(data stored in ACNUC7421 zone)

EMBL: L22503

ID   L22503; SV 1; linear; genomic DNA; STD; PRO; 1229 BP.
XX
AC   L22503;
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Bacillus subtilis ORFH, 3' end and complete ORFJ.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1229
RX   DOI; 10.1016/0005-2728(94)90131-7.
RX   PUBMED; 8011666.
RA   Quirk P.G., Guffanti A.A., Clejan S., Cheng J., Krulwich T.A.;
RT   "Isolation of Tn917 insertional mutants of Bacillus subtilis that are
RT   resistant to the protonophore carbonyl cyanide m-chlorophenylhydrazone";
RL   Biochim. Biophys. Acta 1186(1-2):27-34(1994).
XX
DR   MD5; ea9dd3feda74c5f8b23f2f5b0491149d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1229
FT                   /organism="Bacillus subtilis"
FT                   /strain="BD99"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /function="unknown"
FT                   /note="sensor protein of two-component system; ORFH;
FT                   putative"
FT                   /db_xref="GOA:P40758"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40758"
FT                   /protein_id="AAA64346.1"
FT                   /translation="EFQVEDNGPGISEKIGDIVFDPGFTSKYDEFGTPSTGIGLSYVKE
FT                   IVTELEGDITFDNQQRGVVFAIRLPVRHLIQKG"
FT   regulatory      231..236
FT                   /note="putative"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248..1192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /function="unknown"
FT                   /note="Putative response regulator of two-component system.
FT                   Likely operon with orfH. Disruption of orfJ by Tn917
FT                   insertion leads to protonophore-resistance.; ORFJ;
FT                   putative"
FT                   /db_xref="GOA:P40759"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40759"
FT                   /protein_id="AAA64347.1"
FT                   /translation="MRFFIADDDRAVRSILRQIIEDEDLGEAAGEADDGSQVEGHMLQF
FT                   KQIDILLIDLLMPGRDGIETIRQIQNTYSGKIVMISQVEAKEMVGEAYSLGIEYFIHKP
FT                   INRIEIVTVLQKVKERIELEHSIGAIQHSLSRLVNRTERKARPQQKSDSGLKEAGTFLL
FT                   SELGMMGEGGAHDLMAVLQYLAEHEQSEPHEKQSPSLKQIFTQVAVRKLGTGASQTEVN
FT                   REMKASEQRIRRAIIHSLHHFASLGTTDFSNPKFETYASKFFDFPVVSQKMKELQSKDA
FT                   KPLAPARINMKKFIHVFFLEAKLLHETMKQRRI"
FT   misc_feature    387..391
FT                   /note="site of Tn917 insertion in MS73; bases 387-391 were
FT                   duplicated by the insertion; transposon"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      1190..1225
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 1229 BP; 361 A; 262 C; 319 G; 287 T; 0 other;
     gaattccagg tggaagacaa tggccccggg atttccgaga aaatcggaga cattgtgttt        60
     gacccgggct ttacttcaaa atatgacgaa tttggcacgc cttctacggg tatcggactt       120
     tcctacgtaa aggaaatcgt gacagagcta gaaggggata tcacgtttga taatcagcag       180
     cggggagtgg tgtttgccat caggctgcct gtccggcatt tgattcagaa agggtgaacc       240
     aaaagctatg cgttttttta ttgcagatga tgaccgtgcg gtgcggtcaa ttttaaggca       300
     gatcattgag gacgaagatc tcggggaagc tgctggtgaa gcagacgacg gaagccaagt       360
     ggaagggcat atgctgcaat ttaagcagat tgatatttta ttaatcgatc tgttaatgcc       420
     cggaagagac ggcattgaga cgattcgtca gatccagaat acgtactccg gcaaaatcgt       480
     aatgatctct caagtggagg cgaaggaaat ggtcggggaa gcgtactcgc tcggcatcga       540
     atattttatc cataagccga ttaaccgcat tgaaattgtc acggttctcc aaaaggtgaa       600
     ggagcggatc gagcttgaac actcgattgg agccattcag cattctctaa gccggcttgt       660
     caatcggact gaacggaaag cgcgtcccca gcagaagagt gacagcggtt taaaagaggc       720
     aggaacattc ctgttgtccg agctgggcat gatgggagaa ggcggcgcac atgatctcat       780
     ggcggtcctg cagtatttag cagaacacga gcaatccgag ccgcacgaaa aacaaagccc       840
     ttcgctaaaa caaatattca cccaagtagc ggtacggaag ctggggacag gagcctcaca       900
     gacggaagtc aatcgcgaaa tgaaagcctc ggagcagcgt atccgcagag cgattattca       960
     ttcgctgcac cattttgctt cactgggcac aactgatttt tcgaatccaa aatttgaaac      1020
     ctatgcatcg aaattctttg attttccggt tgtcagccag aaaatgaaag aactccaatc      1080
     caaggatgca aaaccccttg cacctgctag aataaatatg aaaaaattca tccacgtgtt      1140
     ttttttggaa gcaaagcttt tgcatgagac gatgaaacaa agaaggatat aaaccaaaca      1200
     gccggctgac caggctgttt ttttgctgc                                        1229
//

If you have problems or comments...

PBIL Back to PBIL home page