(data stored in SCRATCH zone)

EMBL: L32599

ID   L32599; SV 1; linear; genomic DNA; STD; PRO; 3723 BP.
XX
AC   L32599;
XX
DT   11-MAY-1994 (Rel. 39, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Bacillus subtilis multidrug efflux transporter (blt) gene; transcription
DE   regulator (bltR) gene; transacetylase (bltD) gene.
XX
KW   blt gene; bltD gene; bltR gene; multidrug efflux transporter;
KW   transacetylase; transcription regulator.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3723
RX   PUBMED; 7608059.
RA   Ahmed M., Lyass L., Markham P.N., Taylor S.S., Vazquez-Laslop N.,
RA   Neyfakh A.A.;
RT   "Two highly similar multidrug transporters of Bacillus subtilis whose
RT   expression is differentially regulated";
RL   J. Bacteriol. 177(14):3904-3910(1995).
XX
RN   [2]
RP   1-3723
RA   Neyfakh A.A.;
RT   ;
RL   Submitted (09-MAY-1994) to the INSDC.
RL   Alex A. Neyfakh, Department of Medicinal Chemistry and Pharmacognosy,
RL   University of Illinois, Chicago, IL 60612, USA
XX
DR   MD5; 8cd058e3225b82783e86d30ab76d6bf5.
DR   EuropePMC; PMC1065235; 15774883.
DR   EuropePMC; PMC123860; 11916697.
DR   EuropePMC; PMC161847; 12821500.
DR   EuropePMC; PMC98904; 9529885.
DR   EuropePMC; PMC99009; 11104814.
DR   GOA; P54428.
DR   InterPro; IPR000644; CBS_dom.
DR   InterPro; IPR002550; CNNM.
DR   InterPro; IPR005170; Transptr-assoc_dom.
DR   InterPro; IPR016169; FAD-bd_PCMH_sub2.
DR   InterPro; IPR036318; FAD-bd_PCMH-like_sf.
DR   UniProtKB/Swiss-Prot; P54428; YRKA_BACSU.
DR   UniProtKB/Swiss-Prot; P54429; YRKB_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3723
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /isolate="BD170"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(299..1120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bltR"
FT                   /product="transcription regulator"
FT                   /function="transcriptional regulator of blt"
FT                   /db_xref="GOA:P39842"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39842"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC36943.1"
FT                   /translation="MSEDVKKYFTTGEFSKLCRVKKQTLFHYDEIGLFSPEIKKENGYR
FT                   YYSYHQFETFQVISLFKELGVPLKEIKCLIKGKTPDKILHVLKEKSIEIDKKINELKQL
FT                   QTILQTKVTLTEQALETDFSSISFEYLNEETFMLSRKTLNLPERKYVAAISELIHEVQQ
FT                   YELDEGYPIGGIFAREQILEKDFYNYSYFYIKVKDGAENINYHVRPKGLYAVGYEIGGN
FT                   TEEAYRRIIEFIERNGMQIGENAYEEYMLDEMVVDGYENTYAKILLQVKEV"
FT   regulatory      1131..1136
FT                   /gene="blt"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      1156..1161
FT                   /gene="blt"
FT                   /regulatory_class="minus_10_signal"
FT   CDS_pept        1237..2439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blt"
FT                   /function="multidrug efflux transporter"
FT                   /db_xref="GOA:P39843"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39843"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC36944.1"
FT                   /translation="MKKSINEQKTIFIILLSNIFVAFLGIGLIIPVMPSFMKIMHLSGS
FT                   TMGYLVAAFAISQLITSPFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFS
FT                   RILGGVSAAFIMPAVTAYVADITTLKERSKAMGYVSAAISTGFIIGPGAGGFIAGFGIR
FT                   MPFFFASAIALIAAVTSVFILKESLSIEERHQLSSHTKESNFIKDLKRSIHPVYFIAFI
FT                   IVFVMAFGLSAYETVFSLFSDHKFGFTPKDIAAIITISSIVAVVIQVLLFGKLVNKLGE
FT                   KRMIQLCLITGAILAFVSTVMSGFLTVLLVTCFIFLAFDLLRPALTAHLSNMAGNQQGF
FT                   VAGMNSTYTSLGNIFGPALGGILFDLNIHYPFLFAGFVMIVGLGLTMVWKEKKNDAAAL
FT                   N"
FT   CDS_pept        2608..3066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bltD"
FT                   /function="transacetylase cotranscribed with blt"
FT                   /note="putative"
FT                   /db_xref="GOA:P39909"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027455"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39909"
FT                   /protein_id="AAC36945.1"
FT                   /translation="MSINIKAVTDDNRAAILDLHVSQNQLSYIESTKVCLEDAKECHYY
FT                   KPVGLYYEGDLVGFAMYGLFPEYDEDNKNGRVWLDRFFIIERYQGKGLGKKMLKALIQH
FT                   LAELYKCKRIYLSIFENNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL"
XX
SQ   Sequence 3723 BP; 1060 A; 699 C; 662 G; 1302 T; 0 other;
     aaatggcttt tgaacattta catagcacaa caacagagta tacggaattc tgttgtttgt        60
     cccccctatc ccagctcttt tagatttatc tctttggatg cgccttgatg gccagttttt       120
     cagcagcata gaatttatcc cctcctgaat cgttatagca tatttcaacg ccgatagact       180
     tgcggttccc agtgccgttt gtaccgtctc ctgtatgtgg gctcgctttt agtaaaccag       240
     tttatattct ttttgggcac acaacagaaa caattttcca tatgaaaatc tcgtaatttt       300
     acacctcttt aacttgaagg aggatttttg catatgtatt ttcatacccg tcaactacca       360
     tctcatccag catatattcc tcatatgcat tttcccctat ttgcattcca tttctttcaa       420
     tgaactcaat gattctccgg tacgcctctt cagtatttcc gcctatttca tatccaactg       480
     catacaggcc ttttggccgt acatgataat ttatgttctc tgccccatct tttactttta       540
     tataaaagta actgtaattg tagaagtctt tttctaagat ttgttcccgt gcaaagattc       600
     cgcctatcgg atatccttca tctaattcat attgctgaac ttcatgaatg agttctgaaa       660
     tggccgccac atattttcgt tctggtaagt ttaatgtttt tcggcttaac atgaatgttt       720
     cttcatttaa atattcaaaa gaaattgagg aaaaatcagt ctcaagtgct tgttctgtaa       780
     gcgtcacttt tgtttgtaag atcgtttgca actgcttaag ctcatttatt tttttatcaa       840
     tctcaataga cttttctttt agaacatgca ggatcttgtc tggtgttttt ccttttatta       900
     gacactttat ttcttttaat ggaaccccaa gctctttaaa tagactgatg acttgaaaag       960
     tctcaaattg atgataggaa taatatctat acccattttc tttttttatt tccggcgaga      1020
     aaagaccaat ctcatcataa tgaaataaag tttgtttttt tacacggcag agcttcgaaa      1080
     actcccctgt tgtgaaatac ttcttaacat cttcgctcat aaaaacctcc ttgactatac      1140
     ggtaaccata taccttatga tttgattgta cttgaaaaaa gcttcaagcg aaaaggatag      1200
     gtaaaaaggg ttcaattgag taaaagggga attcagatga aaaaatcaat aaatgagcaa      1260
     aaaacgatat tcattatact attaagcaac atcttcgtag catttcttgg tatcggttta      1320
     atcattccag ttatgccttc ttttatgaaa atcatgcatt tatccggcag cacaatgggt      1380
     tatcttgttg cggcttttgc catttctcag ttaattactt caccttttgc aggtaggtgg      1440
     gttgaccgtt tcgggagaaa aaaaatgatt attctcgggt tgcttatatt cagtttatct      1500
     gagttgattt tcggattagg gacccatgtt tcaatatttt atttctcgag gatattgggt      1560
     ggtgtaagtg cggcttttat catgcccgcg gtaacagcat atgtagctga tattacaacc      1620
     ctaaaggaaa ggtcaaaggc tatggggtat gtttctgctg caattagcac cggctttatt      1680
     attggacctg gtgcgggagg atttattgcc ggctttggta tccgcatgcc gtttttcttc      1740
     gcctccgcca tcgcgttaat agcagctgtc acttccgttt ttatactaaa agagtcattg      1800
     tcgatagaag aacgccatca actctcatct catacaaagg aatcaaattt cattaaagac      1860
     ttgaagagat ccattcatcc tgtctatttc attgcattta ttatcgtctt tgtaatggct      1920
     tttggtttat cagcttatga aacggtattc agcttgtttt ctgatcataa atttggcttc      1980
     acaccaaaag atattgcagc cattattacg attagttcca ttgttgcggt agttattcaa      2040
     gttttactat tcgggaaatt ggtcaacaaa cttggagaga aaagaatgat tcagctgtgc      2100
     ttaataaccg gtgcgatctt ggctttcgtg tctactgtta tgtcaggatt tttaactgtt      2160
     ttgcttgtaa cttgttttat ttttctggcg ttcgatttgc tacgtccggc cttaaccgct      2220
     catttatcca atatggccgg taaccagcag ggtttcgtag caggcatgaa ctccacatac      2280
     accagcctgg gaaatatatt tggacctgct ctaggcggta tactatttga tcttaacatt      2340
     cattatcctt tcctttttgc aggtttcgtt atgattgtcg gccttggtct tacaatggtt      2400
     tggaaagaaa aaaagaatga tgctgcagct ttgaattaat tcattttcta taaagttaag      2460
     tcatttggat gcagggaatg cccctggtta ggcacaataa gaaaaggtac ttaatttgat      2520
     aggctacatg ttgcttgaca tgaatatagt ataagctgag ttttagcaat atcaggatac      2580
     cgggataaga aaaaaggaga atgtagtatg agtataaaca taaaagcagt aactgatgat      2640
     aatcgtgctg caattcttga tctacatgtc agccagaatc aattatcata tattgaatct      2700
     acaaaagtat gtttagaaga tgcaaaagaa tgtcactatt ataaacctgt cgggctttac      2760
     tatgaaggag atctagtcgg ttttgcaatg tatggattgt ttcccgagta tgatgaagat      2820
     aataaaaacg gacgagtctg gcttgaccga ttttttatta tcgaacgcta tcagggaaaa      2880
     ggattaggga agaaaatgct taaagccctc attcagcacc ttgctgagtt atataaatgc      2940
     aagagaattt atttaagcat atttgaaaat aatattcatg ctatacgcct ttatcaaagg      3000
     tttggttttc aatttaatgg tgaactcgac tttaatggtg agaaggtaat ggtaaaagag      3060
     ctatagatat ccaagcctcc ttgtttgctg agaaacgttt gaacttcgat aatgataatg      3120
     attacctact taaactgcaa gatcattgtt taaaaaagcc tggatgaaaa tttcatctca      3180
     tgtgttttat ccagatgtta ttcttttttc cggacaattt ctaaataatt aatatgccgg      3240
     ccaactgttt cgtgcacttt aaaaatatac ccatcggctt ctataacgga cccaactgca      3300
     gcgtctattt gttgagtcat aaaccagccg cctattgtat ccacttcgtc acttgctaac      3360
     gtcgttccca ataaatcatt tacatcttca atgagcactt tcgaatctaa gatatagtga      3420
     ttatcattta cttttctaat attaggcact tcatctttat caaattcatc tctgatttcc      3480
     ccgacaattt cttcaagaat atcttcagca gtgactaaac ctgaagtgcc gccatattca      3540
     tccacaagaa tagcgatatg tgttcgctct tttcgcattt ttcccaatac atcatgaatt      3600
     ggaacggatt caataacatg gataacaggg ttgatatgat tttctaactt gaaatcctct      3660
     tttatcttct ggtctgggtc aatataagct gaccaaaatt cttttgcatt gataaaacca      3720
     atg                                                                    3723
//

If you have problems or comments...

PBIL Back to PBIL home page