(data stored in ACNUC16935 zone)

EMBL: L36067

ID   L36067; SV 1; linear; genomic DNA; STD; INV; 2214 BP.
XX
AC   L36067;
XX
DT   08-SEP-1994 (Rel. 40, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Anopheles gambiae polyubiquitin gene, complete cds.
XX
KW   polyubiquitin.
XX
OS   Anopheles gambiae (African malaria mosquito)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae;
OC   Anophelinae; Anopheles.
XX
RN   [1]
RP   1-2214
RA   Beard C.B., Cornel A.J., Collins F.H.;
RT   "The polyubiquitin gene of the mosquito Anopheles gambiae: structure and
RT   expression";
RL   Unpublished.
XX
DR   MD5; 5be4b7762380c9e4b40104854b7741ef.
XX
CC   Sequence includes the 5'and 3' noncoding regions of the gene,the 5'
CC   and 3' terminal repeat units, and a third repeat unit consisting of
CC   the two subterminal repeat units joined at the PvuII site.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2214
FT                   /organism="Anopheles gambiae"
FT                   /strain="SUA 2La"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:7165"
FT   repeat_region   1328..1554
FT                   /rpt_type=TANDEM
FT                   /note="The complete genomic clone contains seven repeat
FT                   units.; ubiquitin monomer; putative"
FT   CDS_pept        1328..2017
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q17033"
FT                   /protein_id="AAA29362.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGN"
FT   regulatory      2175..2180
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2214 BP; 645 A; 415 C; 527 G; 627 T; 0 other;
     ctcgagttga caggatgggt gagtttcgct ggatttgaca gcttggcatg atgcagccca        60
     gtatgacaat ttagggtgcc gaatacattt tattttaaaa aaactttttg catagtttaa       120
     gtaacttggt tttagctgta aattataaaa aaacactgaa gacatcttaa atgcttgaaa       180
     tacagttcaa aatcttatta acttgatatt tgaatttgac caattaaatt attaacgtca       240
     atcggccatg tcatgattat acctgttttc tgaacaagtt ggcatcagct ttggccgtgc       300
     gcatcatttt ccttattcag atttcaccct gcgagaagaa cagaagtgca aactgcgaac       360
     tccgtgactg tgcgttgata aaaaaaaagt gatatttgtg aatttcatct agagctgtga       420
     gtcaacaatt aatatacgtg aagagtgtga actaaagtga aggtaagtca gattggggtt       480
     agcaattatt tccctgttaa caggctgaac tggaatagac ctcaaagcgt tgggctttga       540
     tggcaatgga ggggctgaaa ggtcattaat gaacaaagag ggtttcccac tttattcgaa       600
     gcgtttgtag atatgaatat ttgcaaaagg aaatttgata attgaagaat tgtaatgcaa       660
     attatttgtt gggttctcta attttcaatc ccttcggtgg cgtcgcttct gcaggtagcg       720
     aaaattgtct ttgttctcca tcgtcaccag ccgttatgac gtaaaagaaa atggcgaacg       780
     tttcgaatga ctttggaatt aacgcatcag gcatctttac gagtagacta gacggttctc       840
     gaaacgttag tcatttcctg tttttttcca caataacttt ttacatcagc gcataggtta       900
     gatagctttg ctagagcttc atgcatgaaa tgcattcgta tagggaatga gtcagatgcg       960
     ctatcaactg tgaaaacaaa gaaaatcgat aaggtcagct gatgcggaag agctcagagc      1020
     gcagctgtag acctggcgtt agcaacaagc tctctttgtt cgtcaaagta ggttatgaag      1080
     aaaagaaatc taaaacattt tcgttccgta cagcaatgta atcgcgaaca aagagtgctt      1140
     tgctatggaa aatatttggt tagtaagtga agtatgcaaa tagcatgtac agttctggca      1200
     ttaccaaaat cgaaattatc gtgttttttg taattttatt tattgagtga atgtatgaat      1260
     catgttttat tttgcaagca cgaaaattta tgtgttgtta tttattattt atttcatgta      1320
     atttaggatg cagatcttcg tgaagacgct gactggcaag accatcacgc tggaggtcga      1380
     gccgtcggac acgatcgaga acgtgaaggc caagatccag gacaaggagg gcattcctcc      1440
     agatcagcag cgtttgatct tcgccggtaa gcagctggaa gacggacgta ccttgtccga      1500
     ctacaacatc cagaaggagt cgaccttgca cttggtcctc cgtctgcgcg gtggcatgca      1560
     gatcttcgtg aagacgctga ctggcaagac catcacgctg gaggtcgagc cgtcggacac      1620
     gatcgagaac gtgaaggcca agatccagga caaggagggt attcctccag atcagcagcg      1680
     tttgatcttc gccggtaagc agctggaaga cggacgtact ctgtccgact acaacatcca      1740
     gaaggagtcg accttgcact tggtccttcg tctgcgcggt ggcatgcaga tcttcgtgaa      1800
     gacgctgact ggcaagacca tcacgctgga ggtcgagccg tcggacacga tcgagaacgt      1860
     gaaggccaag atccaggaca aggagggcat tcctccagat cagcagcgtt tgatcttcgc      1920
     cggtaagcag ctggaagacg gacgtactct gtccgactac aacatccaga aggagtcgac      1980
     ccttcacttg gttcttcggc ttcgtggggg aaactgaatc caacgagcat agaaatcgaa      2040
     acagtcgtta cttttttttg gtaaaatgtt gaattgttct cactttgcaa tctgatggat      2100
     tgatgtcacg taatgtgact attaaaaaat cttttgtgga gggtgaagtg ttgaaaaaat      2160
     cgataattta ttccaataaa agagtaaaaa cggcttgagt tagaatttga cctt            2214
//

If you have problems or comments...

PBIL Back to PBIL home page