(data stored in SCRATCH zone)

EMBL: L43593

ID   L43593; SV 1; linear; genomic DNA; STD; PRO; 4298 BP.
XX
AC   L43593;
XX
DT   24-AUG-1995 (Rel. 44, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 13)
XX
DE   Bacillus subtilis rpoB gene, 3' end of cds, RNA polymerase beta' subunit
DE   (rpoC) gene, complete cds, orf82 gene, complete cds, and ribosomal protein
DE   S12 gene' 5' end of cds.
XX
KW   ribosomal protein S12; RNA polymerase beta'-subunit; rpoB gene; rpoC gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4298
RX   DOI; 10.1074/jbc.270.35.20329.
RX   PUBMED; 7657605.
RA   Boor K.J., Duncan M.L., Price C.W.;
RT   "Genetic and transcriptional organization of the region encoding the beta
RT   subunit of Bacillus subtilis RNA polymerase";
RL   J Biol Chem 270(35):20329-20336(1995).
XX
RN   [2]
RP   1-4298
RX   DOI; 10.1074/jbc.270.41.23930.
RX   PUBMED; 7592585.
RA   Yang X., Price C.W.;
RT   "Streptolydigin resistance can be conferred by alterations to either the
RT   beta or beta' subunits of Bacillus subtilis RNA polymerase";
RL   J Biol Chem 270(41):23930-23933(1995).
XX
DR   MD5; 372b55268a4a14f42f36704c8a8ae85a.
DR   EuropePMC; PMC140360; 11923353.
DR   EuropePMC; PMC344509; 14766807.
DR   EuropePMC; PMC88165; 11427549.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4298
FT                   /organism="Bacillus subtilis"
FT                   /strain="168 Marburg"
FT                   /mol_type="genomic DNA"
FT                   /clone="21"
FT                   /note="(vector lambda gt11)"
FT                   /db_xref="taxon:1423"
FT   CDS             <1..3
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /note="rpoB (beta) termination codon, nt 4668 in Citation 1
FT                   = nt 1 here"
FT   gene            1..3
FT                   /gene="rpoB"
FT   regulatory      52..56
FT                   /gene="rpoC"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            52..56
FT                   /gene="rpoC"
FT   CDS_pept        65..2866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="RNA polymerase beta' subunit"
FT                   /note="stl6 and stl445 alleles confer streptolydigan
FT                   resistance and alter nt 2451 from an A to a G - this
FT                   transition inserts a gly instead of an asp at beta' residue
FT                   796"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /citation=[2]
FT                   /protein_id="AAB59112.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFK
FT                   NTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDED
FT                   KALEIVEAGIEEVWIRLPSHVIRLMVYVNDAMAEILQLAPMLKSVKLSESLLPNQSVSL
FT                   VHS"
FT   variation       2451
FT                   /replace="g"
FT                   /note="stl6 and stl445"
FT   regulatory      3830..3834
FT                   /note="orf 82"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3841..4089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="orf 82; similar to orf102 of Sulfolobus
FT                   acidocaldarius"
FT                   /db_xref="GOA:P46350"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:3V7E"
FT                   /db_xref="PDB:4LCK"
FT                   /db_xref="PDB:4TZP"
FT                   /db_xref="PDB:4TZV"
FT                   /db_xref="PDB:4TZW"
FT                   /db_xref="PDB:4TZZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46350"
FT                   /protein_id="AAB59113.1"
FT                   /translation="MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSV
FT                   VSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL"
FT   regulatory      4192..4196
FT                   /gene="rpsL"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            4192..4196
FT                   /gene="rpsL"
FT   CDS_pept        4203..>4298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ribosomal protein S12"
FT                   /db_xref="GOA:P21472"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21472"
FT                   /protein_id="AAB59114.1"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFK"
XX
SQ   Sequence 4298 BP; 1285 A; 900 C; 981 G; 1132 T; 0 other;
     taatctctag ttataaaggc aagtgacatc ggttaatccg aagataaaaa gggaggtagg        60
     ccccttgcta gatgtgaaca attttgagta tatgaacatc ggtcttgctt caccagataa       120
     aatccgttca tggtcttttg gtgaagtgaa aaagcctgaa acgataaact atcgtacgtt       180
     aaaacctgaa aaggacggtc tattctgcga acgcattttc ggaccgacta aggactggga       240
     atgtcattgc gggaagtaca agcgagttcg ttataaaggc gtagtttgtg accgctgcgg       300
     agtcgaagta acacgggcta aagtccgtcg tgagagaatg gggcacattg aactggctgc       360
     cccagtttcc cacatttggt atttcaaagg tattccaagc cgtatgggtc ttgtgctgga       420
     tatgtcacct cgtgctttag aagaagtcat ttactttgct tcttacgttg taactgatcc       480
     ggcgaataca ccgcttgaaa agaaacagct tctgtctgag aaagaatacc gtgcttatct       540
     tgataaatac ggtaataaat tccaagcatc tatgggtgct gaagcaattc ataaacttct       600
     tcaagatatc gatcttgtaa aagaagttga tatgttaaaa gaagagctga aaacttcaca       660
     aggacaacgc cgtactcgtg cgatcaaacg tcttgaagtt ttagaagcct tccgtaactc       720
     aggaaacaag ccttcttgga tgatccttga tgtgcttcct gttattcctc cggagcttag       780
     accgatggtt cagctagatg gcggacgttt tgcgacttct gatttgaatg acctttatcg       840
     tcgtgtcatc aaccgtaaca atcgtttgaa acgccttttg gaccttggtg cgcctagcat       900
     catcgttcaa aacgaaaagc gtatgcttca agaggctgtc gatgccctaa ttgacaacgg       960
     ccgccgcgga cgccctgtaa caggtcctgg aaacagaccg ttaaaatctc tttctcacat      1020
     gctgaaaggg aagcaaggcc gtttccgtca aaaccttctt ggtaaacgtg tcgattactc      1080
     cggacgttct gtaatcgttg ttggtcctca tttgaaaatg taccaatgcg gattaccgaa      1140
     ggaaatggca cttgaacttt tcaaaccttt cgttatgaaa gaacttgttg aaaaaggtct      1200
     tgctcacaac attaagagtg cgaaacgcaa aattgagcgc gtacagcctg aagtttggga      1260
     tgtactagaa tcagttatta aggagcatcc ggtactgctg aaccgtgccc ctacacttca      1320
     cagattaggt atccaggcgt ttgaaccaac gcttgttgaa ggacgcgcaa tccgtcttca      1380
     cccgctcgta tgtacagctt acaacgctga ctttgacggt gaccaaatgg cggttcacgt      1440
     accattatct gctgaagcac aagctgaagc acgcatcttg atgcttgctg ctcaaaacat      1500
     cttgaaccct aaagatggta aaccggttgt aacaccgtct caggatatgg tactaggtaa      1560
     ctattacctg acacttgagc gtgccggtgc tgtcggtgaa ggtatggtct tcaagaatac      1620
     agacgaagcg cttcttgctt atcaaaacgg atatgttcac cttcatacga gagtagctgt      1680
     tgcagctaac tcacttaaga atgtgacatt taccgaagaa cagcgctcaa aattgttaat      1740
     tacaactgtc ggtaagcttg tcttcaatga aattcttccg gaatcattcc cttacatgaa      1800
     tgaaccaacg aagagcaaca ttgaagagaa aacacctgac cgtttcttct tagaaaaagg      1860
     tgctgatgtt aaagctgtta tcgcacagca gccaatcaat gcgccgttta aaaaaggcat      1920
     tctgggtaaa atcatcgcgg aaatctttaa acgattccat attacggaaa cgtctaaaat      1980
     gcttgaccgc atgaaaaacc taggtttcaa atattcaact aaagctggta ttacagttgg      2040
     ggtttctgac atcgtcgtac tcgatgataa acaagaaatt cttgaggaag cgcaaagcaa      2100
     agttgacaac gttatgaagc aattccgccg cggtcttatc actgaagaag aacgctatga      2160
     gagagtcatc tctatctgga gtgctgcaaa agacgttatc caaggcaaac tgatgaaatc      2220
     acttgatgaa ctcaacccga tctacatgat gagtgactct ggtgcccgtg gtaacgcatc      2280
     taactttacg cagcttgccg gaatgcgcgg cctgatggcc aacccggctg gacgtatcat      2340
     tgagttgccg atcaaatcaa gtttccgtga aggtctgaca gtattggagt actttatctc      2400
     cacacacggt gcgcgtaaag gtcttgccga taccgctctt aaaactgctg actcaggtta      2460
     ccttacacgc cgtctcgttg acgttgctca ggatgttatc atccgtgaaa ctgattgcgg      2520
     aactgaccga ggcattcttg ctaagcctct taaagaagga actgaaacaa ttgagcgctt      2580
     agaagaacgc ttaatcggac gttttgcaag aaaacaagtg aagcaccctg aaacaggtga      2640
     agtgcttgtg aatgaaaacg aactgatcga tgaagataaa gcactggaga ttgtcgaagc      2700
     cggcattgaa gaagtgtgga tccgtctgcc ttcacatgta atacgcctca tggtgtatgt      2760
     aaacgatgct atggccgaaa tcttgcaact ggctccgatg ttgaagtcgg tgaagctgtc      2820
     ggaatcattg ctgcccaatc aatcggtgag cctggtacac agttaacaat gcgtacattc      2880
     catacaggcg ggttgccgga gacgatatca cacagggtct tccgcgtatc caagagcttt      2940
     tcgaagcgcg taatccgaaa ggtcaggcaa caattacaga aatcgacggt acagtcgttg      3000
     agatcaatga agttcgtgat aagcaacagg aaattgtggt tcaaggcgca gtggaaacac      3060
     gttcttatac ggcaccttac aactcccgcc tgaaagtagc ggaaggagat aaaattactc      3120
     gaggccaagt actgacagaa ggttcaatcg atccgaaaga acttcttaaa gtgactgacc      3180
     tgacgactgt tcaagagtat cttctccatg aggttcaaaa ggtttaccgt atgcagggtg      3240
     ttgaaatcgg tgataaacac gtagaagtaa tggttcgcca gatgcttcgc aaagtacgcg      3300
     tgattgatgc cggtgacact gatgtgcttc caggtacatt gcttgatatt caccaattta      3360
     ctgaagcgaa caaaaaggta ttgcttgaag gcaaccgacc agctacaggc cgtcctgtct      3420
     tactcggtat tacaaaagca tctcttgaaa ctgattcatt cttatctgct gcttccttcc      3480
     aggaaacaac acgtgtcctt acagatgcag cgatcaaagg taagcgtgac gagcttctcg      3540
     gcttgaaaga gaatgttatc atcggtaagc ttgttccagc aggtacagga atgatgaaat      3600
     accgtaaagt aaaaccagta tcaaatgttc agccgactga cgatatggtc ccggttgaat      3660
     aactgattta actctgctga aagactgcaa aaacagtctt tcagcagata tatttatgaa      3720
     aaagtcactc tatgagaaga acgaatctaa aaaatgtcat accttgttga cattcgtctc      3780
     ctagaatgat aatataacca aggtgctcga aataaacctg ttactttgga ggatatgttt      3840
     atgtcttatg ataaagtatc acaggccaaa tcaattatta ttggtacgaa gcaaacagtg      3900
     aaagctctaa agcgaggttc agtaaaggaa gtagtcgttg caaaagacgc agatccgata      3960
     ctcacgtcaa gtgttgtttc acttgctgaa gatcaaggta tctctgtctc aatggttgaa      4020
     tccatgaaaa agctcggcaa agcctgcgga attgaggtag gagcagccgc tgttgccatt      4080
     attttataac gtacttttgt ttttgcgtaa gattccatct tgtgtaaaga cattgttttt      4140
     tgccttttga tgaaccacct gggtatgtgg gttataaaac gtaatgaagg gaggaaaaat      4200
     tcatgcctac aattaatcag ctaattcgca aaggacgcgt gagtaaagta gaaaactcaa      4260
     agtctcctgc acttaacaaa ggatacaaca gctttaaa                              4298
//

If you have problems or comments...

PBIL Back to PBIL home page