AAA21796.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVED
FT                   TDKKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGK
FT                   VIAFNDIVKGEISFESDGIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYQAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFI
FT                   GLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVEL
FT                   TLPHLQKAGKVGTELSAEEQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAK
FT                   AVLEEEQVPEVLSTFAAKLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELIGKETAIQRLKNI"
FT   misc_feature    3354..3371
FT                   /standard_name="T-box"
FT                   /note="conserved sequence for T-box"
FT                   /citation=[2]
FT   regulatory      3379..3415
FT                   /regulatory_class="terminator"
FT   CDS_pept        3459..4112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="serine acetyltransferase"
FT                   /db_xref="GOA:Q06750"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06750"
FT                   /protein_id="AAA21797.1"
FT                   /translation="MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHAL
FT                   YKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVG
FT                   IPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK"
FT   CDS_pept        4109..5509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="GOA:Q06752"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06752"
FT                   /protein_id="AAA21798.1"
FT                   /translation="MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGAL
FT                   GCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDEL
FT                   RSGARIRVGEKKEDALDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KQHDPQLLRFFMLSVHYRHPINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDD
FT                   DQWLEKVEEHRKAFEEEMDDDFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMF
FT                   DRIVSVLGFSLGEQELLDQEIEDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQ
FT                   GTRWKRGE"
FT   CDS_pept        5928..>6357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="ORFD1"
FT                   /db_xref="GOA:Q06753"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06753"
FT                   /protein_id="AAA21799.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELA
FT                   KKQGITIQYVPRKKLDQMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDE
FT                   LEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKA"
XX
SQ   Sequence 6357 BP; 1969 A; 1196 C; 1622 G; 1570 T; 0 other;
     gatatcctga accgcattca gaaagaatta gacattgaag ttgaaattta cgaaggcgac        60
     tttgaagata ttcaggaggt tgacagcaag ctcgtcaaac ttgctaagct gacatccggg       120
     gtcgttgtga cgaatgattt taatttaaat aaagtgtgcg agcttcagaa ggtagcagta       180
     ttaaacatta atgaccttgc caatgcggtt aagcctgttg tgcttcctgg cgaggaaatg       240
     aatgttcagg tcattaagga cgggaaagag cataatcagg gagttgccta cttggatgac       300
     ggtacgatga ttgtcgttga agaaggacgg aattatatcg gcaagcatat tgatgtactc       360
     gtcacaagtg tgctgcagac agcagcggga cgaatgattt ttgcgaagcc taagctgttg       420
     gagaaggcgc tgtaaaggga gaagaacatg agttatgatg tggtgattcc tgcagccgga       480
     cagggaaagc ggatgaaggc agggagaaat aaactgttca ttgagctgaa gggagacccg       540
     gtgatcatac acacgttaag agtgtttgac agccaccggc agtgcgataa aatcattttg       600
     gtgattaacg agcaggaccg ggagcacttt cagcaattgc tgtccgatta cccgtttcaa       660
     acttcaattg agcttgttgc aggcggagat gagcgacagc acagtgtgta taaggggctg       720
     aaagccgtaa agcaggaaaa gattgtcctt gtacatgacg gtgcccgtcc atttataaaa       780
     catgaacaaa ttgacgaact gatcgcagag gcggaacaga caggagcggc catccttgct       840
     gttccggtaa aagatacgat taaacgcgtt caagatttac aagtcagtga gacgattgaa       900
     cgttcaagct tgtgggctgt ccaaacgcca caagcttttc gtctttcttt attgatgaag       960
     gctcacgctg aggccgagcg caagggattt ttagggacgg atgacgccag cctcgttgaa      1020
     cagatggagg gcggttcggt ccgtgttgta gaaggcagct atacaaatat taagctgacg      1080
     acgccagacg atttgacgtc agctgaagct atcatggaat cagaaagtgg gaataaacat      1140
     gtttagaatt ggacaaggat ttgatgtgca tcaattagtg gagggccgtc ctctcattat      1200
     tggcggaatt gaaatcccgt acgaaaaagg gctgcttggc cattctgatg cagacgtatt      1260
     gttgcatacc gtcgctgacg cctgcctggg agctgtgggt gaaggagaca taggcaagca      1320
     ttttcctgac acagatcccg agttcaagga cgcagattct ttcaaattac ttcagcatgt      1380
     ctggggaatc gtgaaacaga aggggtatgt ccttgggaac attgattgca ccatcatagc      1440
     gcaaaagccg aagatgctgc cgtacataga agatatgaga aaaagaattg ctgaaggcct      1500
     tgaggcagat gtttctcaag taaatgtaaa agcaacaacg acagaaaagc ttggatttac      1560
     aggccgggcg gaaggaatag cggctcaggc gacagtactg atacaaaaag gctaacttgt      1620
     tttgatgccg ggtctatttg gtggtagaat agattcatac atttttgcct gaggccatac      1680
     atgacatgaa aggaagtatt tgaaaatggg aaacgaagta cgcgtccgtt atgcaccgag      1740
     tccaaccgga catttgcata ttggaaatgc cagaacggcg ctttttaatt atttatttgc      1800
     ccgcaatcaa ggcggtaagt ttatcattcg agttgaggat actgataaaa agcgcaatat      1860
     tgagggcgga gaacaaagcc agctgaatta tctgaagtgg ctaggtattg actgggatga      1920
     gagtgtggat gtcggaggag agtacggtcc ataccgtcag tcagagcgta acgatatcta      1980
     taaagtgtac tatgaagagc ttcttgaaaa agggcttgct tataaatgtt actgtacgga      2040
     agaagagctt gaaaaagagc gtgaagaaca gattgcccgc ggagaaatgc ctcgttattc      2100
     cggaaaacac agagacctga ctcaggaaga acaggagaaa tttatcgccg aaggcagaaa      2160
     accaagtatt cgtttccgtg tgccggaagg aaaagtcatc gccttcaacg acatcgtaaa      2220
     aggcgaaatt tcttttgaat cagatggcat cggcgacttc gttattgtga aaaaggacgg      2280
     aacgcctact tataacttcg cggtagctat tgatgactac ttaatgaaaa tgacacacgt      2340
     gctgcgcggt gaggatcata tttctaacac accgaaacag attatgatct atcaagcatt      2400
     cgggtgggat attcctcagt tcggacacat gacgctgatt gtaaacgaaa gccgtaaaaa      2460
     gctcagcaaa cgtgatgaat ccattattca attcatcgag cagtacaaag agcttggcta      2520
     cctgccagaa gcgctgttca actttatcgg cttgttaggc tggtcaccgg ttggagaaga      2580
     agagcttttc acaaaagagc agtttattga aatttttgat gtaaatcgtt tatctaaatc      2640
     accagctttg tttgatatgc ataagctaaa atgggttaac aaccaatatg tgaagaagct      2700
     ggatcttgat caggttgttg aactgacgct tccgcatttg caaaaagccg gcaaagttgg      2760
     cactgagctt tctgctgaag aacaagaatg ggttcgtaaa ctgatttccc tgtatcatga      2820
     gcaattaagc tacggtgcgg aaattgttga gctgactgat ttgttcttta cggatgagat      2880
     cgagtataat caagaagcga aagctgttct ggaagaagaa caggttcctg aagtgctcag      2940
     cacattcgca gcgaagcttg aagagcttga ggagttcact ccggataata tcaaagcatc      3000
     gatcaaagca gtgcagaaag aaactggcca taaagggaaa aaactgttta tgccgattcg      3060
     tgttgctgta acagggcaaa ctcacggtcc ggaactgccg caatcaattg aattgatcgg      3120
     taaagagact gcaattcagc gtttaaagaa tatctaaata aatgattgtt gacagggaag      3180
     agtataaagc tttaggccat tacagaaagg atcttcattg gctgagagag atccatgagc      3240
     cgggttttag aagtgcgccc ttaagacctt tgaagaacgt tttttgaaat cagtattcaa      3300
     aggcggccgc cgccgttaca ggctgaagtt gggagagcag aagtctgctt ttcaaacaga      3360
     gtggaaccgc gcggttaaag cgtctctgtc atgtttacat gcagagacgc tttttttatt      3420
     gggtagagga aatcagatag agaaacgggg ggaagcatgt gttttttaga atgctcaaag      3480
     aagacattga tactgtgttc gatcaagatc ccgcagcaag aagctatttt gaagtgattt      3540
     taacttattc cggtttacat gctatatggg cgcatcggat tgcacatgct ttatataaac      3600
     gaaaatttta tttccttgca cgccttatat ctcaagtaag ccgatttttt accgggatag      3660
     aaatccaccc cggcgctaca atcgggagaa gatttttcat agaccacggc atgggggttg      3720
     tcattgggga gacatgtgaa atcggcaata acgtaaccgt ttttcagggg gttaccctcg      3780
     ggggaacggg aaaagaaaag ggaaaaaggc acccaacgat taaagatgac gcattgatag      3840
     ccacaggtgc taaagtgctc ggttctatta cggtcggtga aggctcaaag attggcgctg      3900
     gttcagtagt gctgcatgat gttcctgatt tttcaacagt tgtcggtatc cctggacggg      3960
     tcgttgtaca aaatggcaag aaagtaagac gcgatttaaa ccatcaggat ttgcccgatc      4020
     cagttgctga ccgctttaag tctttggaac agcagatttt agagctgaag gcagaacttg      4080
     aagacagaaa agaaaggatc aatcaaaaat gacaatcaca ctttataata cattgactag      4140
     acagaaggaa acattcgttc ctcttgaaga gggaaaagtg aaaatgtatg tatgcggacc      4200
     cacggtttac aattacattc atatcgggaa cgcgcgtccg gcaatcgttt acgatacggt      4260
     tcgaaactat ttagagtata aaggctatga tgtgcagtat gtctctaact tcacagacgt      4320
     agacgataaa ttaattaaag cggcaaatga actcggtgag gatgtaccca ccatttcaga      4380
     gcgttttatt aaagcatact ttgaagacgt aggtgcgctc ggctgccgaa aagccgacct      4440
     tcatccgcga gtaatggaga acatggatgc cattatcgaa ttcgtagatc agctcgtgaa      4500
     aaagggctac gcatatgaat cagaaggtga cgtatatttc aaaaccagag catttgaagg      4560
     gtacggaaag ctttctcagc aatcaatcga tgaactaaga tcaggtgcac gcatccgggt      4620
     cggcgagaaa aaagaagatg ctcttgattt cgcactgtgg aaagcggcaa aagaaggaga      4680
     aatctcttgg gatagccctt gggggaaagg gcgtccgggc tggcacattg aatgctcagc      4740
     aatggtgaaa aagtatctcg gtgaccagat tgatatccat gcgggcggac aggatttaac      4800
     attccctcac catgaaaacg aaattgcgca atctgaggcg ctgacaggca aaacgtttgc      4860
     gaagtactgg cttcataatg gttatatcaa tattgataat gaaaaaatgt caaaatcact      4920
     aggcaacttt gtgcttgtgc atgacatcat taaacagcat gatccgcagc ttttgagatt      4980
     ctttatgcta tctgttcatt atcgccatcc gattaactat tcagaagagc ttctggagaa      5040
     tacgaaaagc gcgttcagcc gtttaaaaac agcgtacagc aatcttcagc accgtctgaa      5100
     cagcagtacg aatttaaccg aagatgacga tcaatggctt gaaaaggttg aagaacaccg      5160
     caaagcattc gaagaagaga tggacgatga ttttaatacg gcgaatgcca tttcagtctt      5220
     gtttgactta gcgaaacacg ccaattatta tcttcagaaa gatcatacgg ctgatcatgt      5280
     gattacggcg tttattgaga tgtttgaccg cattgtttct gtcctcggtt tttcgttggg      5340
     tgagcaggaa cttctcgatc aagagattga agacttaatc gaaaagcgaa atgaagcgcg      5400
     ccggaatcgc gattttgcat tgtcagacca gatccgcgac cagctgaaaa gcatgaatat      5460
     cattcttgaa gatacggctc aaggcactcg ctggaaacgg ggagaataac agatgcttga      5520
     atttgatacg ataaaagatt ctaagcagct taacggtctt gcgcttgctt atataggtga      5580
     tgccattttt gaagtgtatg tcaggcatca cctgcttaag cagggcttta ccaaaccaaa      5640
     tgatcttcat aagaaatcaa gccggattgt ttcagcaaag tcacaggctg agatcctatt      5700
     ttttctgcag aatcaatcat tttttacgga agaagaggaa gcggtgctga aaagaggcag      5760
     aaatgccaag tcagggacaa cacctaaaaa tacagatgtt cagacgtacc gctacagtac      5820
     agcatttgaa gcgcttctgg gctacctttt tctagagaaa aaagaggaac gacttagtca      5880
     gctcgtagcc gaagctatac aattcgggac gtcagggagg aaaacaaatg agtcagcaac      5940
     atgattacgt catagggaaa aatgcagtga tcgagacgtt aaaatctgat cggaagctgt      6000
     ataagctgtg gatggcggaa aacaccgtaa agggacaagc acagcaagtg attgagcttg      6060
     ccaaaaagca gggaatcacg attcaatacg tcccgagaaa aaaactcgat caaatggtga      6120
     caggacagca tcagggcgta gtggcacagg ttgcagcgta tgaatatgca gaactggacg      6180
     atttatataa agcagccgaa gaaaaaaatg aacagccttt cttcctcatt ctggacgagc      6240
     ttgaagaccc tcataatctt ggttccatta tgaggacagc agatgcggtc ggcgctcatg      6300
     gcatcgtcat tccaaaacgg agagctgtcg ggctgacaac aacagtggca aaagctt         6357
//

If you have problems or comments...

PBIL Back to PBIL home page