(data stored in ACNUC16935 zone)

EMBL: L31492

ID   L31492; SV 1; linear; genomic DNA; STD; INV; 3395 BP.
XX
AC   L31492;
XX
DT   07-APR-1994 (Rel. 39, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Caenorhabditis elegans ubiquitin/ribosomal fusion protein (ubiB) gene exons
DE   1-3, complete cds.
XX
KW   ubiquitin/ribosomal fusion protein.
XX
OS   Caenorhabditis elegans
OC   Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
OC   Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
OC   Caenorhabditis.
XX
RN   [1]
RP   1-3395
RX   DOI; 10.1006/dbio.1995.1260.
RX   PUBMED; 7556908.
RA   Jones D., Stringham E.G., Graham R.W., Candido E.P.;
RT   "A portable regulatory element directs specific expression of the
RT   Caenorhabditis elegans ubiquitin gene ubq-2 in the somatic gonad";
RL   Dev. Biol. 171(1):60-72(1995).
XX
RN   [2]
RP   1-3395
RA   Jones D.;
RT   ;
RL   Submitted (31-MAR-1994) to the INSDC.
RL   Donald Jones, Biochemistry and Molecular Biology, University of British
RL   Columbia, Vancouver, B.C. V6T 1Z3, Canada
XX
DR   MD5; 7957c4dc3ed1da9e7d2f5b5184541baf.
DR   Ensembl-Gn; WBGene00006728; caenorhabditis_elegans.
DR   Ensembl-Tr; ZK1010.1; caenorhabditis_elegans.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3395
FT                   /organism="Caenorhabditis elegans"
FT                   /chromosome="III"
FT                   /strain="Bristol"
FT                   /mol_type="genomic DNA"
FT                   /sex="hermaphrodite"
FT                   /db_xref="taxon:6239"
FT   exon            <1385..1523
FT                   /gene="ubiB"
FT                   /number=1
FT   CDS_pept        join(1385..1523,1601..1687,1737..1897)
FT                   /codon_start=1
FT                   /gene="ubiB"
FT                   /product="ubiquitin/ribosomal fusion protein"
FT                   /db_xref="GOA:P49632"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49632"
FT                   /protein_id="AAC37252.1"
FT                   /translation="MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKQICRKCYARLP
FT                   PRASNCRKKKCGHSSELRIKKKLK"
FT   intron          1524..1600
FT                   /gene="ubiB"
FT                   /number=1
FT   exon            1601..1687
FT                   /gene="ubiB"
FT                   /number=2
FT   intron          1688..1736
FT                   /gene="ubiB"
FT                   /number=2
FT   exon            1737..>1897
FT                   /gene="ubiB"
FT                   /number=3
FT   regulatory      1926..1931
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3395 BP; 991 A; 740 C; 620 G; 1044 T; 0 other;
     gatctccaat cgactgggcc ttcttgtata gcgtctgtac ggatctggaa attgaattta        60
     atcggattta tctatttata tctaaattag cacttacatt aaccatttca ttcattgtag       120
     cggttctact agccacataa atatgcccct ctttatttgg aactgtgaga gaggaaaagt       180
     ggtgaggaga cggcttggaa cgcggttttc cctcctggaa aaccaacacg aattgctcgc       240
     ggatccaata gcttcagcca tggcaaccaa ttgatattcg ctgtccactc caacatatct       300
     tccgaatcct gtcttcaaac tgattttact atcgtctgga gttttgacga gcgcgaaaat       360
     ttcctcagga ttcgggcctt ctcctccgga tgtggaaatc caattgtgaa ttttccgttg       420
     tccattgcag cgacataagt tcgcgttgag ccggctccac tggcaacttc gatggcgacg       480
     ttggttcctc ctttcatatc gaattcatcg gcaattttgc gccaaccacc attttcgacg       540
     gtgtctggat cgattttctc cttgtcgtct ttgttcttct tctttttctc ctttcccact       600
     ttgaatctgc aacgagtgaa ttaatggagg attttataca ctttaaactt gaatatgtca       660
     cttacaaatt cttttttccg gcttttaatt tcaatccacc accttttaca gcactgtagt       720
     cagcgcctgg cattttttca agttttctgc aataaaaaac aaaattttca tcaataaaac       780
     tgtaaatttc ataacaaaac tcgaagaaat caataaaaaa acgttcgaaa aacgtttgaa       840
     acaaaaaaat aatattcgaa ttcttctccc ccttcccgaa atcctgcagc tctctaccgt       900
     actttcgccg tctctcaatt tcgcggcgag acccatcacc acggcaatcc tccatttgtg       960
     tcgctgggcc taaatttttt ccgttttttt gctcgatttt cgccgtttct ctgcgaaatt      1020
     tttccaaatt tctgttcaat ttaatcaaaa tattgttctg gacgcttgtt cagcatagaa      1080
     agtggagatt ctgttgtatt ttaagcttgg aaaacgaatt tattatgaaa tttcattttt      1140
     ttgctaaata atttctctat tcttgaattt ttacagcttt ttaacgcaaa tattctttcc      1200
     tctttgttct aaatgggtag ttacacacat tatgcggtct ataacgtctt ttgtcacctt      1260
     tgaaactagt ctctaaagaa aaatcaataa tttttgcccc tacgctctcc tccaaatgtt      1320
     tcgctctcgc cgtcattttc tgacaatttt actcggtttc ttttcaaatt atataatttc      1380
     agtcatgcaa atcttcgtca agactctgac gggtaagact attaccctcg aagtcgaggc      1440
     ttccgatacc attgagaatg tcaaggccaa gatccaagac aaggagggaa tcccaccaga      1500
     tcagcaaaga ttgatcttcg ccggtacgtt attattcaga cctgatatat tcttgaatta      1560
     atttccgggc aaaacaccca atataatttt ctaatttcag gaaagcaact cgaggatgga      1620
     cgtactctct ccgactacaa catccaaaag gagtctactc tccacttggt gctccgtctt      1680
     cgtggaggtt agtttttttc taatgttcag gcattgagaa atatttctaa attcaggaat      1740
     catcgagcca tctctccgtc agctcgccca gaagtacaac tgcgacaagc agatctgcag      1800
     aaagtgctat gctcgtctcc caccacgtgc cagcaactgc agaaagaaga agtgcggaca      1860
     ctccagcgag ctccgcatca agaagaagct gaagtaactt cactcgttcc agtccatgtg      1920
     ttggaaataa atcgttaatt ttaattgaat gtcgctattt gtgcaaaacg taaatttcgt      1980
     aaatattgga tttttggaat gagatttgta catggtaaca aagaatcatt ataaaataca      2040
     gatgctcaaa tcaatacttc ggggagctct agtagctaca aagccgggtc cagccaggcg      2100
     ccagttctca ttcacagcac ttctgcggag cgagacccag cccaaagaga taattaatct      2160
     ggttcgggtt caagttagaa agatgaagaa gagacgccca gttgcttcat cggttgttcc      2220
     aaaatcccta cgagaacctt cagtcgtcgc catggcactt tcagaatcac tgaacctcaa      2280
     tgaggtcatc atggatcaca gctcaatgga atgtataata taactgcaat cgtcgaggac      2340
     gcggatgaca gcttgcactt tgtcaaaaaa ctggaatata ccatcaatcc aggcgaactc      2400
     agtgaaattt tcgtgtttcg agatggagtt gtcgtttttt ggaacgttga ttctagtcag      2460
     cgatcgcata ttctacggga gctcgaacga tacgcagatg ctccatatga ctcgatgatt      2520
     gtgatggatg agcaggatag aatgttctat aaattttcag agcagtacgt tttctcttga      2580
     aatcgtcaaa tttgcaaaaa aaaacgcgcc gcacagaaat agaggcggcg taatttcgca      2640
     accctgtggt cacggttttt acttcttttt ttttaaattt gagttttagc ctcacaacct      2700
     tatgataatc aaattggata acatttcatt caaaaaaaga aagtaagtaa aaaccgtgcc      2760
     gcagggttgc aaaattacgc cccgcctctt tttctgtgcg acactgcttt tttgttgcaa      2820
     aattctcttt ttttgttcaa aaaagaaaat ttagataatt ttctccaata gaagcttcaa      2880
     aattaggaaa aactcgacaa aaattcaaaa atttacaatt ttttattaat ataagcgaaa      2940
     tttgcaaaac aaaacggcgc cgcacagata tagaggcggg gcgtcatttt gcaacctgcg      3000
     gcatggtttt tcctcttttt tttttgcaaa atttgcaatt tttaactcaa aaaaaaaaga      3060
     aaaataaaat gacattttcc agcagaaact ttaaaattaa gaaaaactca aaagtattaa      3120
     aaaagaaaat tattatttcc aggtctacag gatccaccat tcgtcaagat cgtttctacc      3180
     tctcgggaaa acatttggac gccttccacg gctcgaacga agcaatttta gagcgatttg      3240
     cactcagtca gggattcgct gcttccgtga aaatcggagt ctgggaaagt cttctaaaca      3300
     atcttgcgga gccactctcc aacactacaa aatcgctaac tctgggaaag attccgtgga      3360
     gccggaagca ggctctcatg agatccggag aattc                                 3395
//

If you have problems or comments...

PBIL Back to PBIL home page