(data stored in SCRATCH3701 zone)

EMBL: L29417

ID   L29417; SV 1; linear; genomic DNA; STD; PRO; 3150 BP.
XX
AC   L29417;
XX
DT   13-MAR-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Pseudomonas aeruginosa (clone pGL2B5) gyrase A subunit (gyrA) gene,
DE   complete cds.
XX
KW   gyrA gene; gyrase A subunit; quinolone resistance.
XX
OS   Pseudomonas aeruginosa
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-3150
RX   PUBMED; 7811002.
RA   Kureishi A., Diver J.M., Beckthold B., Schollaardt T., Bryan L.E.;
RT   "Cloning and nucleotide sequence of Pseudomonas aeruginosa DNA gyrase gyrA
RT   gene from strain PAO1 and quinolone-resistant clinical isolates";
RL   Antimicrob. Agents Chemother. 38(9):1944-1952(1994).
XX
DR   MD5; 655db3a14113260f306d17b03e17dc98.
DR   EuropePMC; PMC155826; 12760863.
DR   EuropePMC; PMC2744841; 19656662.
DR   EuropePMC; PMC2826008; 20086165.
DR   EuropePMC; PMC4071185; 24982833.
DR   EuropePMC; PMC90640; 11451683.
DR   EuropePMC; PMC92979; 11425720.
DR   RFAM; RF01740; gyrA.
DR   StrainInfo; 154131; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3150
FT                   /organism="Pseudomonas aeruginosa"
FT                   /strain="PAO1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:287"
FT   regulatory      249..252
FT                   /gene="gyrA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        265..3036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="gyrase A subunit"
FT                   /db_xref="GOA:P48372"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48372"
FT                   /protein_id="AAA68625.1"
FT                   /translation="MGELAKEILPVNIEDELKQSYLDYAMSVIVGRALPDARDGLKPVH
FT                   RRVLYAMSELGNDWNKPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSVDGDNAAAMRYTEVRMAKLAHELLADLEKETVDWVPNYDGTEQIPAVMPTKI
FT                   PNLLVNGSSGIAVGMATNIPPHNLGEVIDGCLALMDNPDLTVDELMQYIPGPDFPTAGI
FT                   INGRAGIIEAYRTGRGRIYIRARAVVEEMEKGGGREQIIITELPYQLNKARLIEKIAEL
FT                   VKEKKIEGISELRDESDKDGMRVVIELRRGEVGEVVLNNLYAQTQLQSVFGINVVALVD
FT                   GQPRTLNLKDMLEVFVRHRREVVTRRTVYELRKARERGHILEGQAVALSNIDPVIELIK
FT                   SSPTPAEAKERLIATAWESSAVEAMVERAGADACRPEDLDPQYGLRDGKYYLSPEQAQA
FT                   ILELRLHRLTGLEHEKLLSEYQEILNLIGELIRILTNPARLMEVIREELEAVKAEFGDA
FT                   RRTEIVASQVDLTIADLITEEDRVVTISHGGYAKSQPLAAYQAQRRGGKGKSATGMKDE
FT                   DYIEHLLVANSHATLLLFSSKGKVYWLRTFEIPEASRTARGRPLVNLLPLDEGERITAM
FT                   LQIDLEALQQNGGADDDLDEAEGAVLEGEVVEAAEVEEVEGETAELVAEPTGAYIFMAT
FT                   AFGTVKKTPLVQFSRPRSSGLIALKLEEGDTLIAAAITDGAKEVMLFSSAGKVIRFAES
FT                   VVRIMGRNARGVRGMRLGKGQQLISMLIPESGAQILTASERGFGKRTPLSKFPRRGRGG
FT                   QGVIAMVTNERNGALIAAVQVQEGEEIMLISDQGTLVRTRVDEVSLSGRNTQGVTLIKL
FT                   ASDEVLVGLERVQEPSGGDDEDLPEGEEAAESLGESAESESEPAAEAEGNEE"
XX
SQ   Sequence 3150 BP; 606 A; 1004 C; 1055 G; 484 T; 1 other;
     cctgatgagc cgcaagcgcc tgcattgaac gaggcgactg gaggtcgtcc ccgccagggc        60
     ctttgccttg ggctggggcg tgggctgtgg taagctccga cggttattcg agcgccccgc       120
     ggaggggcct cgagagtgcg cgaatccttg actcaagtcg ttgatttgta gtgagttggc       180
     gctgctcggg catgcgccga cctacttcgt ttgcctcagg atcgaggcgg cgaagttcca       240
     ccagaaaaag gaaccaggct tctcatgggc gaactggcca aagaaattct cccggtcaat       300
     atcgaagacg agctgaaaca gtcctatctc gactacgcga tgagcgtgat cgtcgggcgg       360
     gccctgccgg atgcacgtga cggcctgaag ccggtgcacc gccgtgtgct ttatgccatg       420
     agcgagctgg gcaacgactg gaacaagccc tacaagaaat ccgcccgtgt ggtcggcgac       480
     gtgatcggta agtaccaccc gcacggcgac accgcggtct acgacaccat cgtgcgcatg       540
     gcgcagccgt tctcgctgcg ctacatgctg gtagacggcc agggcaactt cggttcggtg       600
     gacggcgaca acgccgcagc catgcgatac accgaagtgc gcatggccaa gctggcccac       660
     gaactgctgg cggacctgga aaaggaaacc gtcgactggg tgcccaacta cgatggcacc       720
     gagcagatcc cggcggtcat gccgaccaag attcccaacc tgctggtcaa cggttccagc       780
     ggtatcgccg tgggcatggc gaccaacatc ccgccgcaca acctcggcga agtgatcgac       840
     ggctgcctgg cgctgatgga caaccccgac ctgaccgtcg atgagctgat gcagtacatc       900
     cccggtccgg acttccccac cgccggcatc atcaacggcc gcgccgggat catcgaggcc       960
     taccgcaccg gtcgcgggcg catctacatc cgtgcccgcg ccgtcgtcga ggagatggag      1020
     aagggcggcg gtcgcgagca gattatcatc accgagctgc cgtaccagtt gaacaaggcg      1080
     cggttgatcg agaagatcgc cgagctggtg aaagagaaga agatcgaggg tatttccgag      1140
     ctgcgcgacg agtctgacaa ggacggcatg cgcgtggtca tcgagctgcg tcgcggcgag      1200
     gtgggcgagg tggtcctcaa caacctctat gcccagaccc agctgcagag cgtgttcggc      1260
     atcaacgtgg tggccctggt cgacggccag ccgcgcacgc tgaacctgaa ggacatgctc      1320
     gaggtgttcg tccgccaccg ccgcgaagtg gtgacccggc gtaccgtcta cgagctgcgc      1380
     aaggcccgcg agcgcgggca catcctggaa ggccaggcgg tcgccctgtc gaacatcgac      1440
     ccggtgatcg agctgatcaa gagttcgccg accccggccg aggccaagga acgcctgatc      1500
     gccactgcct gggagtccag cgcggtggaa gcgatggtcg agcgtgccgg cgccgacgcc      1560
     tgtcgtccgg aagacctgga tccgcagtac ggcctgcgcg acggcaagta ctacctgtcg      1620
     ccggagcagg cccaggcgat cctcgagctg cgcctgcatc gcctgaccgg cctggagcac      1680
     gagaagctgc tctccgaata ccaggaaatc ctcaacctga tcggcgagct gatccgcatc      1740
     ctgaccaacc cggcgcgcct gatggaggtg atccgtgagg aactggaagc ggtcaaggcc      1800
     gaattcggcg atgctcgccg caccgagatc gtggcttccc aggtcgacct gaccatcgcc      1860
     gacctgatca ccgaggaaga ccgcgtggtg accatctcgc acggcggcta cgccaagtcc      1920
     cagccgctgg ccgcctacca ggcgcagcgt cgcggcggca aaggcaagtc cgccaccggg      1980
     atgaaggacg aggactacat cgaacacctg ctggtggcca acagccatgc gaccctcctg      2040
     ctgttctcca gcaagggcaa ggtctactgg ctgcgtacct tcgagattcc ggaagcctcg      2100
     cgtaccgcgc gtggccggcc gctggtgaac ctgctgccgc tggatgaggg cgagcggatc      2160
     accgcgatgt tgcagatcga cctggaggcg ctgcagcaga acggtggcgc cgatgacgac      2220
     ctcgacgaag ccgaaggcgc ggtgctcgag ggcgaggtgg tcgaggccgc cgaggtcgag      2280
     gaagtcgagg gcgagaccgc cgagctggtg gccgagccga ccggcgccta catcttcatg      2340
     gccaccgcct tcggtaccgt gaagaagacc ccgctggtgc agttcagccg tccgcgcagc      2400
     agcggcctga tcgcgctcaa gctggaagag ggcgacaccc tgatcgccgc cgcgatcacc      2460
     gatggcgcca aggaagtcat gctgttctcc agcgccggca aggtgatccg cttcgccgag      2520
     agcgtggtgc gcatcatggg ccgcaacgcc cgcggcgtac gtggcatgcg cctgggcaag      2580
     gggcagcagc tgatctccat gctgattccg gagtccgggg cgcagatcct caccgcctcc      2640
     gagcgcggct tcggcaagcg taccccgctg agcaagttcc cgcgtcgcgg ccgcggcggc      2700
     cagggggtga tcgccatggt caccaacgag cgcaacggcg cgctgatcgc cgcggtacag      2760
     gtccaggaag gcgaggagat catgctgatt tccgaccagg gcaccctggt gcggacgcgt      2820
     gtcgacgaag tctccctgtc cggccgcaat acccagggcg taaccctgat caagctcgcc      2880
     agcgacgagg tactggtcgg tctggagcgt gtccaggagc cgtcgggcgg agatgacgag      2940
     gacctgcccg agggcgagga agctgccgaa tctctgggcg agtcggccga gtccgagtcc      3000
     gagcccgcgg cggaagcgga aggcaacgaa gagtaaggct cggcggcgcc tgcgcccgcc      3060
     cggccgatga cctcggcgga taactcacgg ctatccgccc tacctatagc gagagtggat      3120
     gtgagcaagc gagccttcaa tttctsgccg                                       3150
//

If you have problems or comments...

PBIL Back to PBIL home page