(data stored in ACNUC7421 zone)

EMBL: L25126

ID   L25126; SV 1; linear; mRNA; STD; MUS; 2187 BP.
XX
AC   L25126;
XX
DT   15-OCT-1993 (Rel. 37, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus RNA helicase mRNA, complete cds.
XX
KW   RNA helicase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2187
RX   DOI; 10.1016/0378-1119(94)90541-X.
RX   PUBMED; 8144024.
RA   Gee S.L., Conboy J.G.;
RT   "Mouse erythroid cells express multiple putative RNA helicase genes
RT   exhibiting high sequence conservation from yeast to mammals";
RL   Gene 140(2):171-177(1994).
XX
DR   MD5; 1af22e3f8f82b4c4f2e5ff7cd3bbeae9.
DR   Ensembl-Gn; ENSMUSG00000000787; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035542; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035462; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036083; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034686; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000804; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095693; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096214; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096545; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094252; mus_musculus_wsbeij.
DR   EuropePMC; PMC104042; 10074132.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2187
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="erythroleukemia"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        24..2012
FT                   /codon_start=1
FT                   /product="RNA helicase"
FT                   /note="RNA-dependent ATPase and RNA helicase of 'DEAD box'
FT                   family; putative"
FT                   /db_xref="GOA:Q62167"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62167"
FT                   /protein_id="AAA53630.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFG
FT                   GGGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 2187 BP; 635 A; 409 C; 596 G; 547 T; 0 other;
     cgatttctcg gtactcttca gggatgagtc atgtggcagt ggaaaatgcg ctcgggctgg        60
     accagcagtt tgctggccta gacctgaact cttcagataa tcagagtgga ggaagtacag       120
     caagcaaagg gcgttatatc ccacctcatt taaggaacag agaagctact aaaggattct       180
     atgacaaaga cagttcaggg tggagttcta gtaaagataa ggatgcatac agcagttttg       240
     gatcacgggg tgattcaaga gggaagtcta gcttctttgg agatcgtgga agtggatcaa       300
     ggggaaggtt tgatgatcgt ggacggggag actatgatgg cattggtggc cgtggagata       360
     gaagtggctt tggcaaattt gaaagaggtg gaaatagtcg ctggtgtgac aaatcagatg       420
     aagatgactg gtcaaagcca ctcccaccaa gtgaacgatt ggaacaggaa ctcttttctg       480
     gaggcaatac tgggattaac tttgagaaat atgatgacat tccagtcgaa gcaacaggca       540
     acaactgtcc tccacacatt gaaagtttca gtgatgtcga gatgggagaa attattatgg       600
     gaaacattga gcttactcgt tatactcgcc caactccagt gcagaagcat gctattccta       660
     ttatcaaaga gaaaagagac ttgatggctt gtgctcaaac aggctctgga aaaactgcag       720
     catttctctt gcccatcttg agtcagatct atgctgatgg tccaggagaa gctctgaggg       780
     ctatgaagga aaatggaaga tatggccgtc gtaaacagta tccaatctct ttggtactgg       840
     caccaacgag agaattggca gtgcagatct atgaggaagc cagaaaattc tcataccgat       900
     ctagagtccg tccttgcgtg gtttatggtg gtgctgaaat tggccagcag attcgagact       960
     tagaacgtgg atgccacttg ttagtagcca ctccaggacg tctagtggat atgatggaga      1020
     gagggaagat cgggttagac ttctgcaaat acctggtgtt agatgaagct gaccggatgt      1080
     tagatatggg gtttgaacct cagatacgaa gaatagttga acaagacact atgcctccaa      1140
     aaggtgtccg ccacactatg atgtttagtg ctacttttcc taaggaaata cagatgctgg      1200
     cccgtgattt cttagatgag tacatatttc tggctgtagg aagagttggg tctacttcag      1260
     agaacatcac acaaaaagtg gtttgggtgg aggagataga caaaaggtca tttctgcttg      1320
     accttctaaa tgcaacaggc aaggattccc tgactctagt gtttgtggag accaaaaagg      1380
     gggcagattc gctggaggat ttcttatacc atgaaggata tgcttgtacc agtatccatg      1440
     gagaccgttc tcagagagat agggaagagg cccttcacca gttccgctca ggaaaaagcc      1500
     caattctagt ggctacagca gtagcagcaa gaggactgga tatttcaaat gtgaagcatg      1560
     ttattaattt tgacctgcct agtgatatcg aagaatatgt gcatcgcata ggccgtacag      1620
     gccgtgtggg aaaccttggt cttgccacct cattctttaa tgaaaggaat ataaatatca      1680
     caaaggattt actggatctt cttgttgaag caaaacaaga agtgccttct tggttagaga      1740
     acatggcttt tgaacaccac tacaagggta gcagtcgtgg acgttctaag agcagtcgat      1800
     ttagtggagg gtttggtgcc agagactacc gacagagtag cggtgccagc agttccagct      1860
     tcagcagcag ccgtgcaagc agcagtcgaa gtggtggagg tggccatggc ggcagtcgag      1920
     gatttggtgg aggtggctac ggaggctttt acaacagtga tggatatgga gggaattata      1980
     actcccaggg ggttgactgg tggggtaact gagcctgctc tgtagtaggt caccctgcca      2040
     aacaagctaa tatggaaacc acatgtaact tagccagact ataccttgtg tagcttcaag      2100
     aactcgcagt acattaccag ctgtgattct ccactgaaat ttttttttaa gggagctcaa      2160
     ggtcacaagt aaagatgaaa ggaacaa                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page