(data stored in SCRATCH zone)

EMBL: L24376

ID   L24376; SV 1; linear; genomic DNA; STD; PRO; 6130 BP.
XX
AC   L24376;
XX
DT   22-SEP-1993 (Rel. 37, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   Bacillus subtilis ribosomal protein L7/12 (rplL) gene, beta subunit of RNA
DE   polymerase (rpoBC) gene, 3' end, complete cds, 5' end.
XX
KW   ribosomal protein L7/12; RNA polymerase beta'-subunit;
KW   RNA polymerase beta-subunit.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-6130
RX   DOI; 10.1074/jbc.270.35.20329.
RX   PUBMED; 7657605.
RA   Boor K.J., Duncan M.L., Price C.W.;
RT   "Genetic and transcriptional organization of the region encoding the beta
RT   subunit of Bacillus subtilis RNA polymerase";
RL   J Biol Chem 270(35):20329-20336(1995).
XX
DR   MD5; b2cea920425715e12bd1e12bf3107b04.
DR   EuropePMC; PMC84932; 10325313.
DR   EuropePMC; PMC93078; 11472954.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6130
FT                   /organism="Bacillus subtilis"
FT                   /sub_species="Marburg"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..148
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /product="ribosomal protein L7/12"
FT                   /db_xref="GOA:P02394"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02394"
FT                   /protein_id="AAB00970.1"
FT                   /translation="REITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASV
FT                   EVK"
FT   stem_loop       169..193
FT   regulatory      222..230
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238..843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:P37872"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37872"
FT                   /protein_id="AAB00971.1"
FT                   /translation="MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFG
FT                   SRLLIDSFEEPEVEGGILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQ
FT                   NGITNVKIYQSDLFSNVDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIV
FT                   IQKKQGAPSAIEKLEELFDEVSVVQKKKGYYIIKAKKV"
FT   regulatory      840..845
FT                   /note="beta promoter"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      863..868
FT                   /note="beta promoter"
FT                   /regulatory_class="minus_10_signal"
FT   mRNA            874..875
FT                   /note="probable initiation site for rpoB message"
FT   regulatory      1012
FT                   /note="5' end of rpoB message, probable processing site"
FT                   /regulatory_class="other"
FT   regulatory      1076..1083
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1089..4670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /product="RNA polymerase beta-subunit"
FT                   /db_xref="GOA:P37870"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="PDB:2LY7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37870"
FT                   /protein_id="AAB00972.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLIGENEYLRNTLD
FT                   KDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGQILDRRTLDKVLPYLENGIGFRKLYPNGGVVED
FT                   EVTLQSIKIFAPTDQEGEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQ
FT                   ANARLDDEGAFIDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPEAPFVGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMELGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGHGFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDEEDAKQA
FT                   DGLALSGDEEPEETASADVERDVVTKE"
FT   regulatory      4719..4724
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4732..>6130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /product="RNA polymerase beta'-subunit"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /protein_id="AAB00973.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQ"
XX
SQ   Sequence 6130 BP; 1788 A; 1250 C; 1436 G; 1656 T; 0 other;
     acgtgaaatc actggtcttg gcttgaaaga agctaaagag cttgttgaca acactccaaa        60
     accacttaaa gaaggtattg ctaaagaaga agctgaagag cttaaagcta aacttgaaga       120
     agttggcgct tctgtagaag ttaagtaatc ttcacttacc tgtaggggaa gctcgctttt       180
     atgaggcgag ctttttcttt gccattcttt aagccatgaa aaaaggaggt tctaataatg       240
     agtgagcact attattcaga aaaaccttca gtaaaaagca acaagcaaac ctggtctttt       300
     aggcttcgga ataaagattt cacgtttacc agcgacagcg gggttttttc taaaaaagaa       360
     gttgatttcg gctcccgcct gctgattgat tcttttgaag agcctgaggt tgagggcggc       420
     attttagatg taggctgcgg atacggcccg attggtttat cgctcgccag cgactttaaa       480
     gaccggacca tccacatgat tgacgttaat gagagagccg tagaactatc aaatgaaaat       540
     gcggaacaga acggaataac aaacgttaag atttatcaaa gcgatttgtt ttcaaacgtt       600
     gattctgctc aaacatttgc ttctattctt acaaatcccc caatccgagc cggaaaaaaa       660
     gttgtccatg ctatctttga gaaaagcgct gaacacttaa aagcttcagg tgaattgtgg       720
     atcgtcatac agaaaaagca aggcgcgcct tctgccattg aaaagctcga ggaactgttc       780
     gatgaagttt ccgtcgttca aaaaaagaaa ggctattata tcataaaagc aaaaaaagtt       840
     tgactcggta ttttaactat gttaatattg taaaatgcca atgtatatat tttgcttgat       900
     atgatgaatt gtcaatatct atgtataaat tatacaagta tggaaatgct aataaaatcg       960
     gtatttgttt ttggatgtgg ttttcttaat tagaaaccct tttttctttt gtcttgtaaa      1020
     agtattttct ttctttggaa gaaatgctta ttacacatat aatacgcatg atttgagggg      1080
     tgaatcagtt gacaggtcaa ctagttcagt atggacgaca ccgccagcgc agaagctatg      1140
     ctcgcattag cgaagtgtta gaattaccaa atctcattga aattcaaacc tcttcttatc      1200
     agtggtttct tgatgagggt cttagagaga tgtttcaaga catatcacca attgaggatt      1260
     tcactggtaa cctctctctt gagttcattg attatagttt aggtgagcct aaatatcctg      1320
     tagaggaatc aaaagaacgt gatgtgactt actcagctcc gctaagagtg aaggttcgtt      1380
     taattaacaa agaaactgga gaggtaaaag accaagatgt cttcatgggt gatttcccta      1440
     ttatgacaga tacaggtact tttatcatta acggtgcgga acgtgttatc gtttcccagc      1500
     ttgttcggtc tccaagtgta tatttcagtg gtaaagtaga caaaaacggt aaaaaaggtt      1560
     ttaccgcaac tgtcattcca aaccgtggcg catggttaga atacgaaact gatgcgaaag      1620
     atgttgttta tgtccgcatt gatcgcacac gtaagttgcc ggttacggtt cttttgcgtg      1680
     ctctcggctt cggctccgat caagagattc ttgatctcat aggagaaaac gaatacctgc      1740
     gaaatacgct tgataaagat aacacagaaa acagcgacaa agcgttgctg gaaatttacg      1800
     agcgtctccg tcctggagag ccgcctacag tagaaaatgc gaaaagcttg cttgattctc      1860
     gtttctttga tccgaaacga tacgatcttg ccaatgtagg acgctataaa attaataaaa      1920
     aacttcatat taagaatcgc ctcttcaatc agagacttgc tgaaacgctt gttgatcctg      1980
     aaacaggaga aatccttgct gaaaaaggcc agattcttga tagaagaacg cttgataaag      2040
     tactgccata cttagaaaac ggaatcggtt ttagaaagct gtatccgaat ggcggcgttg      2100
     ttgaagatga agtgactctt caatcaatta aaatctttgc tccgactgat caagaaggag      2160
     aacaggttat caatgtaatc ggcaatgctt acatcgaaga agagattaaa aacatcacgc      2220
     ctgctgatat tatttcttca atcagctact tcttcaacct gctgcacgga gtaggcgaca      2280
     cagatgatat cgatcatctt ggaaaccgcc gtttacgttc tgtaggcgag cttctccaga      2340
     accaattccg tatcggttta agccgtatgg agcgtgtggt tcgtgagaga atgtcaattc      2400
     aagatacgaa tacaattacg cctcagcagc tgatcaatat tcgtcctgtt attgcgtcca      2460
     ttaaagagtt ctttggaagc tcacagcttt ctcaattcat ggatcagacg aacccgcttg      2520
     ctgaattaac gcacaagcgt cgtctgtcag cattaggacc gggcggattg acacgtgagc      2580
     gtgccggaat ggaagtgcgt gacgttcact actcccacta tggccgtatg tgtccgattg      2640
     aaacgcctga gggcccgaac atcggtttga tcaactcact atcatcttat gcaaaagtaa      2700
     accgttttgg ctttattgaa acgccatatc gccgcgttga ccctgaaaca gggaaggtaa      2760
     cgggcagaat cgattactta actgctgatg aagaggataa ctatgttgtc gctcaagcga      2820
     atgctcgtct tgatgacgaa ggcgccttta ttgatgacag catcgtagct cgtttccgcg      2880
     gggagaacac cgttgtttcc agaaatcgtg tagactacat ggatgtatcg cctaagcagg      2940
     ttgtatctgc tgcgacagca tgtatcccgt tcttagaaaa cgatgactcc aaccgtgccc      3000
     tcatgggagc gaacatgcag cgtcaggctg tgcctttgat gcagccggaa gcgccatttg      3060
     ttggaactgg tatggaatac gtatcaggaa aagactctgg tgccgctgtt atttgtaaac      3120
     accctggtat cgttgaacgc gtagaagcca aaaacgtttg ggttcgccgt tatgaagaag      3180
     tagacggtca aaaagtaaaa ggaaacctgg ataaatacag cctgctgaaa tttgtccgct      3240
     ctaaccaagg tacgtgctac aaccagcgtc cgatcgtaag tgtcggcgat gaagtggtaa      3300
     aaggagaaat ccttgctgac ggtccttcta tggagcttgg tgaacttgca cttggccgta      3360
     acgtaatggt cggcttcatg acgtgggatg gctacaacta tgaggatgcc atcatcatga      3420
     gtgaacgcct agtgaaggat gatgtttata catctatcca cattgaagaa tacgaatcag      3480
     aagcacgtga tacgaaactt ggacctgaag aaatcactcg cgatattcca aacgtcggtg      3540
     aagatgcgct tcgcaatctt gatgaccgcg gaatcatccg tattggggca gaagtaaaag      3600
     acggagatct tcttgttggt aaagtaacgc ctaaaggcgt aactgaactg actgccgaag      3660
     aacgccttct tcacgccatc tttggcgaga aagcccgcga ggttcgtgat acttctcttc      3720
     gtgtgcctca tggcggcggc ggaattatcc atgacgttaa agtcttcaac cgtgaagacg      3780
     gagacgaact tcctccaggt gttaaccagt tagtacgcgt atatatcgtt cagaaacgta      3840
     agatttctga aggggataaa atggccggtc gtcacggtaa caaaggtgtt atctctaaga      3900
     ttcttcctga agaggatatg ccttaccttc ctgacggcac accaattgat atcatgctta      3960
     acccgctggg cgtaccatca cgtatgaaca tcgggcaggt attggaactt cacatgggta      4020
     tggccgctcg ttaccttggc attcacattg catctcctgt atttgacgga gcgcgagaag      4080
     aggatgtctg ggaaacactt gaagaagccg gcatgtctcg tgacgccaaa acagtgcttt      4140
     acgacggacg tactggagag ccgtttgata accgtgtatc tgtcggtatc atgtacatga      4200
     tcaaactggc tcacatggtt gacgataaac ttcatgcacg ctctacaggc ccttactcac      4260
     ttgttacgca gcagcctctt ggcggtaaag cgcaatttgg cggacacggt tttggtgaga      4320
     tggaggtttg ggcacttgaa gcttacggtg cggcttacac tcttcaagaa attctgactg      4380
     ttaagtctga tgacgtggtt ggacgtgtga aaacatacga agccatcgtt aaaggcgaca      4440
     atgttcctga accaggtgtt ccggaatcat tcaaagtatt aatcaaagaa cttcaaagct      4500
     taggtatgga tgtcaaaatc ctttctggtg atgaagaaga aatagaaatg agagatttag      4560
     aagacgaaga agatgcgaaa caagctgacg gcctggcatt atcaggtgat gaagagccgg      4620
     aagaaacagc atctgcagac gttgaacgcg atgtagtaac aaaagaataa tctctagtta      4680
     taaaggcaag tgacatcggt taatccgaag ataaaaaggg aggtaggccc cttgctagat      4740
     gtgaacaatt ttgagtatat gaacatcggt cttgcttcac cagataaaat ccgttcatgg      4800
     tcttttggtg aagtgaaaaa gcctgaaacg ataaactatc gtacgttaaa acctgaaaag      4860
     gacggtctat tctgcgaacg cattttcgga ccgactaagg actgggaatg tcattgcggg      4920
     aagtacaagc gagttcgtta taaaggcgta gtttgtgacc gctgcggagt cgaagtaaca      4980
     cgggctaaag tccgtcgtga gagaatgggg cacattgaac tggctgcccc agtttcccac      5040
     atttggtatt tcaaaggtat tccaagccgt atgggtcttg tgctggatat gtcacctcgt      5100
     gctttagaag aagtcattta ctttgcttct tacgttgtaa ctgatccggc gaatacaccg      5160
     cttgaaaaga aacagcttct gtctgagaaa gaataccgtg cttatcttga taaatacggt      5220
     aataaattcc aagcatctat gggtgctgaa gcaattcata aacttcttca agatatcgat      5280
     cttgtaaaag aagttgatat gttaaaagaa gagctgaaaa cttcacaagg acaacgccgt      5340
     actcgtgcga tcaaacgtct tgaagtttta gaagccttcc gtaactcagg aaacaagcct      5400
     tcttggatga tccttgatgt gcttcctgtt attcctccgg agcttagacc gatggttcag      5460
     ctagatggcg gacgttttgc gacttctgat ttgaatgacc tttatcgtcg tgtcatcaac      5520
     cgtaacaatc gtttgaaacg ccttttggac cttggtgcgc ctagcatcat cgttcaaaac      5580
     gaaaagcgta tgcttcaaga ggctgtcgat gccctaattg acaacggccg ccgcggacgc      5640
     cctgtaacag gtcctggaaa cagaccgtta aaatctcttt ctcacatgct gaaagggaag      5700
     caaggccgtt tccgtcaaaa ccttcttggt aaacgtgtcg attactccgg acgttctgta      5760
     atcgttgttg gtcctcattt gaaaatgtac caatgcggat taccgaagga aatggcactt      5820
     gaacttttca aacctttcgt tatgaaagaa cttgttgaaa aaggtcttgc tcacaacatt      5880
     aagagtgcga aacgcaaaat tgagcgcgta cagcctgaag tttgggatgt actagaatca      5940
     gttattaagg agcatccggt actgctgaac cgtgccccta cacttcacag attaggtatc      6000
     caggcgtttg aaccaacgct tgttgaagga cgcgcaatcc gtcttcaccc gctcgtatgt      6060
     acagcttaca acgctgactt tgacggtgac caaatggcgg ttcacgtacc attatctgct      6120
     gaagcacaag                                                             6130
//

If you have problems or comments...

PBIL Back to PBIL home page