(data stored in ACNUC8465 zone)

EMBL: L36870

ID   L36870; SV 1; linear; mRNA; STD; HUM; 3576 BP.
XX
AC   L36870;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MAP kinase kinase 4 (MKK4) mRNA, complete cds.
XX
KW   MAP kinase kinase; MAP kinase kinase 4; mitogen activated protein kinase;
KW   protein kinase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[[published erratum appears in Science 1995 Jul 7;269(5220):17]]
RP   1-3576
RX   DOI; 10.1126/science.7839144.
RX   PUBMED; 7839144.
RA   Derijard B., Raingeaud J., Barrett T., Wu I.H., Han J., Ulevitch R.J.,
RA   Davis R.J.;
RT   "Independent human MAP-kinase signal transduction pathways defined by MEK
RT   and MKK isoforms";
RL   Science, e1252229 267(5198):682-685(1995).
XX
DR   MD5; 51473b15f3a8c1ccc983c72a82257c79.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3576
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /note="(vector lambda ZAPII)"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..9
FT                   /gene="MKK4"
FT   gene            1..3576
FT                   /gene="MKK4"
FT   mRNA            1..3576
FT                   /gene="MKK4"
FT   CDS_pept        10..1209
FT                   /codon_start=1
FT                   /gene="MKK4"
FT                   /standard_name="protein kinase"
FT                   /product="MAP kinase kinase 4"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000193276.15"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="AAC41719.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
FT   3'UTR           1210..3576
FT                   /gene="MKK4"
XX
SQ   Sequence 3576 BP; 1052 A; 751 C; 753 G; 1020 T; 0 other;
     ctcccaacaa tggcggctcc gagcccgagc ggcggcggcg gctccggggg cggcagcggc        60
     agcggcaccc ccggccccgt agggtccccg gcgccaggcc acccggccgt cagcagcatg       120
     cagggtaaac gcaaagcact gaagttgaat tttgcaaatc cacctttcaa atctacagca       180
     aggtttactc tgaatcccaa tcctacagga gttcaaaacc cacacataga gagactgaga       240
     acacacagca ttgagtcatc aggaaaactg aagatctccc ctgaacaaca ctgggatttc       300
     actgcagagg acttgaaaga ccttggagaa attggacgag gagcttatgg ttctgtcaac       360
     aaaatggtcc acaaaccaag tgggcaaata atggcagtta aaagaattcg gtcaacagtg       420
     gatgaaaaag aacaaaaaca acttcttatg gatttggatg tagtaatgcg gagtagtgat       480
     tgcccataca ttgttcagtt ttatggtgca ctcttcagag agggtgactg ttggatctgt       540
     atggaactca tgtctacctc gtttgataag ttttacaaat atgtatatag tgtattagat       600
     gatgttattc cagaagaaat tttaggcaaa atcactttag caactgtgaa agcactaaac       660
     cacttaaaag aaaacttgaa aattattcac agagatatca aaccttccaa tattcttctg       720
     gacagaagtg gaaatattaa gctctgtgac ttcggcatca gtggacagct tgtggactct       780
     attgccaaga caagagatgc tggctgtagg ccatacatgg cacctgaaag aatagaccca       840
     agcgcatcac gacaaggata tgatgtccgc tctgatgtct ggagtttggg gatcacattg       900
     tatgagttgg ccacaggccg atttccttat ccaaagtgga atagtgtatt tgatcaacta       960
     acacaagtcg tgaaaggaga tcctccgcag ctgagtaatt ctgaggaaag ggaattctcc      1020
     ccgagtttca tcaactttgt caacttgtgc cttacgaagg atgaatccaa aaggccaaag      1080
     tataaagagc ttctgaaaca tccctttatt ttgatgtatg aagaacgtgc cgttgaggtc      1140
     gcatgctatg tttgtaaaat cctggatcaa atgccagcta ctcccagctc tcccatgtat      1200
     gtcgattgat atcgctgcta catcagactc tagaaaaaag ggctgagagg aagcaagacg      1260
     taaagaattt tcatcccgta tcacagtgtt tttattgctc gcccagacac catgtgcaat      1320
     aagattggtg ttcgtttcca tcatgtctgt atactcctgt cacctagaac gtgcatcctt      1380
     gtaatacctg attgatcaca cagtgttagt gctggtcaga gagacctcat cctgctcttt      1440
     tgtgatgaac atattcatga aatgtggaag tcagtacgat caagttgttg actgtgatta      1500
     gatcacatct taaattcatt tctagactca aaacctggag atgcagctac tggaatggtg      1560
     ttttgtcaga cttccaaatc ctggaaggac acagtgatga atgtactata tctgaacata      1620
     gaaactcggg cttgagtgag aagagcttgc acagccaacg agacacattg ccttctggag      1680
     ctgggagaca aaggaggaat ttactttctt caccaagtgc aatagattac tgatgtgata      1740
     ttctgttgct ttacagttac agttgatgtt tggggatcga tgtgctcagc caaatttcct      1800
     gtttgaaata tcatgttaaa ttagaatgaa tttatcttta ccaaaaacca tgttgcgttc      1860
     aaagaggtga acattaaaat atagagacag gacagaatgt gttcttttct cctctaccag      1920
     tcctattttt caatgggaag actcaggagt ctgccacttg tcaaagaagg tgctgatcct      1980
     aagaattttt cattctcaga attcggtgtg ctgccaactt gatgttccac ctgccacaaa      2040
     ccaccaggac tgaaagaaga aaacagtaca gaaggcaaag tttacagatg tttttaattc      2100
     tagtatttta tctggaacaa cttgtagcag ctatatattt ccccttggtc ccaagcctga      2160
     tactttagcc atcataactc actaacaggg agaagtagct agtagcaatg tgccttgatt      2220
     gattagataa agatttctag taggcagcaa aagaccaaat ctcagttgtt tgcttcttgc      2280
     catcactggt ccaggtcttc agtttccgaa tctctttccc ttcccctgtg gtctattgtc      2340
     gctatgtgac ttgcgcttaa tccaatattt tgcctttttt ctatatcaaa aaacctttac      2400
     agttagcagg gatgttcctt accgaggatt tttaaccccc aatctctcat aatcgctagt      2460
     gtttaaaagg ctaagaatag tggggcccaa ccgatgtggt aggtgataaa gaggcatctt      2520
     ttctagagac acattggacc agatgaggat ccgaaacggc agcctttacg ttcatcacct      2580
     gctagaacct ctcgtagtcc atcaccattt cttggcattg gaattctact ggaaaaaaat      2640
     acaaaaagca aaacaaaacc ctcagcactg ttacaagagg ccatttaagt atcttgtgct      2700
     tcttcactta cccattagcc aggttctcat taggttttgc ttgggcctcc ctggcactga      2760
     accttaggct ttgtatgaca gtgaagcagc actgtgagtg gttcaagcac actggaatat      2820
     aaaacagtca tggcctgaga tgcaggtgat gccattacag aaccaaatcg tggcacgtat      2880
     tgctgtgtct cctctcagag tgacagtcat aaatactgtc aaacaataaa gggagaatgg      2940
     tgctgtttaa agtcacatcc ctgtaaattg cagaattcaa aagtgattat ctctttgatc      3000
     tacttgcctc atttccctat cttctccccc acggtatcct aaactttaga cttcccactg      3060
     ttctgaaagg agacattgct ctatgtctgc cttcgaccac agcaagccat catcctccat      3120
     tgctcccggg gactcaagag gaatctgttt ctctgctgtc aacttcccat ctggctcagc      3180
     atagggtcac tttgccatta tgcaaatgga gataaaagca attctggctg tccaggagct      3240
     aatctgaccg ttctattgtg tggatgacca cataagaagg caattttagt gtattaatca      3300
     tagattatta taaactataa acttaagggc aaggagttta ttacaatgta tctttattaa      3360
     aacaaaaggg tgtatagtgt tcacaaactg tgaaaatagt gtaagaactg tacattgtga      3420
     gctctggtta tttttctctt gtaccataga aaaatgtata aaaattatca aaaagctaat      3480
     gtgcagggat attgccttat ttgtctgtaa aaaatggagc tcagtaacat aactgcttct      3540
     tggagctttg gaatatttta tcctgtattc ttgttt                                3576
//

If you have problems or comments...

PBIL Back to PBIL home page