(data stored in ACNUC9306 zone)

EMBL: L28176

ID   L28176; SV 1; linear; mRNA; STD; MUS; 2386 BP.
XX
AC   L28176;
XX
DT   13-MAR-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mouse neurofibromatosis type 2 (Nf-2) mRNA, complete cds.
XX
KW   neurofibromatosis type 2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2386
RA   Pulst S.-M., Nechiporuk T., Huynh D.P.;
RT   "The mouse neurofibromatosis type 2 (NF2) gene: cDNA sequence and tissue
RT   expression";
RL   Unpublished.
XX
DR   MD5; 3fcb6363b01541e23f6488dccc8d18f5.
DR   Ensembl-Gn; ENSMUSG00000009073; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017989; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017926; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017930; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018382; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017899; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017846; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017085; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017359; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109910; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027828; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027797; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027758; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027170; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027503; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027598; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026858; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027085; mus_musculus_wsbeij.
XX
CC   Protein Features:
CC   N-glycosylation site 263..265
CC   tyrosine phosphorylation site 124..132
CC   cAMP-dependent phosphorylation 310..315.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2386
FT                   /organism="Mus musculus"
FT                   /map="22q12"
FT                   /mol_type="mRNA"
FT                   /dev_stage="newborn"
FT                   /tissue_lib="lambda ZAPII"
FT                   /tissue_type="brain"
FT                   /note="The strain provided is Sprague-Dawley, which is a
FT                   rat strain."
FT                   /db_xref="taxon:10090"
FT   CDS_pept        318..2108
FT                   /codon_start=1
FT                   /gene="Nf-2"
FT                   /product="neurofibromatosis type 2"
FT                   /db_xref="GOA:P46662"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:97307"
FT                   /db_xref="PDB:1ISN"
FT                   /db_xref="PDB:3WA0"
FT                   /db_xref="PDB:4P7I"
FT                   /db_xref="PDB:4ZRK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46662"
FT                   /protein_id="AAA39808.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLETATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGAPSSKHN
FT                   TIKKLTLQSAKSRVAFFEEL"
XX
SQ   Sequence 2386 BP; 621 A; 615 C; 652 G; 497 T; 1 other;
     tcggcgccgc agccgtctag gatttctgtc caaaggcgtg ggtggcgtcc ccagcccgaa        60
     gctccaagct cttttctgcg cgtgctttgc cggcatctcc cccgaccccc ccgtcgtcag       120
     agactgtccc ttaactcatc tttccgcacc cacagccggg tcctggccca tgctggccgc       180
     tggggaccca ggcagcctag gtctgtccgc cgccgagcca ccatggtgcc ctgaggcctg       240
     tgcagctact ccaggggggc taagagaccc agaacgcggg cctaggggtg agggatccaa       300
     ggccggtacc tcgcgccatg gccggagcca tcgcttctcg catgagcttc agctcactca       360
     agaggaagca gcccaagaca ttcacggtgc ggatcgtcac catggacgcc gagatggagt       420
     tcaactgcga gatgaaatgg aaggggaagg acctgtttga tttggtgtgc cggacactgg       480
     ggcttcggga aacctggttc tttggactgc agtatacaat caaggacacg gtggcctggc       540
     tcaaaatgga caagaaggtg ttggatcatg atgtttcgaa ggaagaacca gttacctttc       600
     acttcctggc caaattttat cctgaaaatg ctgaggagga gctagttcaa gagatcacgc       660
     aacacttatt tttcttacag gtgaagaagc agattttgga tgaaaaggtc tactgccctc       720
     ccgaggcgtc cgtgctcttg gcgtcatatg ctgtccaggc caagtatggc gactatgacc       780
     cctctgtgca caagcgggga tttttagccc aagaggaatt gctcccgaaa agggtgataa       840
     atctctatca gatgactccg gaaatgtggg aggagagaat tacggcttgg tatgcggagc       900
     accggggcag agccagggat gaagctgaaa tggagtattt gaagatagct caggacctgg       960
     agatgtatgg tgtgaactac tttacaatcc ggaataaaaa gggcacagag ttgctgcttg      1020
     gagtggatgc cctggggctt cacatttatg accctgagaa cagactgacc cccaagatct      1080
     ccttcccgtg gaatgaaatc cgaaacatct cctacagcga caaggagttt actattaaac      1140
     cactggataa gaaaattgat gtcttcaaat ttaactcctc aaagcttcgt gttaataagc      1200
     tgattcttca gctatgtatt gggaaccatg acctatttat gaggcgacgg aaagctgact      1260
     ctttagaagt tcagcagatg aaagcccagg ccagggaaga gaaggctaga aagcagatgg      1320
     aaaggcagcg gctggctcga gagaagcaga tgcgggagga ggccgagcgt acaagagatg      1380
     agttagagag gaggctcctg cagatgaaag aagaagcaac gatggccaat gaagctctga      1440
     tgcgctctga ggagacagct gatctgttgg ctgaaaaggc tcagatcaca gaggaggagg      1500
     ccaagctttt ggcacaaaag gctgcagagg ctgagcaaga gatgcagcga atcaaggcca      1560
     cggccattcg gacagaggag gagaagcgcc tgatggagca gaaggtgctg gaggctgaag      1620
     tgctggcatt gaagatggct gaggagtcag agaggagggc caaggaggct gatcagttaa      1680
     agcaagactt gcaagaagcc agagaagcag agcgaagagc caagcagaag ctcttagaaa      1740
     ctgccaccaa gcccacctat ccacccatga acccaattcc accaccactg cctcctgaca      1800
     taccgagctt cgacattatt gctgacagct tgtcattcga cttcaaggat acggacatga      1860
     agcgactttc catggagata gagaaagaaa aagtggagta catggagaag agcaagcacc      1920
     tgcaggagca gctcaacgag ctcaagacgg agatcgaggc cttgaaactc aaagagcggg      1980
     agacggcctt ggacgtccta cacagcgaga gctcagacag aggcgccccc agcagcaagc      2040
     ataataccat taaaaagctc actctgcaga gcgccaagtc ccgagtggcc ttctttgaag      2100
     aactctagca ggtgacccgg ccacctcctg ccacatctgc tgctcctgac accaacagga      2160
     tgggcctgac ccaaaaggaa ccatcagtag agggctggct tgtttggaac tcttgagggc      2220
     cccgtgccac tctgacccta tagagaggtt tctcaatgtg ttctagttct ccttgcctcc      2280
     tccatacctg catatctctc tctccctccc tctctctctc tctccrtctc tctctctctc      2340
     tctctctctc tctctctctc tctctctctc tctctctcat ataata                     2386
//

If you have problems or comments...

PBIL Back to PBIL home page