(data stored in ACNUC27125 zone)

EMBL: L14778

ID   L14778; SV 1; linear; mRNA; STD; HUM; 2276 BP.
XX
AC   L14778;
XX
DT   08-JUL-1993 (Rel. 36, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Human calmodulin-dependent protein phosphatase catalytic subunit (PPP3CA)
DE   mRNA, complete cds and alternative exon.
XX
KW   calcineurin A-alpha; calmodulin-dependent protein phosphatase;
KW   phosphoprotein phosphatase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2276
RX   PUBMED; 2162844.
RA   Kincaid R.L., Giri P.R., Higuchi S., Tamura J., Dixon S.C., Marietta C.A.,
RA   Amorese D.A., Martin B.M.;
RT   "Cloning and characterization of molecular isoforms of the catalytic
RT   subunit of calcineurin using nonisotopic methods";
RL   J Biol Chem 265(19):11312-11319(1990).
XX
RN   [2]
RP   1-2276
RX   DOI; 10.1016/0167-4889(93)90117-8.
RX   PUBMED; 8392375.
RA   Muramatsu T., Kincaid R.L.;
RT   "Molecular cloning of a full-length cDNA encoding the catalytic subunit of
RT   human calmodulin-dependent protein phosphatase (calcineurin A alpha)";
RL   Biochim. Biophys. Acta 1178(1):117-120(1993).
XX
DR   MD5; 530182db781684c8579814e8db753eeb.
DR   Ensembl-Gn; ENSG00000138814; homo_sapiens.
DR   Ensembl-Tr; ENST00000323055; homo_sapiens.
DR   Ensembl-Tr; ENST00000394853; homo_sapiens.
DR   Ensembl-Tr; ENST00000394854; homo_sapiens.
DR   Ensembl-Tr; ENST00000512215; homo_sapiens.
DR   EuropePMC; PMC28094; 9861020.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2276
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="2 year old"
FT                   /tissue_lib="lambda ZAPII (Stratagene)"
FT                   /tissue_type="brain (hippocampus)"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..147
FT                   /gene="PPP3CA"
FT   CDS_pept        148..1713
FT                   /codon_start=1
FT                   /gene="PPP3CA"
FT                   /standard_name="calcineurin A alpha"
FT                   /product="calmodulin-dependent phosphatase catalytic
FT                   subunit"
FT                   /function="phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="Partial coding sequence and 3' UTR was reported for
FT                   the human 'type 1', or 'A alpha' cDNAs in ref. 1"
FT                   /db_xref="GOA:Q08209"
FT                   /db_xref="H-InvDB:HIT000192257.13"
FT                   /db_xref="HGNC:HGNC:9314"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="PDB:1AUI"
FT                   /db_xref="PDB:1M63"
FT                   /db_xref="PDB:1MF8"
FT                   /db_xref="PDB:2JOG"
FT                   /db_xref="PDB:2JZI"
FT                   /db_xref="PDB:2P6B"
FT                   /db_xref="PDB:2R28"
FT                   /db_xref="PDB:2W73"
FT                   /db_xref="PDB:3LL8"
FT                   /db_xref="PDB:4F0Z"
FT                   /db_xref="PDB:4Q5U"
FT                   /db_xref="PDB:5C1V"
FT                   /db_xref="PDB:5SVE"
FT                   /db_xref="PDB:6NUC"
FT                   /db_xref="PDB:6NUF"
FT                   /db_xref="PDB:6NUU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08209"
FT                   /citation=[1]
FT                   /citation=[2]
FT                   /protein_id="AAA02631.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAI
FT                   KGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNS
FT                   SNIQ"
FT   exon            1486..1515
FT                   /gene="PPP3CA"
FT                   /function="unknown"
FT                   /note="This alternative exon was first described in
FT                   citation 1 and transcripts containing this exon are the
FT                   predominant ones in brain.; alternative inserted exon"
FT                   /citation=[1]
FT                   /citation=[2]
FT   3'UTR           1714..2276
FT                   /gene="PPP3CA"
FT   regulatory      2245..2250
FT                   /gene="PPP3CA"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2276 BP; 653 A; 458 C; 538 G; 627 T; 0 other;
     ccagctcaga gcctagacct ccagccgagc ggtttgcagc cgcgggcggc ggcggcggcg        60
     gcggcgttga gtgtctggcc cgccggtccg gtcggggtgt gcagtcggac ggacgagcag       120
     cgcgtcgctg tcctccggca gctggagatg tccgagccca aggcaattga tcccaagttg       180
     tcgacgaccg acagggtggt gaaagctgtt ccatttcctc caagtcaccg gcttacagca       240
     aaagaagtgt ttgataatga tggaaaacct cgtgtggata tcttaaaggc gcatcttatg       300
     aaggagggaa ggctggaaga gagtgttgca ttgagaataa taacagaggg tgcatcaatt       360
     cttcgacagg aaaaaaattt gctggatatt gatgcgccag tcactgtttg tggggacatt       420
     catggacaat tctttgattt gatgaagctc tttgaagtcg ggggatctcc tgccaacact       480
     cgctacctct tcttagggga ctatgttgac agagggtact tcagtattga atgtgtgctg       540
     tatttgtggg ccttgaaaat tctctacccc aaaacactgt ttttacttcg tggaaatcat       600
     gaatgtagac atctaacaga gtatttcaca tttaaacaag aatgtaaaat aaagtattca       660
     gaacgagtat atgatgcctg tatggatgcc tttgactgcc ttcccctggc tgccctgatg       720
     aaccaacagt tcctgtgtgt gcatggtggt ttgtctccag agattaacac tttagatgat       780
     atcagaaaat tagaccgatt caaagaacca cctgcatatg gacctatgtg tgatatcctg       840
     tggtcagacc ccctggaaga ttttggaaat gagaagactc aggaacattt cactcacaac       900
     acagtcaggg ggtgttcata cttctacagt tacccggctg tatgtgaatt cttacagcac       960
     aataacttgt tatctatact ccgagcccac gaagcccaag atgcagggta ccgcatgtac      1020
     aggaaaagcc aaacaacagg cttcccttct ctaattacaa ttttttcagc accaaattac      1080
     ttagatgtat acaataacaa agctgcagta ttgaagtatg agaacaatgt tatgaatatc      1140
     aggcaattca actgttctcc tcatccatac tggcttccaa atttcatgga tgtttttact      1200
     tggtcccttc catttgttgg ggaaaaagtg actgagatgc tggtaaatgt cctcaacatc      1260
     tgctcagatg atgaactagg gtcagaagaa gatggatttg atggtgcaac agctgcagcc      1320
     cggaaagagg tgataaggaa caagatccga gcaataggca aaatggccag agtgttctca      1380
     gtgctcagag aagagagtga gagtgtgctg acgctgaaag gcttgacccc aactggcatg      1440
     ctccccagcg gagtactttc tggagggaag caaaccctgc aaagcgctac tgttgaggct      1500
     attgaggctg atgaagctat caaaggattt tcaccacaac ataagatcac tagcttcgag      1560
     gaagccaagg gcttagaccg aattaatgag aggatgccgc ctcgcagaga tgccatgccc      1620
     tctgacgcca accttaactc catcaacaag gctctcacct cagagactaa cggcacggac      1680
     agcaatggca gtaatagcag caatattcag tgaccacttc ctgttcacat tttttttttt      1740
     tttttttttt tttttttttt tgagctgcgg ggcatgatgg ggattgctgc atatcagcag      1800
     ttggatgttc ttgcctctga cagtagctta tttgctctgg gggccaggaa ttggattcag      1860
     tttacactat cattaaaaaa gagggagaga gataataaac tatattttgg tggggatggt      1920
     gattaaacac ctcttttggg tatgcctttt aaaaatgctt atagagaaaa aaaattttaa      1980
     aaaaagaaag ctaatgctag tatatactgc aatgttaggg gaatgaacat gttttcctac      2040
     tgcattgggg acttctagat aggttaatga aaggcctttt attctgttac tggacatgaa      2100
     aactttgtct aatttcttac tctattgtac gtttacagtc gcagcactaa aaatggatga      2160
     catcaaacat ttttaacaaa atgatgatgt acaaactaag gactatttat tgataatgtt      2220
     ttgctactct tgtcagacaa tggctataaa ctgaattagg cagtcttaaa aaaaaa          2276
//

If you have problems or comments...

PBIL Back to PBIL home page