(data stored in ACNUC8465 zone)

EMBL: L28703

ID   L28703; SV 1; linear; mRNA; STD; VRT; 1590 BP.
XX
AC   L28703;
XX
DT   22-SEP-1995 (Rel. 45, Created)
DT   29-JUN-2018 (Rel. 137, Last updated, Version 4)
XX
DE   Chicken mitogen-activated protein kinase kinase type 2 (MEK2) mRNA,
DE   complete cds.
XX
KW   mitogen-activated protein kinase kinase type 2.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1590
RA   Wang H., Pinsonneault S., Meury L., Morais R.;
RT   "Nucleotide sequence of the mitogen-activated protein kinase kinase type 2
RT   (MEK2) from chicken";
RL   Unpublished.
XX
RN   [2]
RP   1-1590
RA   Morais R.;
RT   ;
RL   Submitted (07-FEB-1994) to the INSDC.
RL   Rejean Morais, Departement de Biochimie, Universite de Montreal, Montreal,
RL   Quebec, H3C 3J7, Canada
XX
DR   MD5; 92962ceb00ef7ecbdc83959415b79fae.
XX
CC   Original source text: Gallus gallus (strain White leghorn,
CC   sub_species domesticus) cDNA to mRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1590
FT                   /organism="Gallus gallus"
FT                   /sub_species="domesticus"
FT                   /strain="White leghorn"
FT                   /mol_type="mRNA"
FT                   /cell_type="epitheleoid"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9031"
FT   gene            1..1590
FT                   /gene="MEK2"
FT   mRNA            <1..>1590
FT                   /gene="MEK2"
FT   5'UTR           <1..19
FT                   /gene="MEK2"
FT   CDS_pept        20..1216
FT                   /codon_start=1
FT                   /gene="MEK2"
FT                   /product="mitogen-activated protein kinase kinase type 2"
FT                   /db_xref="GOA:Q90891"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q90891"
FT                   /protein_id="AAA75576.1"
FT                   /translation="MPAKRKPVLPALTITPSPAEGPGPGGSAEANLVDLQKKLEELELD
FT                   EQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHKPSGLIMARKLIHLE
FT                   IKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRI
FT                   PEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMA
FT                   NSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELEAIFGRPV
FT                   VDGAEGESHSVSPWARPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDF
FT                   QEFVNKCLIKNPAERADLKMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRAAV"
FT   3'UTR           1217..>1590
FT                   /gene="MEK2"
XX
SQ   Sequence 1590 BP; 383 A; 442 C; 410 G; 355 T; 0 other;
     ggcgcggcgc ggcccggcca tgccggccaa gaggaagccg gtgctgccgg ccctcaccat        60
     cactcccagc cccgccgagg gacccgggcc cggcggttct gcagaggcca acctggtgga       120
     ccttcagaag aagctggagg agctggagct ggatgagcag cagaagaagc gcttggaagc       180
     tttcctcact cagaaagcca aagtgggaga gctgaaggac gatgactttg agaggatctc       240
     cgagctgggg gctggcaacg gtggtgtggt caccaaagtg caacacaaac cctcaggact       300
     cattatggca cggaagctga ttcatctaga aatcaaacca gccatcagga atcagattat       360
     ccgagagctg caggtgctgc atgagtgtaa ttccccatac attgtgggtt tctatggggc       420
     cttctacagc gatggagaga tttccatctg catggagcac atggatggtg gctccctgga       480
     tcaagtgttg aaagaagcca aaagaatccc cgaggaaata ctggggaaag tcagcatagc       540
     agttctgaga ggtttggcct atctgagaga gaagcaccaa atcatgcaca gagatgtgaa       600
     gccttccaac atcctggtta actctcgagg agagattaag ctgtgtgatt ttggggtcag       660
     tggtcaactc attgactcca tggcaaactc ttttgtggga actcggtcct acatgtctcc       720
     tgaacggttg cagggcaccc attactcagt ccagtccgac atctggagca tgggtctgtc       780
     actggtggag ctttctattg gaaggtaccc cataccccca ccagactcca aggaactgga       840
     agcaatattt ggccgtcccg tggtggatgg ggcagaggga gaatctcaca gcgtctcgcc       900
     gtgggccaga cccccaggac gccccatcag tggccatgga atggacagcc gacctgcaat       960
     ggccatcttt gaactgctgg actatatcgt taatgagcca cctcccaagt tgccaaatgg      1020
     agttttcacg caagatttcc aggagtttgt aaataaatgc ttaattaaga atccagcgga      1080
     acgggcagat ttgaagatgc tgatgaatca caccttcatc aaacgctccg aagtggagga      1140
     ggtggatttc gccggctggc tgtgcaaaac actgaggtta aaccagccca gcacacccac      1200
     ccgtgctgcc gtgtgatggc cgagccgact gcctgctgtc agtacatctg cctctgtcac      1260
     cattccctgt ccttcagcac acaacagaaa ctgccctcct tccttccccc ccaccccctc      1320
     cagccccatc ctcacctcgc atcccaccag caaagcaacc atcacttgga aacgttaatc      1380
     agctgccccc cccccaaccc ccctcccagt cccctttcca cccccaagca aacacgggct      1440
     tggtttctgt tggtctgggg gtatcctggg cctctgctcc agcttggagc tcttgacact      1500
     tgggaaatgt gctgcttatg ttaatttttt tttcctcttt tggttttttt tttttggaaa      1560
     catgttcact tgggttaaaa aaaaacaaaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page