(data stored in ACNUC9552 zone)

EMBL: L14680

ID   L14680; SV 1; linear; mRNA; STD; ROD; 1179 BP.
XX
AC   L14680;
XX
DT   05-OCT-1993 (Rel. 37, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 8)
XX
DE   Rattus norvegicus BCL2 (bcl-2) mRNA, complete cds.
XX
KW   bcl-2 gene; dinucleotide repeat; oncogene.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1179
RX   DOI; 10.1016/0378-1119(94)90561-4.
RX   PUBMED; 8144041.
RA   Sato T., Irie S., Krajewski S., Reed J.C.;
RT   "Cloning and sequencing of a cDNA encoding the rat Bcl-2 protein";
RL   Gene 140(2):291-292(1994).
XX
DR   MD5; 07e97813df673d25e6a9a98929f8aa47.
DR   EuropePMC; PMC185835; 7560090.
DR   EuropePMC; PMC21377; 9689119.
DR   EuropePMC; PMC2532498; 18556117.
DR   EuropePMC; PMC2590756; 12803975.
DR   EuropePMC; PMC2590760; 15545017.
DR   EuropePMC; PMC2855499; 15744743.
DR   EuropePMC; PMC371087; 15016872.
DR   EuropePMC; PMC4239606; 25294882.
XX
CC   On Oct 19, 1993 this sequence version replaced gi:405552.
CC   Original source text: Rattus norvegicus (library: Clontech;
CC   TS95-11-2) brain cDNA to mRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1179
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="Clontech; TS95-11-2"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10116"
FT   gene            1..1179
FT                   /gene="bcl-2"
FT   CDS_pept        235..945
FT                   /codon_start=1
FT                   /gene="bcl-2"
FT                   /product="BCL2"
FT                   /db_xref="GOA:P49950"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013278"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49950"
FT                   /protein_id="AAA53662.1"
FT                   /translation="MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPT
FT                   PGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRR
FT                   YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVNREM
FT                   SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLAL
FT                   VGACITLGAYLGHK"
FT   repeat_region   1061..1112
FT                   /rpt_unit_range=1061..1062
FT   polyA_site      1179
FT                   /gene="bcl-2"
XX
SQ   Sequence 1179 BP; 295 A; 316 C; 306 G; 262 T; 0 other;
     cctcatgaaa taaaaagctg aaaggaattt gaataaaaat ttcctgcatc tcatgccaag        60
     ggggaaacac cagaatcaag tgttcgtcat aactaaagac accccttcat ccaagaatgc       120
     aaagcacatc caataaaagc gctggatata acttcttttt tctctctttc ggccgtgggg       180
     cgggagccgg gacgcgaagt gctattggta cctgcagctt ctttccccgg aaggatggcg       240
     caagccggga gaacagggta tgataaccgg gagatcgtga tgaagtacat ccattataag       300
     ctgtcacaga ggggctacga gtgggatact ggagatgaag actccgcgcc cctgagggct       360
     gcccccaccc ctggcatctt ctccttccag cctgagagca accgaacgcc cgctgtgcac       420
     cgagacacgg ctgccaggac gtcgcctcta cggccccttg tcgccaacgc tgggcctgcg       480
     ctcagccctg tgccacctgt ggtccacctg accctccgcc gggctgggga tgacttctct       540
     cgtcgctacc gtcgcgactt tgcagagatg tccagtcagc tgcacctgac gcccttcacc       600
     gcgaggggac gctttgccac ggtggtggag gaactcttca gggatggggt gaactggggg       660
     aggattgtgg ccttctttga gttcggtggg gtcatgtgtg tggggagcgt caacagggag       720
     atgtcacccc tggtggacaa catcgctctg tggatgactg agtacctgaa ccggcatctg       780
     cacacctgga tccaggataa cggaggctgg gatgcctttg tggaactata tggccccagc       840
     atgcgacctc tgtttgattt ctcctggctg tctctgaaga cgctgctcag cctggccctg       900
     gtgggggcct gcatcactct gggtgcatac ctgggccaca agtgaggtca gcagacctgc       960
     cccaaacaaa tatgaaaagg ttcactaaag cagtagaaat taatatgcat tatcaaggat      1020
     ggaccatgaa acaaagttgt gatttttttt taaagcagaa cacacacaca cacacacaca      1080
     cacacacaca cacacacaca cacacacaca cattcaggca aatggtcaaa tcagctattt      1140
     actgccaaag ggaaatatta tttatttttt acattattt                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page