(data stored in ACNUC8465 zone)

EMBL: L36719

ID   L36719; SV 1; linear; mRNA; STD; HUM; 2030 BP.
XX
AC   L36719;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MAP kinase kinase 3 (MKK3) mRNA, complete cds.
XX
KW   MAP kinase kinase; mitogen activated protein kinase; protein kinase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[[published erratum appears in Science 1995 Jul 7;269(5220):17]]
RP   1-2030
RX   DOI; 10.1126/science.7839144.
RX   PUBMED; 7839144.
RA   Derijard B., Raingeaud J., Barrett T., Wu I.H., Han J., Ulevitch R.J.,
RA   Davis R.J.;
RT   "Independent human MAP-kinase signal transduction pathways defined by MEK
RT   and MKK isoforms";
RL   Science, e1252229 267(5198):682-685(1995).
XX
DR   MD5; fe03b63c2e0c6ebafe3c358cee4d3e53.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
DR   EuropePMC; PMC100077; 11598072.
DR   EuropePMC; PMC1828482; 17130252.
DR   EuropePMC; PMC2039739; 17718906.
DR   EuropePMC; PMC2173571; 11781339.
DR   EuropePMC; PMC2678890; 18695677.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2030
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /note="vector lamda ZAPII"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..337
FT                   /gene="MKK3"
FT   gene            1..2030
FT                   /gene="MKK3"
FT   mRNA            1..2030
FT                   /gene="MKK3"
FT   CDS_pept        338..1294
FT                   /codon_start=1
FT                   /gene="MKK3"
FT                   /product="MAP kinase kinase 3"
FT                   /function="protein kinase"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="H-InvDB:HIT000193270.14"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="AAC41718.1"
FT                   /translation="MSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGA
FT                   YGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFRE
FT                   GDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVK
FT                   PSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDV
FT                   WSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNP
FT                   AERMSYLELMEHPFFTLHKTKKTDIAAFVKKILGEDS"
FT   3'UTR           1292..2030
FT                   /gene="MKK3"
XX
SQ   Sequence 2030 BP; 415 A; 610 C; 576 G; 429 T; 0 other;
     tggctggcaa tggccttgct gacctcgagc cgggcccacg tggggacctt tggagcacag        60
     cctacgatcc tggtgcaagg ccggtggatg cagaggccag tccatatacc acccaggcct       120
     gcgaggagcg tggtccccac ccatccagcc catatgtgca agtgcccttg acagagaggc       180
     tggtcatatc catggtgacc atttatgggc cacaacaggt ccccatctgc gcagtgaacc       240
     ctgtgctgag caccttgcag acgtgatctt gcttcgtcct gcagcactgt gcggggcagg       300
     aaaatccaag aggaagaagg atctacggat atcctgcatg tccaagccac ccgcacccaa       360
     ccccacaccc ccccggaacc tggactcccg gaccttcatc accattggag acagaaactt       420
     tgaggtggag gctgatgact tggtgaccat ctcagaactg ggccgtggag cctatggggt       480
     ggtagagaag gtgcggcacg cccagagcgg caccatcatg gccgtgaagc ggatccgggc       540
     caccgtgaac tcacaggagc agaagcggct gctcatggac ctggacatca acatgcgcac       600
     ggtcgactgt ttctacactg tcaccttcta cggggcacta ttcagagagg gagacgtgtg       660
     gatctgcatg gagctcatgg acacatcctt ggacaagttc taccggaagg tgctggataa       720
     aaacatgaca attccagagg acatccttgg ggagattgct gtgtctatcg tgcgggccct       780
     ggagcatctg cacagcaagc tgtcggtgat ccacagagat gtgaagccct ccaatgtcct       840
     tatcaacaag gagggccatg tgaagatgtg tgactttggc atcagtggct acttggtgga       900
     ctctgtggcc aagacgatgg atgccggctg caagccctac atggcccctg agaggatcaa       960
     cccagagctg aaccagaagg gctacaatgt caagtccgac gtctggagcc tgggcatcac      1020
     catgattgag atggccatcc tgcggttccc ttacgagtcc tgggggaccc cgttccagca      1080
     gctgaagcag gtggtggagg agccgtcccc ccagctccca gccgaccgtt tctcccccga      1140
     gtttgtggac ttcactgctc agtgcctgag gaagaacccc gcagagcgta tgagctacct      1200
     ggagctgatg gagcacccct tcttcacctt gcacaaaacc aagaagacgg acattgctgc      1260
     cttcgtgaag aagatcctgg gagaagactc ataggggctg ggcctcggac cccactccgg      1320
     ccctccagag ccccacagcc ccatctgcgg gggcagtgct cacccacacc ataagctact      1380
     gccatcctgg cccagggcat ctgggaggaa ccgagggggc tgctcccacc tggctctgtg      1440
     gcgagccatt tgtcccaagt gccaaagaag cagaccattg gggctcccag ccaggccctt      1500
     gtcggcccca ccagtgcctc tccctgctgc tcctaggacc cgtctccagc tgctgagatc      1560
     ctggactgag ggggcctgga tgccccctgt ggatgctgct gcccctgcac agcaggctgc      1620
     cagtgcctgg gtggatgggc caccgccttg cccagcctgg atgccatcca agttgtatat      1680
     ttttttaatc tctcgactga atggactttg cacactttgg cccagggtgg ccacacctct      1740
     atcccggctt tggtgcgggg tacacaagag gggatgagtt gtgtgaatac cccaagactc      1800
     ccatgaggga gatgccatga gccgcccaag gccttcccct ggcactggca aacagggcct      1860
     ctgcggagca cactggctca cccagtcctg cccgccaccg ttatcggtgt cattcacctt      1920
     tcgtgttttt tttaatttat cctctgttga ttttttcttt tgctttatgg gtttggcttg      1980
     tttttcttgc atggtttgga gctgatcgct tctcccccac cccctagggg                 2030
//

If you have problems or comments...

PBIL Back to PBIL home page