(data stored in SCRATCH3701 zone)

EMBL: L27063

ID   L27063; SV 1; linear; genomic DNA; STD; PRO; 8200 BP.
XX
AC   L27063;
XX
DT   21-DEC-1993 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Streptomyces coelicolor dnaA-gyrA region.
XX
KW   6-phosphogluconate dehydrogenase homolog; DNA gyrase; dnaA gene; gyrA gene;
KW   gyrB gene.
XX
OS   Streptomyces coelicolor
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RP   1-8200
RX   DOI; 10.1016/0378-1119(94)90628-9.
RX   PUBMED; 7828880.
RA   Calcutt M.J.;
RT   "Gene organization in the dnaA-gyrA region of the Streptomyces coelicolor
RT   chromosome";
RL   Gene 151(1-2):23-28(1994).
XX
DR   MD5; ffc5494276e496f8392d74e797270680.
DR   StrainInfo; 166217; 0.
XX
CC   NCBI gi: 436023
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8200
FT                   /organism="Streptomyces coelicolor"
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1902"
FT   CDS_pept        <1..36
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /note="NCBI gi: 777777"
FT                   /db_xref="UniProtKB/TrEMBL:Q79E67"
FT                   /protein_id="AAA65211.1"
FT                   /translation="KYLIMPVRLSG"
FT   repeat_region   21..60
FT                   /rpt_type=TANDEM
FT                   /note="putative"
FT   CDS_pept        280..1155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="product homolog; putative; NCBI gi: 436024"
FT                   /db_xref="GOA:Q53917"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q53917"
FT                   /protein_id="AAA65212.1"
FT                   /translation="MELGLVGLGKMGGNMRERIRRAGHTVVGYDRNPDLADVHSLEELV
FT                   GKLSAPRVVWVMVPAGEATQATVDRLGELLEPGDVVVDGGNSRWTDDEKHAEELAAKGI
FT                   GFVDCGVSGGVWGLENGYALMYGGDAENVAKVQPVFDALKPEGDFGAVHAGKVGAGHFA
FT                   KMVHNGIEYAMMQAYAEGWELLEKVDSVENVREVFRSWQEGTVIRSWLLDLAVNALDDD
FT                   EHLDGLRGYAQDSGEGRWTVEAAIDNAVPLPAITASLFARFASRQDDSPQMKMIAALRN
FT                   QFGGHAVEKK"
FT   CDS_pept        1186..2307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /note="putative; NCBI gi: 436025"
FT                   /db_xref="GOA:P36176"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36176"
FT                   /protein_id="AAA65213.1"
FT                   /translation="MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGY
FT                   LATLGSHRVSSDAPLVRMGAERAVIRAQVRQGERQQLIELELNPGRANRARVNRSSQVK
FT                   PRDVLGIVRTVLFAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYDRVLKQRNT
FT                   LLKSAALARRHGGRTMDLSTLDVWDQHLARAGAELLAQRLDLIASVQPLADKAYEQLAP
FT                   GGGPVALEYKPSAPGEAHTREDLYEQLMAALAEARKQEIERGVTLVGPHRDDLLLKLGS
FT                   LPAKGYASHGESWSYALALRLASFDLLRAEGNEPVLVLDDVFAELDARRRERLAELVAP
FT                   GEQVLVTAAVDDDVPHVLAGARFTVAEGTVERV"
FT   CDS_pept        2304..2876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /function="unknown"
FT                   /note="ORF191; putative; NCBI gi: 436026"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35925"
FT                   /protein_id="AAA65214.1"
FT                   /translation="MSADAPEPGPGQSPGERASGGPEPSGVDLARVALRAAREAARARG
FT                   DAAQQKKQARRGGLRSGARADGRDPMALGSAINRLITERGWETPAAVGGVMGRWPEIVG
FT                   ADVAKHCVPERYDEDERVLVVRCDSTAWATNLRLLAPTLVARLNEDLGHGSVRMIKVLG
FT                   PGGPGGPGRRYGPLRAPGSQGPGDTYG"
FT   CDS_pept        <3311..5371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:3311..3313,aa:Val)
FT                   /gene="gyrB"
FT                   /product="DNA gyrase"
FT                   /note="putative; NCBI gi: 436027"
FT                   /db_xref="GOA:P35886"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35886"
FT                   /protein_id="AAA65215.1"
FT                   /translation="VADSGNPNENNPSTDTGVNDAVSTSHGDASASYDASAITVLEGLD
FT                   AVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGHADTIDVTILPDGGVRVVDNGRG
FT                   IPVGIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSTRVAVEVKT
FT                   DGYRWTQEYKLGVPTASLARHEATEETGTTVTFWADGDIFETTDYSFETLSRRFQEMAF
FT                   LNKGLKINLTDERESAKATAGADEAGEDEKHEVKSVSYHYEGGIVDFVTYLNSRKGELV
FT                   HPTVIDLEAEDKDKSLSLEVAMQWNGGYTEGVYSFANIIHTHEGGTHEEGFRAALTSLI
FT                   NKYARDKKLLREKDDNLTGDDIREGLTAIISVKLAEPQFEGQTKTKLGNTEVKTFVQKV
FT                   VYEHLTDWLDRNPNEAADIIRKGIQAAHARVAARKARDLTRRKGLLESASLPGKLSDCQ
FT                   SNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAILPIRGKILNVEKARIDRILQNQEIQAM
FT                   ISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVESGHVYLS
FT                   RPPLYKIKWGRDDFEYAYSDRERDALIEMGRQAGKRIREDSVQRFKGLGEMNAEELRIT
FT                   TMDQEHRVLGQVTLDDAAQADDLFSVLMGEDVEARRAFIQRNAKDVRFLDI"
FT   CDS_pept        5414..8008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase"
FT                   /note="putative; NCBI gi: 436028"
FT                   /db_xref="GOA:P35885"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35885"
FT                   /protein_id="AAA65216.1"
FT                   /translation="MTDENTPVTTPEGDALAMRVEPVGLETEMQRSYLDYAMSVIVSRA
FT                   LPVVRDGLKPVHRRVLYAMYDGGYRPERGFYKCARVVGDVMGNYHPHGDSSIYDALVRL
FT                   AQPWSMRMPLVDSNGNFGSPGNDPAAAMRYTECKMAPLSMEMVRDIDEETVDFTDNYDG
FT                   RSQEPTVLPARFPNLLINGSAGIAVGMATNIPPHNLREVAAGAQWYLENYEASHEELLD
FT                   ALIERIKGPDFPTGALVVGRKGIEEAYRTGRGSITMRAVVEVEEIQNRQCLVVTELPYQ
FT                   TNPDNLAQKIADLVKDGKVGGIADVRDETSSRTGQRLVIVLKRDAVAKVVLNNLYKHTD
FT                   LQSNFGANMLALVDGVPRTLSLDAFIRHWVNHQIEVIVRRTRFRLRKAEERAHILRGLL
FT                   KALDAIDEVIALIRRSDTVEIARGGLMDLLEIDEIQANAILEMQLRRLAALERQKIVRE
FT                   HDELQAKITEYNEILASPVRQRGIVSEELTALVEKYGDDRKTKLIPYEGDMSIEDLIAE
FT                   EDIVVTVTRGGYIKRTKTDDYRAQKRGGKGVRGTKLKEDDIVNHFFVSTTHHWLLFFTN
FT                   KGRVYRAKAYELPDAGRDARGQHVANLLAFQPDETIAQIRAIRDYEAVPYLVLATKAGL
FT                   VKKTPLKDYDSPRSGGVIAINLREQADGSDDELIGAELVSAEDDLLLISKKAQSIRFTA
FT                   SDDTLRPMGRATSGVKGMSFREGDELLSMNVVRAGTFVFTATDGGYAKRTSVDEYRVQG
FT                   RGGLGIKAAKIVEDRGSLVGALVVEEHDEILAITLSGGVIRTRVNGVRETGRDTMGVQL
FT                   INLGKRDAVVGIARNAEAGREAEEVDGDVAVDETAEGAATTGTDEGEAPSAE"
XX
SQ   Sequence 8200 BP; 1410 A; 2773 C; 2910 G; 1107 T; 0 other;
     aagtacctga tcatgccggt gcggctgagc ggctgagcgg ctgagcggct gagcggctga        60
     gtccgcggac cgtcgcccgc cggccggtgg cgccgtcggc ggctgtccac agggtgggga       120
     cgaacccgca ggtgggggca tacgtctgag cgcgtatgcc cacagctgtg cacgggcgtg       180
     cgggtttagg ctcgacgcgg gtacgaaagt gccgcggcac ccgtccggcg ggttcggagg       240
     tgccgccttg ccacctcgca cacctaagga acgcaactga tggagctcgg tctcgtcggc       300
     ctcggcaaga tgggcggcaa catgcgcgag cggatccgcc gcgcgggcca caccgtcgtc       360
     ggatacgacc gcaatccgga cctcgccgac gtccacagcc tggaagagct tgtgggcaag       420
     ctcagcgccc cgcgcgtggt gtgggtgatg gtcccggccg gcgaggccac ccaggccacc       480
     gtcgaccggc tcggcgagct gctggagccc ggcgacgtgg tcgtggacgg cggcaactcc       540
     cgctggacgg acgacgagaa gcacgccgag gagctggcgg ccaagggcat aggcttcgtc       600
     gactgcggcg tctccggggg cgtgtggggc ctggagaacg gctacgcgct gatgtacggc       660
     ggcgacgcgg agaacgtcgc caaggtgcag ccggtcttcg acgccctcaa gccggagggc       720
     gacttcggtg ccgtgcacgc cggcaaggtg ggcgcgggcc acttcgcgaa gatggtccac       780
     aacggcatcg agtacgccat gatgcaggcc tacgccgagg gctgggagct gctggagaag       840
     gtcgactccg tggagaacgt ccgcgaggtc ttccggtcct ggcaggaggg cacggtgatc       900
     cgctcctggc tcctcgacct cgcggtcaac gcgctcgacg acgacgagca cctggacggg       960
     ctccggggtt atgcacagga ctccggtgag ggacgctgga ctgtggaggc ggcgatcgac      1020
     aacgcggtgc cgctgcccgc gatcacggcc tccctcttcg cgcggttcgc gtcccgccag      1080
     gacgactcgc cgcagatgaa gatgatcgcg gcgctgcgca accagttcgg cggccacgcg      1140
     gtcgagaaga agtaaccgga acgctgggga ggtcggcgca cgaccatgca cgtcacgcat      1200
     ctgtcgctgg ccgacttccg ttcgtacgcc cgggtcgagg tgcccctgga cccgggcgtc      1260
     accgccttcg tcggcccgaa cgggcagggc aagacgaacc tggtcgaggc ggtcggctac      1320
     ctcgccaccc tcggcagcca ccgggtctcc tccgacgccc ccctggtgcg catgggcgcc      1380
     gagcgtgccg tgatccgggc ccaggtccgg cagggcgagc ggcagcagct gatcgagctg      1440
     gagctgaacc cgggccgggc caaccgcgcc cgcgtcaaca ggtcctcgca ggtcaaaccg      1500
     cgtgacgtgc tcggcatcgt gcgcaccgtg ctgttcgcgc cggaggacct cgcgctggtg      1560
     aagggcgacc cgggcgagcg gcgccgtttc ctggacgagc tgatcactgc ccgttccccg      1620
     cggatggcgg gagtgcgttc ggactacgac cgggtcctca agcagcgcaa caccctgctg      1680
     aagtcggccg cgctcgcccg ccggcacggc ggccggacga tggacctgtc cacgctcgac      1740
     gtctgggacc agcacctcgc gcgcgcgggc gccgagctgc tcgcccagcg cctggacctg      1800
     atcgcgtccg tgcagccgct ggccgacaag gcgtacgagc agctggcccc gggcgggggc      1860
     ccggtcgccc tggagtacaa gccgtcggcg cccggtgagg cgcacacgcg tgaggacctg      1920
     tacgagcagc tgatggcggc gctcgccgag gcgcgcaagc aggagatcga gcggggcgtc      1980
     accctggtcg gtccgcaccg ggacgacctg ctgctcaagc tcggctcgct gcccgccaag      2040
     ggctacgcct cccacggcga gtcgtggtcg tacgcgctgg cgctgcggct ggcctcgttc      2100
     gacctgctgc gggccgaggg gaacgagccg gtgctggtgc tggacgacgt gttcgccgag      2160
     ctggacgcgc ggcgccggga gcggctggcg gagctggtgg cgcccgggga gcaggtgctg      2220
     gtgacggccg cggtcgacga cgacgtaccg catgtgctcg cgggggcgcg gttcacggtg      2280
     gcggagggca cggtggagcg cgtatgagcg cggacgcacc ggagccgggc cccggacagt      2340
     cccccggcga gcgcgcgagc ggcggtccgg agccgtccgg cgtcgacctc gcgcgcgtgg      2400
     cgctcagggc ggcgcgggag gcggcacgcg cgcgtgggga cgcggcccag cagaagaagc      2460
     aggcgcggcg cgggggcctg cgctccgggg cgcgggccga cggccgtgac cccatggcgc      2520
     tgggttccgc gatcaaccgg ctgatcaccg agcgcggctg ggagacaccg gccgcggtgg      2580
     gcggggtgat gggccgctgg ccggagatcg tcggtgcgga cgtggcgaag cactgcgtgc      2640
     cggagcggta cgacgaggac gagcgggtgc tggtggtgcg ctgcgactcg acggcgtggg      2700
     cgacgaacct gcggctgctc gcgccgacac tggtggcgcg cctcaacgag gacctggggc      2760
     acgggtcggt acggatgatc aaggttctcg gaccgggtgg cccgggcggg ccgggccggc      2820
     ggtacgggcc gttgcgggcc cccgggagcc agggtccggg ggacacctac gggtgatgtg      2880
     cgggcgttct ggcaccccgt cagggatgcg tgatgtacct cacaaaaaac ggcggcgacg      2940
     ggcggcgtga accgtcggcg cgtgccgcgc cgtacccccg tgcgtgagcg cgcgtcccga      3000
     tctgactccc aagtagcaaa gggttgacgc cccgaagcgc tgagtgccgt tgtgagcctc      3060
     ctgaggcccc catccgcata tcgggagtcg gacgagcctc gttcagggcg gcacatgcgg      3120
     actcaggtac cggcaaaccc ccatcagtgt cagtggtacc ggtagaatga gagagaatcc      3180
     cgccccgacc gtggggaccg tccgggacta gctgagcaac gctgatcaag gcttaccaac      3240
     gcaacatgcc gcagccgctc cggcaacctg ccgacgagcc cggctcgtgc tgtgccagaa      3300
     agggcgcttc gtggccgatt ccggcaaccc caacgagaac aacccgtcca ccgacaccgg      3360
     cgtgaacgac gcggtgagca cctcgcacgg cgatgcttcc gcgtcgtacg acgccagtgc      3420
     catcaccgtc ctcgagggtc tggacgcggt ccgcaagcga cccggtatgt acatcggttc      3480
     aaccggtgag cggggcctgc accacctggt gcaggaggtc gtggacaact ccgtcgacga      3540
     ggcactcgcc ggtcacgcgg acacgatcga cgtcacgatc ctgcccgacg gcggtgtccg      3600
     cgtcgtggac aacggccgcg gcatcccggt gggcatcgtc ccctccgagg ggaagccggc      3660
     cgtcgaggtc gtgctgaccg tgctgcacgc gggcggcaag ttcggcggcg gcggttacgc      3720
     ggtctccggt ggtctgcacg gcgtgggcgt ctcggtcgtc aacgccctct ccacgagggt      3780
     ggccgtggag gtcaagaccg acggctaccg ctggacgcag gagtacaagc tgggcgtccc      3840
     cacggcgtcg ctcgcccggc acgaggccac cgaggagacc ggcacgacgg tcaccttctg      3900
     ggccgacggc gacatcttcg agaccaccga ctactccttc gagacgctct cccggcgctt      3960
     ccaggagatg gccttcctca acaagggcct gaagatcaac ctcaccgacg agcgcgagtc      4020
     ggcgaaggcg accgccggcg cggacgaggc gggcgaggac gagaagcacg aggtcaagag      4080
     cgtctcgtac cactacgagg gcggcatcgt cgacttcgtg acgtacctca actcccgcaa      4140
     gggagagctg gtgcacccca ccgtgatcga cctcgaggcc gaggacaagg acaagagcct      4200
     gtccctcgag gtcgcgatgc agtggaacgg cggctacacg gagggcgtgt actccttcgc      4260
     caacatcatc cacacgcacg agggcggcac gcacgaggag ggcttccgcg cggcgctcac      4320
     ctcgctgatc aacaagtacg cgcgcgacaa gaagctgctg cgcgagaagg acgacaacct      4380
     cacgggcgac gacatccgcg agggcctgac ggcgatcatc tcggtcaagc tggcggagcc      4440
     gcagttcgag ggccagacca agacgaagct gggcaacacc gaggtgaaga ccttcgtcca      4500
     gaaggtcgtc tacgagcacc tgacggactg gctcgaccgc aaccccaacg aggccgcgga      4560
     catcatccgc aagggcatcc aggcggccca cgcgcgcgtg gcggcccgca aggcgcgcga      4620
     cctcacccgt cgcaagggcc tgctggagtc ggcctcgctg ccgggcaagc tgtccgactg      4680
     ccagtcgaac gacccgacca agtgcgagat cttcatcgtc gagggcgact ccgccggcgg      4740
     ctccgccaag tccggccgga acccgcagta ccaggcgatc ctcccgatcc gcggcaagat      4800
     cctcaacgtc gagaaggcgc gcatcgaccg gatcctgcag aaccaggaga tccaggcgat      4860
     gatctccgcg ttcggcaccg gggtgcacga ggacttcgac atcgagaagc tccgctatca      4920
     caagatcatc ctgatggcgg acgccgacgt cgacggccag cacatcaaca ccctgctgct      4980
     gaccttcctg ttccgcttca tgcggccgct ggtcgagtcc gggcacgtgt acctgtcccg      5040
     cccgccgctg tacaagatca agtggggccg ggacgacttc gagtacgcct actccgaccg      5100
     cgagcgcgac gcgctgatcg agatgggccg ccaggccggc aagcgcatcc gcgaggactc      5160
     ggtgcagcgc ttcaagggtc tcggcgagat gaacgccgag gagctgcgca tcacgaccat      5220
     ggaccaggag caccgcgtgc tcggccaggt cacgctcgac gacgccgcgc aggccgacga      5280
     cctgttctcg gtgctgatgg gcgaggacgt cgaggcccgg cgcgcgttca tccagcgcaa      5340
     cgccaaggac gtccgcttcc tcgacatctg agtcggtctc agctgaccgc accaggaagg      5400
     atcttcacca gcaatgaccg acgagaacac tcctgtgacc acgcccgagg gtgatgccct      5460
     ggcgatgcgt gtcgagcccg tcgggctcga gacggagatg cagcgctcgt acctcgacta      5520
     cgcgatgtcc gtcatcgtct cgcgcgcgct gccggtcgtc cgcgacggcc tcaagcccgt      5580
     gcaccgccgc gtgctgtacg ccatgtacga cggcggctac cgccccgagc gcggcttcta      5640
     caagtgcgcc cgcgtcgtcg gcgacgtcat gggcaactac cacccgcacg gcgactcctc      5700
     catctacgac gccctggtcc gcctcgcgca gccctggtcg atgcggatgc cgctggtcga      5760
     ctccaacggc aacttcggct cgccgggcaa cgacccggcc gcggccatgc ggtacaccga      5820
     gtgcaagatg gcgccgctgt cgatggagat ggtccgcgac atcgacgagg agaccgtcga      5880
     cttcacggac aactacgacg gccgctccca ggagccgacc gtcctgcccg cccgcttccc      5940
     gaacctgctg atcaacggct cggcgggcat cgcggtcggc atggcgacca acatcccgcc      6000
     gcacaacctg cgcgaggtcg cggccggcgc ccagtggtac ctggagaact acgaggcctc      6060
     gcacgaggaa ctgctcgacg cgctgatcga gcgcatcaag ggccccgact tcccgaccgg      6120
     cgccctggtg gtgggccgaa agggcatcga ggaggcgtac cgcaccggcc gcggctcgat      6180
     caccatgcgc gcggtcgtcg aggtcgagga gatccagaac cgccagtgcc tggtggtcac      6240
     ggagctgccc taccagacca acccggacaa cctggcgcag aagatcgccg acctggtgaa      6300
     ggacgggaag gtcggcggca tcgcggacgt ccgtgacgag acgtcctcgc gcaccggcca      6360
     gcgcctggtg atcgtgctca agcgggacgc ggtcgccaag gtcgtcctga acaacctgta      6420
     caagcacacc gacctgcagt cgaacttcgg cgccaacatg ctggccctgg tcgacggcgt      6480
     gccgcgcacc ctgtccctgg acgcgttcat ccgccactgg gtgaaccacc agatcgaggt      6540
     catcgtccgc cgtacgcggt tcaggctgcg caaggcggag gagcgggcgc acatcctgcg      6600
     cggcctgctc aaggccctgg acgccatcga cgaggtgatc gcgctcatcc ggcgcagtga      6660
     caccgtcgag atcgcgcgcg gcggcctgat ggacctcctg gagatcgacg agatccaggc      6720
     caacgccatc ctggagatgc agctgcgccg cctggcggcc ctggagcggc agaagatcgt      6780
     ccgggagcac gacgagctcc aggcgaagat caccgagtac aacgagatcc tcgcctcccc      6840
     ggtccgccag cgcgggatcg tcagcgagga gctgaccgcg ctcgtcgaga agtacggcga      6900
     cgaccgcaag accaagctga tcccgtacga gggcgacatg tccatcgagg acctgatcgc      6960
     cgaggaggac atcgtcgtca cggtcacgcg tggcggctac atcaagcgca ccaagaccga      7020
     cgactaccgg gcgcagaagc gcggcggcaa gggcgtgcgc ggcacgaagc tcaaggaaga      7080
     cgacatcgtc aaccacttct tcgtgtccac cacgcaccac tggctgctgt tcttcaccaa      7140
     caagggccgc gtctaccgcg ccaaggccta cgagctgccc gacgccggcc gggacgcgcg      7200
     cggccagcac gtggcgaacc tgctggcctt ccagccggac gagacgatcg cccagatccg      7260
     tgcgatccgc gactacgagg cggtgcccta cctggtcctg gccacgaagg ccggcctggt      7320
     gaagaagacg ccgctgaagg actacgactc gccgcgttcg ggcggtgtca tcgcgatcaa      7380
     cctgcgggaa caggcggacg gaagcgacga cgaactgatc ggcgccgaac tggtctccgc      7440
     cgaggacgat ctgctgctga tcagcaagaa ggcgcagtcg atcaggttca ccgcgtcgga      7500
     cgacacactg cgtccgatgg ggcgtgccac ctcgggcgtc aagggcatga gtttccgcga      7560
     aggggacgag ctgctctcga tgaatgttgt tcgagccggt acgttcgtgt tcactgccac      7620
     cgacggcggt tacgcgaagc ggacctccgt cgacgagtac cgcgtccagg gtcgcggcgg      7680
     cctcggcatc aaggccgcca agatcgtcga ggaccgcggg tcgctcgtgg gcgcgctggt      7740
     ggtcgaggag cacgacgaga tcctcgccat cacgctctcg ggcggtgtga ttcgtacgcg      7800
     agtcaacggg gtcagggaga ccggccgtga caccatgggc gttcaactga tcaatctggg      7860
     caagcgcgat gccgtcgtcg gcatcgcacg caacgccgag gcgggacgcg aggcggagga      7920
     ggtcgacggc gatgtggccg tcgacgagac cgccgagggt gccgcgacca ccggcacgga      7980
     cgagggcgag gcgccctcgg ccgagtagca cgaggagaga gtcatcgtga gcggagccac      8040
     gggcgccgga tcggccggta ccccctcggg tacggaaacg ggcggcggcg gccgtggctc      8100
     agccgcgcgt gcgacggatt cgcacacgac tcaactgcgc aagatcgacg acggagcgac      8160
     cgactcgcac tcggggagct cgtcctcaac gcatggatcc                            8200
//

If you have problems or comments...

PBIL Back to PBIL home page