(data stored in SCRATCH zone)

EMBL: L15202

ID   L15202; SV 1; linear; unassigned DNA; STD; PRO; 5132 BP.
XX
AC   L15202;
XX
DT   19-MAY-1993 (Rel. 35, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Bacillus subtilis comE operon encoding ORF1, ORF2, ORF3 and Reverse-ORF
DE   genes, complete cds.
XX
KW   comE operon; competence protein.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-5132
RX   DOI; 10.1111/j.1365-2958.1993.tb00907.x.
RX   PUBMED; 7968523.
RA   Hahn J., Inamine G., Kozlov Y., Dubnau D.;
RT   "Characterization of comE, a late competence operon of Bacillus subtilis
RT   required for the binding and uptake of transforming DNA";
RL   Mol. Microbiol. 10(1):99-111(1993).
XX
DR   MD5; def837ce94fe12eaf486e1c2938655fa.
DR   EuropePMC; PMC107223; 9573156.
DR   EuropePMC; PMC2632086; 19028902.
DR   GOA; P54458.
DR   InterPro; IPR029063; SAM-dependent_MTases.
DR   InterPro; IPR041698; Methyltransf_25.
DR   UniProtKB/Swiss-Prot; P54458; YQEM_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5132
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="unassigned DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      408..413
FT                   /gene="comE"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      432..437
FT                   /regulatory_class="minus_10_signal"
FT   CDS_pept        complement(441..1376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /standard_name="comE Reverse-ORF"
FT                   /db_xref="GOA:P39696"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39696"
FT                   /protein_id="AAC36904.1"
FT                   /translation="MLSYADSTNSSCMFPAFVIFYFHNTYGLEDNSSKEGKPLKIGFIG
FT                   TGNMGTILIESFIESKAADPSNMTITNRTIEKALHIKNRYNSINVTESLEKLVSENEMI
FT                   FICVKPLDIYPLLARALPYLRKDHILISITSPVQTEQLEQYVPCQVARVIPSITNRALA
FT                   GVSLVTFGTSCGESAKAKINELMQHISQALQIESDITRVASDIVSCGPAFMSYLIQRFI
FT                   DAAVSETSVSKQDAILMCKEMLVGMGKLLETELYTLPALQEKVCVKGGVTGEGIKALES
FT                   GVQDMFHRVFQNTHMKYEEDISAVKKQFHV"
FT   CDS_pept        1346..1963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /standard_name="comE ORF1"
FT                   /db_xref="GOA:P39694"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR004787"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39694"
FT                   /protein_id="AAC36905.1"
FT                   /translation="MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETE
FT                   NTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVN
FT                   LAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGVGPS
FT                   KAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK"
FT   CDS_pept        2030..2599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /standard_name="comE ORF2"
FT                   /db_xref="GOA:P32393"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR013404"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32393"
FT                   /protein_id="AAC36906.1"
FT                   /translation="MERISWNQYFMAQSHLLALRSTCPRLSVGATIVRDKRMIAGGYNG
FT                   SIAGGVHCADEGCLMIDDHCARTIHAEMNAILQCSKFGVPTDGAEIYVTHYPCIQCCKS
FT                   IIQAGIKTVYYAEDYKTHPYAQELFEQAGVTVEQVELDEMIVDLKNREKLSFVAGLIGK
FT                   LADAGLAEEELKKIHEQANTLFTSYV"
FT   CDS_pept        2603..4933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /standard_name="comE ORF3"
FT                   /db_xref="GOA:P39695"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39695"
FT                   /protein_id="AAC36907.1"
FT                   /translation="MRNSRLLLPMAAASATAGITAAAYFPAIFLFILFLLIILIKTRHA
FT                   FLIIVCFFSFILFFVLYAVTDSQNVSSYRQGTYQFKAVIDTIPKIDGDRMSMMVETPDK
FT                   EKWAAAYRIQSAGEKEQLLYIEPGMSCELTGTLEEPNHATVPGAFDYNEYLYRQHIHWN
FT                   YSVTSIQNCSEPENFKYKVLSLRKHIISFTNSLLPPDSTGIVQALTVGDRFYVEDEVLT
FT                   AYQKLGVVHLLAISGLHVGILTAGLFYIMIRLGITREKASILLLLFLPLYVMLTGAAPS
FT                   VLRAALMSGVYLAGSLVKWRVRSATAICLSYIVLLLFNPYHLFEAGFQLSFAVSFSLIL
FT                   SSSIFQQVKTSLGQLTIVSLIAQLGSLPILLYHFHQFSIISVPMNMLMVPFYTFCILPG
FT                   AVAGVLLLSLSASFGRLFFSWFDLLISWINRLITNIADVDVFTIMIAHPAPILLFLFTV
FT                   TIILLLMAIEKRSLSQLMVTGGICCTVMFLLFIYPCLSSEGEVDMIDIGQGDSMFVGAP
FT                   HQRGRVLIDTGGTLSYSSEPWREKQHPFSLGEKVLIPFLTAKGIKQLDALILTHADQDH
FT                   IGEAEILLKHHKVKRLVIPKGFVSEPKDEKVLQAAREEGVAIEEVKRGDVLQIKDLQFH
FT                   VLSKEAPDPASKNNSSLVLWMETGGMSWILTGDLEKEGEQEVMNVFPNIKADVLKVGHH
FT                   GSKGSTGEEFIQQLQPKTAIISAGKNNRYHHPHQKVLQLLQRHSIRVLRTDQNGTIQYR
FT                   YKNRVGTFSVYPPYDTSDITETN"
XX
SQ   Sequence 5132 BP; 1424 A; 1061 C; 1195 G; 1452 T; 0 other;
     tttcgggtat taaagcctga aggcatcctg ctgtttgatg ttcattcatc ttttaaaatt        60
     gcggaagtct ttccggatag cacatttgct gaccaggacg aagatatcag ctatatttgg       120
     cagagctttg ccggaagtga cgagctttct gtcattcatg atatgtcgtt ttttgtgtgg       180
     aacggagaag cgtatgatcg ttttgatgag acacacgagc aaagaacgtt cccggtggaa       240
     gaatacgaag aaatgcttaa gaactgcggc tttcagctcc atcgcgtgac agctgatttt       300
     acggataccg agccatcagc acaatcagaa cgcctctttt tcaaggcgca gaaatcaaaa       360
     accatcgttt cctaaaacga tggtttttta aaatgctttt ttatgctttt gcagtacaga       420
     cgaacgtatg acatactcgt ctacacatga aactgctttt tcactgcgga aatatcctcc       480
     tcgtacttca tatgagtatt ttgaaatacc cggtgaaaca tatcctgcac accgctttcc       540
     agcgctttaa tgccttctcc tgttacaccg cctttaacgc aaaccttttc ctgtaatgca       600
     ggcagggtat acaattcggt ttctaacagt tttcccattc cgacaagcat ttccttacac       660
     atcaaaatcg cgtcctgttt agacactgat gtttccgaaa cagctgcatc tataaaccgc       720
     tgaatcagat agctcataaa agcggggccg cagcttacga tgtctgatgc aaccctcgtg       780
     atgtcacttt caatttgcag cgcctgagag atatgctgca tcagctcatt gattttcgct       840
     tttgcagatt cgccgcagct tgtgccgaaa gtgacgagag aaacacctgc cagcgctctg       900
     ttcgtaatac ttgggatcac tcgcgccact tgacacggca catattgttc gagctgttcg       960
     gtttgaacgg ggcttgtaat tgaaatgaga atatgatctt ttcttaaata aggtaacgct      1020
     cttgccagta aaggatatat atcaagcggc ttaacacaaa taaaaatcat ctcgttttca      1080
     gaaacgagct tttcgagact ttcggtaacg tttatgctgt tgtagcggtt ttttatgtgc      1140
     aacgcttttt caattgtgcg gtttgtgatt gtcatgtttg agggatcggc cgcttttgat      1200
     tcaataaatg attcgataag gatcgtaccc atatttcctg tgccgataaa gcctatcttc      1260
     aatggtttcc cctcctttga gctattatcc tctaaaccat atgtgttatg aaaataaaat      1320
     atgacgaaag cggggaacat gcacgatgaa ttggttgaat cagcataaga aagcaattat      1380
     tttagcggct tctgcggctg ttttcacagc gattatgatc tttctggcca cagggaaaaa      1440
     taaagagccg gtgaagcaag ctgtaccaac agagacagaa aatacagtgg taaagcagga      1500
     agcaaacaac gacgagtcaa acgaaacaat tgtgatagac atcaaaggtg ctgttcagca      1560
     tcctggcgtt tatgaaatgc gaacagggga cagagtatct caggcaattg agaaagcggg      1620
     cgggaccagt gaacaagcag acgaagcgca agtaaatttg gcggagattc tgcaggacgg      1680
     gacagtggtg tacatcccga aaaagggaga ggaaacagca gtgcagcaag gtggcggagg      1740
     gtctgtccaa agcgatggag ggaagggagc gctggtgaat atcaatacag caaccttaga      1800
     ggagttacaa ggcatctcag gggtggggcc atccaaagct gaagctatta ttgcataccg      1860
     ggaggaaaac ggtcgtttcc aaacaattga agatatcact aaggtttcag gaataggtga      1920
     aaagtcattt gagaaaataa agtcttccat tacagtaaag tgatttgacg gtcatgcatt      1980
     atgataggta aactaaaggt caggcaacac aacatttgga gggaacaacg tggaacgaat      2040
     ttcatggaat caatacttta tggctcaaag ccatttattg gcgctgcgca gcacatgtcc      2100
     gagattatct gtcggcgcta ctatagtcag agacaaacgc atgatagcag gaggctacaa      2160
     tgggtcaatc gcgggcggcg tacattgtgc agatgaagga tgcttaatga tagatgatca      2220
     ttgcgcaaga accattcacg ctgaaatgaa tgcgattctt caatgctcta agtttggggt      2280
     gccgactgat ggagccgaga tttatgtgac gcattatccg tgcattcaat gctgcaaatc      2340
     tattattcaa gctggtatca aaacggttta ttatgctgag gattacaaaa cacatccgta      2400
     tgcgcaggaa ttatttgaac aggcgggtgt aactgttgaa caggttgaac tcgatgaaat      2460
     gatcgttgat ctgaaaaaca gagaaaagct ttcatttgta gcgggtctaa tagggaaatt      2520
     ggctgatgcc ggtttagcgg aggaagaatt gaaaaagata catgaacagg cgaatacact      2580
     tttcacgagc tacgtgtgat gaatgcgtaa ttcgcgctta ttattgccta tggcggcagc      2640
     ttcggcaacg gctggaatta ctgccgccgc ttatttcccc gctatttttc ttttcatcct      2700
     ctttctcctc atcattttaa tcaaaacgag gcacgctttt cttattattg tttgtttctt      2760
     ctcttttata ttgttttttg tactgtatgc agtcacagat tctcagaatg tctcttccta      2820
     tcggcaggga acctatcaat tcaaggcagt gattgacact attcccaaaa ttgacggcga      2880
     ccgtatgtct atgatggttg agacacctga taaggaaaaa tgggctgctg cgtatcgcat      2940
     tcagtctgct ggtgaaaaag aacagctgtt atacatagaa ccaggaatgt catgtgagtt      3000
     gactggtaca ttggaagaac cgaatcacgc aactgtgccg ggtgcatttg attataacga      3060
     gtatctttat cggcagcata ttcattggaa ctactctgtc acgtctatcc aaaactgcag      3120
     cgaacctgaa aatttcaagt acaaggtgct cagcttgaga aaacatatca tatcattcac      3180
     aaacagcctt ctgcctcctg attcgacagg gattgtacag gcacttacag ttggtgacag      3240
     attttacgtg gaggatgaag tgcttaccgc gtatcaaaag cttggtgttg tccatctctt      3300
     ggcaatatca ggactccacg tggggatttt gacagcaggt ttgttttata tcatgatccg      3360
     ccttggtata actagagaaa aggcgtcaat tctgttgctg ttatttctgc cgctctatgt      3420
     gatgttgacc ggcgctgctc cttcagtgct acgcgccgct ctcatgtcgg gtgtttactt      3480
     agctggaagt cttgtcaaat ggcgtgtccg ctctgcaact gcaatttgcc tttcgtacat      3540
     cgtccttctg ctcttcaatc cttatcatct ctttgaagcc ggttttcagc tatcgttcgc      3600
     cgtcagtttt tctttaattc tatcctcttc tatttttcag caggttaaaa cctccttggg      3660
     gcagctgaca attgtatcac tcatcgctca gctgggctcg cttccgattc tcctatatca      3720
     ttttcatcag ttttctatca tcagcgtacc gatgaatatg ttgatggtac cattttatac      3780
     cttctgtatt ttgccgggag ctgtagcagg tgttcttcta ttaagtcttt ccgcttcgtt      3840
     tgggagattg tttttcagct ggtttgattt attgataagc tggatcaata ggttaatcac      3900
     aaacattgca gatgttgatg tgttcacgat tatgatcgca catcctgcac ctattttgct      3960
     ttttttattc acagtcacga tcatcctatt gcttatggcg attgaaaaac gctccttgtc      4020
     gcagttgatg gtaaccggag gcatttgctg cacggtgatg tttctgctct ttatatatcc      4080
     gtgtcttagt tccgaaggag aagtggatat gatagatatt ggacagggtg acagcatgtt      4140
     tgtaggtgct ccgcatcagc ggggtcgtgt cttaattgat accggcggca ctttgtctta      4200
     ctcgtcagag ccttggcgcg aaaaacagca tccgttttca ctgggggaaa aggtgctgat      4260
     tccgttttta actgctaagg gaatcaagca gcttgacgct ttaattctga cgcacgctga      4320
     ccaagatcat atcggagagg cggagattct gctgaagcat cataaagtaa agcgcctcgt      4380
     gattccgaaa gggttcgttt ctgaacctaa agatgagaaa gtgctgcagg cagccaggga      4440
     agagggagtg gcaattgaag aggtgaagcg aggcgatgtg ttgcaaataa aggatttgca      4500
     gttccatgta ctgtcaaagg aagcgcctga tccggcaagc aaaaataatt catctctcgt      4560
     tctgtggatg gagacgggcg gtatgagctg gatcttgacg ggtgatctgg agaaagaagg      4620
     ggaacaagag gtgatgaacg tgtttccgaa tataaaagca gatgtgttaa aggtggggca      4680
     ccatgggagc aaaggctcta ccggtgaaga attcatccaa cagcttcagc cgaaaacggc      4740
     cattatctca gccgggaaaa acaatcggta ccatcatcct catcaaaaag ttctgcaact      4800
     attacagaga cattctatcc gcgtgctgcg aacagatcaa aacggaacga tccaatatag      4860
     atacaaaaac agagttggaa ccttttctgt ctatcctcca tatgatacat cagatataac      4920
     agagacgaac taaaaaagac tgccgagaaa tcagcagccc gggcagtcgc tgttatgaac      4980
     caactaggtg aataaccgtt gccatgacaa acaagaaggc gaaaaatccg aaggacacaa      5040
     caaaaccaac agctgaatct acagcatcat ttcgtttgct ttgaacgttt ttttcaaaat      5100
     cattcaactt tatccctcct gactgactta ag                                    5132
//

If you have problems or comments...

PBIL Back to PBIL home page