(data stored in ACNUC1829 zone)

EMBL: L34755

ID   L34755; SV 1; linear; genomic DNA; STD; INV; 2852 BP.
XX
AC   L34755;
XX
DT   23-JUL-1994 (Rel. 40, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Schistosoma mansoni integral membrane protein 23 gene, complete cds.
XX
KW   integral membrane protein; integral membrane protein 23.
XX
OS   Schistosoma mansoni
OC   Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Strigeidida;
OC   Schistosomatoidea; Schistosomatidae; Schistosoma.
XX
RN   [1]
RP   1-2852
RX   DOI; 10.1006/expr.1995.1018.
RX   PUBMED; 7821405.
RA   Lee K.W., Shalaby K.A., Medhat A.M., Shi H., Yang Q., Karim A.M.,
RA   LoVerde P.T.;
RT   "Schistosoma mansoni: characterization of the gene encoding Sm23, an
RT   integral membrane protein";
RL   Exp. Parasitol. 80(1):155-158(1995).
XX
DR   MD5; fb5cd71c5edf447b6bbbf70752f59f3b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2852
FT                   /organism="Schistosoma mansoni"
FT                   /strain="NMRI"
FT                   /mol_type="genomic DNA"
FT                   /sex="pairs"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:6183"
FT   regulatory      237..242
FT                   /regulatory_class="GC_signal"
FT   regulatory      order(329..332,408..411,459..463,481..484,498..502)
FT                   /regulatory_class="CAAT_signal"
FT   regulatory      519..523
FT                   /note="putative"
FT                   /regulatory_class="TATA_box"
FT   exon            563..713
FT                   /number=1
FT   mRNA            join(563..713,750..938,971..1135,1169..1255,2293..2826)
FT   CDS_pept        join(645..713,750..938,971..1135,1169..1255,2293..2439)
FT                   /codon_start=1
FT                   /product="integral membrane protein 23"
FT                   /db_xref="GOA:P19331"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19331"
FT                   /protein_id="AAA73525.1"
FT                   /translation="MATLGTGMRCLKSCVFVLNIICLLCSLVLIGAGAYVEVKFSQYGD
FT                   NLHKVWQAAPIAIIVVGVIILIVSFLGCCGAIKENVCMLYMYAFFLVVLLIAELAAAIV
FT                   AVVYKDRIDSEIDALMTGALDKPTKEITEFMNLIQSSFHCCGAKGPNDYRGNVPASCKE
FT                   ENLTYTEGCVSVFGAFLKRNLVIVACVAFGVCFFQLLSIVIACCLGRQIKEYENV"
FT   intron          714..749
FT                   /number=1
FT   exon            750..938
FT                   /number=2
FT   intron          939..970
FT                   /number=2
FT   exon            971..1135
FT                   /number=3
FT   intron          1136..1168
FT                   /number=3
FT   exon            1169..1255
FT                   /number=4
FT   intron          1256..2292
FT                   /number=4
FT   exon            2293..2826
FT                   /number=5
FT   regulatory      2808..2813
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2826
XX
SQ   Sequence 2852 BP; 814 A; 501 C; 570 G; 967 T; 0 other;
     ctctaataat taacgatatg atactcacta cttctgaaga acacatatgg gctgaagatt        60
     gaataatata tttagtatga ataaaggcag gttataaaga atgatgacgt cctcgatgct       120
     gagccatgcc atccgattga ttagttgaat attctcgcgt tcgcgattgc tggccttttg       180
     ctatccgtcc cacagcccat gaggttcaaa ccccttagtt gcaacctcac ggcagtgggc       240
     cgtggtctaa agttcatgta tcactgtctg taaaaagagg aaaggaccca ggacaggaac       300
     tgtcggtagt caactaagta ctggtttcca attggagtgc ttgaaattca ttcttacttc       360
     tatctacgac ttaccaggaa atccttaagc catttataga ggtccggcaa tgcctagatt       420
     tcccagcttc aagaacagtc tattacttga caccttgtca aatgcatgta ttgtaaattt       480
     caattcgata ctgaaaacaa atgcatcaga gattcttgta taagcttttt taagtgataa       540
     tggcgtggtg tttgctgctc atatttgttt aagtgttata gtgatgagaa ttctgttaaa       600
     ggagagggag ttttaattgt tggcattgtg tcccgtttga aagtatggca acgttgggta       660
     ctggtatgcg ttgtctaaaa agttgcgtat tcgttttgaa catcatctgt ctggtatgaa       720
     tagctgattt taattgtttc ttcaactagt tatgttccct ggtattaatt ggggctggtg       780
     cctatgtgga agtcaagttt agtcaatatg gagacaattt acacaaagtc tggcaggcag       840
     cacctatcgc tattattgtt gtcggagtaa taatcctgat agtgagcttt ctgggttgtt       900
     gtggagccat aaaggaaaac gtctgcatgc tgtatatggt aggttattcc aggcaagttt       960
     gagcttgtag tatgcgttct tcctcgtcgt acttctgatt gctgagttgg ccgctgccat      1020
     agttgcagtt gtttacaaag ataggatcga ttcagaaatt gatgcattaa tgactggtgc      1080
     tctggataaa ccgacaaaag agataactga attcatgaat ttgattcaat catcagtaag      1140
     tcataagagt acctgttaac ttatctagtt ccattgctgt ggagccaaag gccctaatga      1200
     ttatcgtggt aacgtgccag cctcgtgcaa agaagagaat ttgacctata ccgaagtaag      1260
     tccaatttgt ttgaaatgca tgttgagaga atactgagta gtacgtagtc atcgttaata      1320
     acagttaatt gacacgtacg tagacatata ttatctaaag attttctcca tcaaatctga      1380
     tgcaagtcta gatacatttg tttcgaacaa gttcctgaat gtgaaaacac ttgtaactta      1440
     cgaaataatg ttgtttttgg taccaatatt cattcctaac gttccttagt gcatatgtta      1500
     atttttgcct agtaagttgg ttagtccatg tcagtttttc gccgtgtaat acaacatacg      1560
     aaagcaagcc ttgagaatca catgacatca gaagctgtgc tactcttaaa gtcagtagca      1620
     ttgagcagtt gattagtcat tcgcaacgta gaacctagta cgtatgtaca tatttcgatt      1680
     tcacctcatc atattagcac agagaatgag attgtaaagc gaactctctg agtagcaaat      1740
     ttagtaacag cattagtagt aataaatatc aggcgtctaa tatttgattg aggaaaacga      1800
     aaataactga aataagaaga aaaagttgta aataattcat tagttcaaag tttagatgtc      1860
     aataaaggag agatgcaacc atgtcatcgc acacaatttt gagccatgtc attcagtcct      1920
     taattgccgg ttataaaaat cacttggacc ccaatcaagt tgtctacaac tgttgacatg      1980
     aatcagtgaa tgacttcatg aactgatgca ttaggatatg ccctattaaa agttcgtgtt      2040
     ttcgacaaaa ttataggctg agcttgcctc aggctcaaag tgttactact gttgtagtac      2100
     tcgtacgtat gattgatttc agctgcaaac tccgaataat cattcggcga gactacgttt      2160
     gcagtccgag gtctatgtct ttactttgtc agatggtgct acgagtctta tacttttatc      2220
     aaggcaatac tgattaattg tactaagtct ggaatacata ttttctaacg gttatcgtct      2280
     tttcattttt agggctgtgt atctgtcttt ggagcattct taaaacgcaa cctggtgatt      2340
     gttgcctgtg ttgcatttgg tgtatgcttt ttccagttgt taagcattgt catagcctgc      2400
     tgtttgggtc gccaaataaa ggagtatgag aatgtgtaaa cactgcaaag aaaacagtat      2460
     gatgtttatc aatcccgttc tgttttccct ctggctttta tgaaatgttg cttttttatt      2520
     gcctagataa ttgtgccttg gctaataatc gtgtactcga cttcgtttac gatataatta      2580
     ttatacttaa atatgatact gtcattctca ttgtttcact tatcattctt ataccaaatg      2640
     agctgcattg attccctggt atttacctac aaactgatga caaatcatct tcatttttat      2700
     ggtgtgtctt ataacatttc tcgtttatat aattttaagt ctttggtata ccttttgttt      2760
     tacagaccgc ttattttgcc gccacagcat tagacatttc ttgtataaat taattccgtt      2820
     aacttatttc agtcttcaac tgcaattgcg gg                                    2852
//

If you have problems or comments...

PBIL Back to PBIL home page