(data stored in ACNUC26462 zone)

EMBL: L41816

ID   L41816; SV 1; linear; mRNA; STD; HUM; 1480 BP.
XX
AC   L41816;
XX
DT   04-MAY-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Homo sapiens cam kinase I mRNA, complete cds.
XX
KW   auto inhibitory domain; calcium/calmodulin; cam kinase I; protein kinase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1480
RX   PUBMED; 7641687.
RA   Haribabu B., Hook S.S., Selbert M.A., Goldstein E.G., Tomhave E.D.,
RA   Edelman A.M., Snyderman R., Means A.R.;
RT   "Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain
RT   structure and activation by phosphorylation at threonine-177 by
RT   calcium-calmodulin dependent protein kinase I kinase";
RL   EMBO J. 14(15):3679-3686(1995).
XX
DR   MD5; 811092705663a5486ea7dc24da0b590e.
DR   Ensembl-Gn; ENSG00000134072; homo_sapiens.
DR   Ensembl-Tr; ENST00000256460; homo_sapiens.
DR   EuropePMC; PMC2194693; 17997827.
DR   EuropePMC; PMC310695; 9521931.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1480
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="HL-60"
FT                   /note="(vector lambda gt10)"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..147
FT   mRNA            1..1480
FT   CDS_pept        148..1260
FT                   /codon_start=1
FT                   /product="cam kinase I"
FT                   /db_xref="GOA:Q14012"
FT                   /db_xref="H-InvDB:HIT000193789.14"
FT                   /db_xref="HGNC:HGNC:1459"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:4FG7"
FT                   /db_xref="PDB:4FG8"
FT                   /db_xref="PDB:4FG9"
FT                   /db_xref="PDB:4FGB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14012"
FT                   /protein_id="AAA99458.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   DAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
FT   misc_feature    1005..1110
FT                   /function="auto-inhibitory and calmodulin binding domains"
FT   3'UTR           1261..1480
XX
SQ   Sequence 1480 BP; 341 A; 410 C; 436 G; 289 T; 4 other;
     gaattccgag caagagcgcg ggcgggtggc ccaggcacgc agcgggtgag gaccgcgccc        60
     acagctcggc gccaaccacc gcgggcctcc cagccagccc cgcnnngagc cgcaggancc       120
     ctggctgtgg tcggggggca gtgggccatg ctgggggcag tggaaggccc caggtggaag       180
     caggcggagg acattagaga catctacgac ttccgagatg ttctgggcac gggggccttc       240
     tcggaggtga tcctggcaga agataagagg acgcagaagc tggtggccat caaatgcatt       300
     gccaaggagg ccctggaggg caaggaaggc agcatggaga atgagattgc tgtcctgcac       360
     aagatcaagc accccaacat tgtagccctg gatgacatct atgagagtgg gggccacctc       420
     tacctcatca tgcagctggt gtcgggtggg gagctctttg accgtattgt ggaaaaaggc       480
     ttctacacgg agcgggacgc cagccgcctc atcttccagg tgctggatgc tgtgaaatac       540
     ctgcatgacc tgggcattgt acaccgggat ctcaagccag agaatctgct gtactacagc       600
     ctggatgaag actccaaaat catgatctcc gactttggcc tctccaagat ggaggacccg       660
     ggcagtgtgc tctccaccgc ctgtggaact ccgggatacg tggcccctga agtcctggcc       720
     cagaagccct acagcaaggc tgtggattgc tggtccatag gtgtcatcgc ctacatcttg       780
     ctctgcggtt accctccctt ctatgacgag aatgatgcca aactctttga acagattttg       840
     aaggccgagt acgagtttga ctctccttac tgggacgaca tctctgactc tgccaaagat       900
     ttcatccggc acttgatgga gaaggaccca gagaaaagat tcacctgtga gcaggccttg       960
     cagcacccat ggattgcagg agatacagct ctagataaga atatccacca gtcggtgagt      1020
     gagcagatca agaagaactt tgccaagagc aagtggaagc aagccttcaa tgccacggct      1080
     gtggtgcggc acatgaggaa actgcagctg ggcaccagcc aggaggggca ggggcagacg      1140
     gcgagccatg gggagctgct gacaccagtg gctggggggc cggcagctgg ctgttgctgt      1200
     cgagactgct gcgtggagcc gggcacagaa ctgtccccca cactgcccca ccagctctag      1260
     ggccctggac ctcgggtcat gatcctctgc gtgggagggc ttgggggcca gcctgctccc      1320
     cttccctccc tgaaccggga gtttctctgc cctgtcccct cctcacctgc ttccctacca      1380
     ctcctcactg cattttccat acaaatgttt ctattttatt gttccttctt gtaataaagg      1440
     gaagataaaa ccaaaaaaaa aaaaaaaaaa acggaattcc                            1480
//

If you have problems or comments...

PBIL Back to PBIL home page