(data stored in ACNUC11299 zone)

EMBL: L23763

ID   L23763; SV 1; linear; genomic DNA; STD; INV; 778 BP.
XX
AC   L23763;
XX
DT   04-OCT-1993 (Rel. 37, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Caenorhabditis briggsae RNA polymerase II large-subunit (ama-1) gene, 5'
DE   end.
XX
KW   RNA polymerase II.
XX
OS   Caenorhabditis briggsae
OC   Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
OC   Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
OC   Caenorhabditis.
XX
RN   [1]
RP   1-778
RA   Bird D.M., Wilson M.A., Kaloshian I.;
RT   "Analysis of 5' flanking sequences from the Caenorhabditis elegans ama-1
RT   gene";
RL   Unpublished.
XX
DR   MD5; 7187f0ebe80c9f617988ae5754461d95.
DR   EuropePMC; PMC2619764; 19274143.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..778
FT                   /organism="Caenorhabditis briggsae"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="Charon 4 of T.Snutch and D.Baillie"
FT                   /db_xref="taxon:6238"
FT   regulatory      356..360
FT                   /gene="ama-1"
FT                   /note="regulatory element; putative"
FT                   /regulatory_class="other"
FT   regulatory      365..371
FT                   /gene="ama-1"
FT                   /regulatory_class="TATA_box"
FT   exon            <534..621
FT                   /gene="ama-1"
FT   CDS_pept        join(534..621,662..771)
FT                   /partial
FT                   /codon_start=1
FT                   /gene="ama-1"
FT                   /product="RNA polymerase II large subunit"
FT                   /db_xref="GOA:P35074"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35074"
FT                   /protein_id="AAA27891.1"
FT                   /translation="MALVGVDFQAPLRTVCRVQFGFLGPEEIVKTNVSGSCRVSRGLRE
FT                   RKTQNGRSDGPAPGSDWTSWK"
FT   intron          622..661
FT                   /gene="ama-1"
FT   exon            662..771
FT                   /gene="ama-1"
FT   intron          772..>778
FT                   /gene="ama-1"
XX
SQ   Sequence 778 BP; 201 A; 151 C; 171 G; 255 T; 0 other;
     gaattcaaat tctttgcctt cccaccaatt ttcttcaaag gcgcacgaag tttctccgct        60
     cgtgggtctc gcagcgattc ctgcgtctcc ttttttcgca cactgtctcg ccttctattt       120
     tttgaacttt tttcgcgttt accgctagcg attttttgcg attttctagt gatttttcgt       180
     gggaaaaagt ggaaaataaa tgaaaatatg ggtttttgag ggtcagaaac ctaaaaatcg       240
     ataaatttcg actgaaaaat gggtgtttaa gctgaaaaat gggttggaaa tgtttcgaaa       300
     tttttctatg tgataaacag ggttttttat gacgaaaaag ttcgaatttt ttcgcatttc       360
     atggttataa acagctgaaa attcagtttt tgatgtgaaa atcactgaaa aatggccttt       420
     tcatcgattt tttcaacttt atccgtattt cgccgttttt tcccattttc cggtcaaaat       480
     tccacgaaaa atattaattt tagattgcca atcagcacac ctaaacaccg cagatggctc       540
     tcgtcggagt cgactttcag gctcctctcc gaaccgtctg ccgtgtgcag ttcggttttt       600
     tgggacccga ggagattgta agtggctgaa aatggctgaa atctcgagat ttttttttca       660
     gaaacgaatg tcagtggctc atgtcgagtt tcccgaggtc tacgagaacg gaaaacccaa       720
     aatgggcggt ctgatggacc cgcgccaggg agtgattgga cgtcgtggaa ggttagga         778
//

If you have problems or comments...

PBIL Back to PBIL home page