(data stored in ACNUC8465 zone)

EMBL: L14936

ID   L14936; SV 1; linear; mRNA; STD; ROD; 1376 BP.
XX
AC   L14936;
XX
DT   13-AUG-1993 (Rel. 36, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus MAP kinase kinase (MKK2) mRNA, complete cds.
XX
KW   MAP kinase kinase 2; MKK2 gene.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1376
RX   PUBMED; 8393135.
RA   Wu J., Harrison J.K., Dent P., Lynch K.R., Weber M.J., Sturgill T.W.;
RT   "Identification and characterization of a new mammalian mitogen-activated
RT   protein kinase kinase, MKK2";
RL   Mol. Cell. Biol. 13(8):4539-4548(1993).
XX
DR   MD5; 8749e28131d8d959d97824f5624f2b0f.
DR   Ensembl-Gn; ENSRNOG00000020005; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000027272; rattus_norvegicus.
DR   EuropePMC; PMC4263014; 25433485.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1376
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="lambda gt10"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        30..1232
FT                   /codon_start=1
FT                   /gene="MKK2"
FT                   /product="MAP kinase kinase 2"
FT                   /function="Dual specificity protein tyrosine/threonine
FT                   kinase"
FT                   /note="putative"
FT                   /db_xref="GOA:P36506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36506"
FT                   /protein_id="AAA41620.1"
FT                   /translation="MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELD
FT                   LDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIH
FT                   LEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGR
FT                   PVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSS
FT                   DFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLCRTLRLKQPSTPTRTA
FT                   V"
FT   stem_loop       47..61
FT                   /gene="MKK2"
FT                   /function="Facilitate initiation of translation"
FT                   /note="putative"
XX
SQ   Sequence 1376 BP; 310 A; 390 C; 426 G; 250 T; 0 other;
     gggggtgccg cgccggccgc agagccctga tgctggcccg gaggaagccg gtgttaccgg        60
     cactcaccat caaccctacc atcgctgagg gcccgtcccc caccagcgag ggcgcctccg       120
     aggcacacct ggtggacctc cagaagaagt tggaagagct ggacctggat gaacagcaga       180
     ggaagcggct ggaggccttc cttacccaga aggccaaggt tggtgagctc aaggacgacg       240
     actttgagag aatctcagaa ctgggtgcag gcaatggcgg cgtggtcaca aaggcccggc       300
     ataggccctc tggcctcatc atggccagaa agctgatcca cctggagatc aagccagctg       360
     tccgcaacca gatcatccgg gagctgcagg tgctgcatga gtgcaactca ccgtacatcg       420
     tgggctttta tggggccttc tacagcgacg gcgagatcag catctgcatg gagcacatgg       480
     acggtggctc actggaccag gtactgaagg aggccaagcg cattcccgag gacatcttag       540
     ggaaggtcag cattgcggtg ctccggggcc tggcgtacct ccgcgagaag caccagatca       600
     tgcatagaga tgtgaagccc tccaacattc tggtgaactc tcgtggagag attaagctgt       660
     gcgacttcgg agtgagcggc cagttgattg actccatggc caactcattt gtagggacac       720
     gctcctacat gtccccagaa cggctgcagg gcacccacta ctctgtgcag tcggacatct       780
     ggagcatggg gctgtcgctg gtggagctgg ccatcgggag gtaccccatc cccccacctg       840
     atgccaagga actagaggcc agctttggcc ggcctgtggt ggacggggca gatggagagc       900
     cccatagtgt ctcaccgcgg ccccggcccc ctggacgccc catcagtggt catgggatgg       960
     acagccgacc agccatggcc atctttgagc tgctggacta catagtgaat gagccacctc      1020
     ccaagctgcc cagtggtgtg ttcagctcag acttccagga gtttgtgaat aaatgtctca      1080
     ttaagaaccc agcagagcgt gcagacctca agctgctgac gaaccatgcc ttcatcaaac      1140
     gctctgaggg ggaggacgtg gacttcgctg gctggctatg cagaaccctg cggctgaagc      1200
     agcccagcac acccacgcgt actgcagtgt gacagccatc gctcagcagt ctgtgtcctt      1260
     gtcctgtggc acagcggccg cctttgggga cagcagtggt gtgtgttgtg gcaggggacc      1320
     tgtgcctgtg catttggaaa agcaaacaaa gtggagaaag agagaaaaaa aaaaaa          1376
//

If you have problems or comments...

PBIL Back to PBIL home page