(data stored in SCRATCH zone)

EMBL: L47971

ID   L47971; SV 1; linear; genomic DNA; STD; PRO; 10759 BP.
XX
AC   L47971;
XX
DT   02-NOV-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Bacillus subtilis ribosomal protein (rplPNXEFROQ, rpmCDJ, rpsQNHEMK) genes,
DE   integral membrane protein (secY) gene, adenylate kinase (adk) gene,
DE   methionine aminopeptidase (map) gene, inititation factor 1 (infA) gene, RNA
DE   polymerase alpha (rpoA) gene.
XX
KW   adenylate kinase; adk gene; infA gene; initiation factor;
KW   initiation factor 1; integral membrane protein; map gene;
KW   methionine aminopeptidase; protein translocation; ribosomal protein;
KW   ribosomal protein B; ribosomal protein L14; ribosomal protein L15;
KW   ribosomal protein L16; ribosomal protein L17; ribosomal protein L18;
KW   ribosomal protein L24; ribosomal protein L29; ribosomal protein L30;
KW   ribosomal protein L5; ribosomal protein L6; ribosomal protein S11;
KW   ribosomal protein S13; ribosomal protein S14; ribosomal protein S17;
KW   ribosomal protein S5; ribosomal protein S8; RNA polymerase;
KW   RNA polymerase alpha-subunit; rplE gene; rplN gene; rplO gene; rplP gene;
KW   rplQ gene; rplR gene; rplX gene; rpmC gene; rpmD gene; rpmJ gene;
KW   rpoA gene; rpsE gene; rpsH gene; rpsK gene; rpsM gene; rpsN gene;
KW   rpsQ gene; secY gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-10759
RX   DOI; 10.1016/0378-1119(95)00757-1.
RX   PUBMED; 8635744.
RA   Suh J.W., Boylan S.A., Oh S.H., Price C.W.;
RT   "Genetic and transcriptional organization of the Bacillus subtilis
RT   spc-alpha region";
RL   Gene 169(1):17-23(1996).
XX
DR   MD5; eb69a8e0fb226fb2d69a1f18af7518cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10759
FT                   /organism="Bacillus subtilis"
FT                   /map="12 degrees"
FT                   /strain="168 Marburg"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   gene            1..152
FT                   /gene="rplP"
FT   CDS_pept        <1..152
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /protein_id="AAB06806.1"
FT                   /translation="VVKPGKVLFEISGVSEEVAREALRLASHKLPIKTKFVKREEIGGE
FT                   SNES"
FT   gene            129..342
FT                   /gene="rpmC"
FT   regulatory      129..136
FT                   /gene="rpmC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142..342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="GOA:P12873"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12873"
FT                   /protein_id="AAB06807.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTVIREREIAANK"
FT   regulatory      348..352
FT                   /gene="rpsQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            348..634
FT                   /gene="rpsQ"
FT   CDS_pept        365..634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="GOA:P12874"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12874"
FT                   /protein_id="AAB06808.1"
FT                   /translation="MSECERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYS
FT                   KKFKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            657..1043
FT                   /gene="rplN"
FT   regulatory      657..666
FT                   /gene="rplN"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        675..1043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="GOA:P12875"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12875"
FT                   /protein_id="AAB06809.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
FT   regulatory      1064..1072
FT                   /gene="rplX"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            1064..1392
FT                   /gene="rplX"
FT   CDS_pept        1081..1392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /protein_id="AAB06810.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   regulatory      1402..1411
FT                   /gene="rplE"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            1402..1958
FT                   /gene="rplE"
FT   CDS_pept        1419..1958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="GOA:P12877"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12877"
FT                   /protein_id="AAB06811.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
FT   gene            1964..2166
FT                   /gene="rpsN"
FT   regulatory      1964..1973
FT                   /gene="rpsN"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1981..2166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="GOA:P12878"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12878"
FT                   /protein_id="AAB06812.1"
FT                   /translation="MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   regulatory      2181..2188
FT                   /gene="rpsH"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            2181..2596
FT                   /gene="rpsH"
FT   CDS_pept        2198..2596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /protein_id="AAB06813.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFVEDSKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLTDKEARAKQAGGEVLAYVW"
FT   regulatory      2609..2619
FT                   /gene="rplF"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            2609..3165
FT                   /gene="rplF"
FT   CDS_pept        2626..3165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="GOA:P46898"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46898"
FT                   /protein_id="AAB06814.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
FT   gene            3181..3560
FT                   /gene="rplR"
FT   regulatory      3181..3192
FT                   /gene="rplR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3198..3560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="GOA:P46899"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46899"
FT                   /protein_id="AAB06815.1"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQII
FT                   DDVNGVTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHG
FT                   RVKALADAAREAGLKF"
FT   gene            3567..4085
FT                   /gene="rpsE"
FT   regulatory      3567..3573
FT                   /gene="rpsE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3585..4085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="GOA:P21467"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21467"
FT                   /protein_id="AAB06816.1"
FT                   /translation="MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTG
FT                   VIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            4084..4278
FT                   /gene="rpmD"
FT   regulatory      4084..4090
FT                   /gene="rpmD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4099..4278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /product="ribosomal protein L30"
FT                   /db_xref="GOA:P19947"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19947"
FT                   /protein_id="AAB06817.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEQ"
FT   gene            4295..4749
FT                   /gene="rplO"
FT   regulatory      4295..4303
FT                   /gene="rplO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4309..4749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="GOA:P19946"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19946"
FT                   /protein_id="AAB06818.1"
FT                   /translation="MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISK
FT                   LNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI"
FT   gene            4738..6046
FT                   /gene="secY"
FT   regulatory      4738..4744
FT                   /gene="secY"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4751..6046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /standard_name="integral membrane component of the protein
FT                   translocation apparatus"
FT                   /product="integral membrane protein"
FT                   /db_xref="GOA:P16336"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16336"
FT                   /protein_id="AAB06819.1"
FT                   /translation="MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQ
FT                   AQSQMGVFDLLNTFGGGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVI
FT                   AILAVIVGVIFIQQAVRKIAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFL
FT                   ITPRTIASFFGTNDVTKWIQNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMKN"
FT   gene            6088..6754
FT                   /gene="adk"
FT   regulatory      6088..6092
FT                   /gene="adk"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6101..6754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /product="adenylate kinase"
FT                   /db_xref="GOA:P16304"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="PDB:1P3J"
FT                   /db_xref="PDB:2EU8"
FT                   /db_xref="PDB:2OO7"
FT                   /db_xref="PDB:2ORI"
FT                   /db_xref="PDB:2OSB"
FT                   /db_xref="PDB:2P3S"
FT                   /db_xref="PDB:2QAJ"
FT                   /db_xref="PDB:3DKV"
FT                   /db_xref="PDB:3DL0"
FT                   /db_xref="PDB:4MKF"
FT                   /db_xref="PDB:4MKG"
FT                   /db_xref="PDB:4MKH"
FT                   /db_xref="PDB:4QBF"
FT                   /db_xref="PDB:4QBG"
FT                   /db_xref="PDB:4TYP"
FT                   /db_xref="PDB:4TYQ"
FT                   /db_xref="PDB:5X6I"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16304"
FT                   /protein_id="AAB06820.1"
FT                   /translation="MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPL
FT                   GLEAKSYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYG
FT                   KPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADD
FT                   NEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK"
FT   gene            6737..7497
FT                   /gene="map"
FT   regulatory      6737..6741
FT                   /gene="map"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6751..7497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="GOA:P19994"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19994"
FT                   /protein_id="AAB06821.1"
FT                   /translation="MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAE
FT                   RFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITETGFDILTRV"
FT   gene            7791..8027
FT                   /gene="infA"
FT   regulatory      7791..7799
FT                   /gene="infA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7809..8027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /product="initiation factor IF-1"
FT                   /db_xref="GOA:P20458"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20458"
FT                   /protein_id="AAB06822.1"
FT                   /translation="MAKDDVIEVEGTIVETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            8044..8174
FT                   /gene="rpmJ"
FT   regulatory      8044..8051
FT                   /gene="rpmJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8061..8174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /product="ribosomal protein B"
FT                   /note="formerly called X"
FT                   /db_xref="GOA:P20278"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20278"
FT                   /protein_id="AAB06823.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            8180..8562
FT                   /gene="rpsM"
FT   regulatory      8180..8188
FT                   /gene="rpsM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8197..8562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="GOA:P20282"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20282"
FT                   /protein_id="AAB06824.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRV
FT                   RDLTEEELGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            8565..8978
FT                   /gene="rpsK"
FT   regulatory      8565..8573
FT                   /gene="rpsK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8583..8978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="GOA:P04969"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04969"
FT                   /protein_id="AAB06825.1"
FT                   /translation="MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAIS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            9137..10099
FT                   /gene="rpoA"
FT   regulatory      9137..9144
FT                   /gene="rpoA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9155..10099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /product="RNA polymerase alpha-core-subunit"
FT                   /db_xref="GOA:P20429"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="PDB:1Z3E"
FT                   /db_xref="PDB:3GFK"
FT                   /db_xref="PDB:3IHQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20429"
FT                   /protein_id="AAB06826.1"
FT                   /translation="MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGE
FT                   GTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   regulatory      10160..10167
FT                   /gene="rplQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            10160..10539
FT                   /gene="rplQ"
FT   CDS_pept        10177..10539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="GOA:P20277"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20277"
FT                   /protein_id="AAB06827.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
XX
SQ   Sequence 10759 BP; 3356 A; 2024 C; 2491 G; 2888 T; 0 other;
     ctgttgtaaa accgggcaaa gttttatttg aaatttctgg tgtgtctgaa gaggttgctc        60
     gtgaagcgct tcgccttgca tctcacaaat tgccaattaa aacgaagttc gtaaaacgtg       120
     aagaaattgg tggtgaatca aatgaaagct aatgaaattc gtgaccttac cactgctgaa       180
     attgaacaaa aagtaaagtc tcttaaagaa gaacttttca atcttcgctt tcaattagcg       240
     acaggacaac ttgaaaatac tgctcgcatt cgtgaagttc gcaaagctat cgcgcgcatg       300
     aaaactgtga ttcgtgaaag agaaattgct gctaataaat aatcactgag gggaggtcgt       360
     gagcatgagc gaatgcgaac gtaaccaacg caaagtttac caaggccgtg ttgtttctga       420
     caaaatggat aaaaccatta ctgttgttgt tgagacatac aaaaaacata cactttacgg       480
     taaacgcgta aaatactcaa aaaaattcaa agcacatgat gaaaataatc aagctaaaat       540
     cggtgacatc gttaagatca tggaaactcg tccattgtct gcaactaagc gtttccgtct       600
     agttgaagtt gtcgaagaag ctgttattat ctaataaagt tcggaattct ttttccgaag       660
     ggaggtaaca aataatgatt caacaagaga ctcgtttaaa agtagctgac aactctggcg       720
     cacgtgaagt acttactatt aaagttcttg gtggttctgg acgtaaaaca gctaacattg       780
     gtgatgtaat tgtttgcacg gttaaacaag caacaccagg aggcgttgtc aaaaaaggtg       840
     aagtcgtaaa agctgttatc gttcgcacta aaagcggagc gcgcagaagt gacggttcat       900
     acatcagctt cgatgagaat gcatgtgtta tcatccgtga cgacaagagc ccacgcggaa       960
     ctcgtatctt cggaccagtt gctcgtgaat tgcgtgaaaa caactttatg aaaattgttt      1020
     ctctagctcc agaagttatc taattgaaat aaatgcctta ctcaaggagg tgcgatcagg      1080
     atgcatgtaa aaaaaggcga taaagttatg gttatctctg gtaaagataa aggcaaacaa      1140
     ggaacaatcc ttgctgcttt ccctaaaaag gaccgcgttt tagttgaagg tgttaacatg      1200
     gtaaagaaac actctaaacc aactcaagct aaccctcaag gcggtatttc taatcaagag      1260
     gcgccaattc atgtatcaaa cgttatgccg ctcgatccta aaacaggtga agtgactcgc      1320
     gtaggataca aagtggaaga tggcaaaaaa gttcgtgtag caaaaaaatc tgggcaagtt      1380
     ctagataaat agtattaaaa ggaagggagg tctatctcat gaaccgcctt aaagaaaagt      1440
     acaataaaga aattgcacct gctttaatga ctaagttcaa ctatgattca gtcatgcaag      1500
     tgcctaaaat cgaaaaaatc gtaatcaaca tgggtgttgg tgacgctgtt caaaacgcca      1560
     aagcaatcga cagtgctgtt gaggaattaa cgtttatcgc aggtcaaaaa cctgtcgtta      1620
     ctcgtgcgaa gaaatcaatt gctggattcc gtcttcgtga gggaatgcct atcggtgcga      1680
     aagtaactct tcgcggagag cgcatgtatg atttccttga taaacttatt tctgtatctt      1740
     taccgcgtgt acgtgacttc cgcggggttt ctaaaaaatc tttcgacggt cgcggtaact      1800
     acacacttgg tatcaaagaa cagttaatct tccctgaaat tgactacgat aaagtaacaa      1860
     aggttcgcgg aatggacatc gttatcgtaa caactgctaa tactgacgaa gaagctcgtg      1920
     agctattaac tcaagtaggt atgccgttcc agaaataatc aatgaaaggg aggcgaaatc      1980
     gtggctaaaa agtctatgat tgcgaaacaa caacgtacac caaagtttaa agtacaagag      2040
     tacacacgct gtgaacgctg cggacgtccg cattcagtca ttcgtaaatt taaactttgc      2100
     cgtatttgtt tccgtgagct tgcatataaa ggacaaattc ctggcgtgaa aaaagccagc      2160
     tggtaatccc caagaaaggg aaggaggtaa ttatataatg gttatgacag atccaattgc      2220
     agatatgcta actcgtattc gcaatgcaaa catggtacgt catgagaagc ttgaaattcc      2280
     tgcttctaaa ttgaaaagag aaattgctga aattttaaag cgtgaaggtt tcattcgtga      2340
     cgttgagttc gtagaagaca gcaaacaagg tattatccgc gttttcttga aatacggaca      2400
     aaacaacgag cgcgttatca ctggtcttaa aagaatcagc aagcctggtt tgcgtgttta      2460
     tgctaaatct aatgaagtac cccgcgtact taacggtctt ggaatcgcga ttatttctac      2520
     atcacaaggt gttttaacgg acaaagaagc ccgtgcaaaa caagctggtg gagaagttct      2580
     agcatacgtt tggtaagaag tttaacatga atggaggtgt ttggtatgtc tcgtgtaggt      2640
     aagaagctac ttgagattcc ttctgatgtt acagtaacgt taaatgataa caacactgta      2700
     gctgtgaaag gaccaaaagg agaattaact cgtacgtttc accctgatat ggagattaaa      2760
     gtagaggaca atgtgcttac agtcgctcgt ccttctgatc aaaaagagca ccgtgccctg      2820
     catggtacga ctcgcagtct gcttggcaac atggttgaag gtgtatctaa aggatttgaa      2880
     agaggtttgg aattagtcgg tgtcggttac cgtgcttcta aatccggaaa taaacttgtt      2940
     ttaaacgttg gatactctca tcctgttgag atcgttcctg aagaaggcat cgaaatcgaa      3000
     gttccttctc aaacaaaagt agttgtaaaa ggtacagaca aagaacgcgt aggagctatt      3060
     gctgctaaca tccgcgctgt acgttctcca gagccttaca aaggtaaagg aatccgctac      3120
     gaaggtgaag ttgttcgccg taaagaaggt aaatctgcta agtaagatcg cttaaagtga      3180
     agaaaggagt gacctagatg attacgaaaa ctagcaaaaa tgctgctcgt cttaaaagac      3240
     acgctcgtgt tcgcgctaaa ctttccggta ctgctgaaag accgcgcctg aacgttttcc      3300
     gttctaacaa gcacatttac gctcaaatca tcgatgatgt aaatggtgta acacttgcta      3360
     gtgcatctac tctcgataaa gacttgaacg ttgaaagcac tggagatact tctgctgcta      3420
     ctaaagttgg agaattagtt gcaaaacgcg ctgctgaaaa aggcatttct gacgtagtat      3480
     ttgaccgtgg cggatactta taccatggac gtgtaaaagc tttggctgat gccgctcgtg      3540
     aagctggact taaattttaa taaaagaagg agggacacat gattatgcgt cgtattgacc      3600
     caagcaaatt agagttagaa gaacgcttag ttacggttaa ccgcgtagcg aaagttgtta      3660
     aaggtggtcg tcgtttccgc ttcgcagctc tagtcgttgt cggtgacaaa aacggacacg      3720
     taggattcgg tactggtaaa gcacaagaag taccagaagc gattcgcaaa gctgttgaag      3780
     atgcgaaaaa gaatttgatt gaagtaccaa tggttggaac tacaattcca cacgaaatca      3840
     tcggacgttt cggtgcaggt aacatcttgt taaaacctgc ttctgaaggt actggagtta      3900
     tcgctggagg ccctgtacgt gcggtacttg agctagctgg tgtagctgat atcctttcta      3960
     agtctttagg ttctaacaca ccgatcaaca tgattcgtgc aacacttcaa ggtttaagtg      4020
     aacttaaacg tgctgaagac gttgcgaagc ttcgtggaaa atctgtagaa gaactgttag      4080
     gataaggagg gaacattaat ggctaaatta gaaattaccc tcaaacgaag tgtaatcggt      4140
     cgcccggaag accaacgcgt tactgtaaga acacttggtt taaagaaaac aaaccaaact      4200
     gttgttcatg aagacaacgc tgcgatccgt ggtatgatta ataaagtatc tcatttagtt      4260
     tctgttaaag aacaataaaa atatttgatc ggataaggag gtgtcctaat gaaacttcat      4320
     gaattaaaac cttcagaagg ttcacgcaaa acgcgtaatc gcgtaggtcg tggtattggt      4380
     tctggcaacg gtaaaacagc tggtaaaggt cacaaaggtc aaaacgctcg ttctggcggc      4440
     ggtgtacgcc ctggattcga ggggggacaa atgcctttat tccaacgtct tcctaaacgt      4500
     ggtttcacta acatcaaccg caaggaatac gctgtagtca acctagacaa attgaacggt      4560
     tttgcagaag gaacggaagt cactcctgaa cttcttctag agactggtgt tattagcaaa      4620
     cttaatgcag gagtaaagat tcttggcaac ggtaaattag agaaaaaatt aactgtaaaa      4680
     gccaataaat tctctgcttc tgcgaaagaa gctgttgaag ctgctggcgg tacagctgag      4740
     gtgatctaac ttgtttaaaa caatctccaa ctttatgcgt gtgagtgata tcaggaataa      4800
     aatcatattc actttactca tgcttatcgt ctttcgcata ggtgcgttta ttcctgtgcc      4860
     ttacgttaac gctgaagcgt tacaggcaca gtctcaaatg ggtgtttttg atctccttaa      4920
     tacatttggc ggcggtgcgc tttaccaatt ttccattttc gcaatgggaa ttactcctta      4980
     tatcacggct tcgatcatca ttcagctgct tcagatggat gtggtaccga agtttaccga      5040
     gtggtctaag caaggtgaag ttggccgccg taaattagct cagttcacaa ggtactttac      5100
     gattgtgctt ggtttcatcc aagcgttagg tatgtcatat ggattcaaca atctggcaaa      5160
     cggtatgctg atcgaaaaat ccggtgtatc gacatatctt atcattgctt tagtgctcac      5220
     tggcggaact gcctttttaa tgtggcttgg ggaacaaatt acttctcatg gagtaggcaa      5280
     cggaatatcg atcattatct tcgcggggat tgtgtctagt attccaaaaa caattgggca      5340
     aatatatgag actcaatttg tcggcagcaa cgatcagttg tttattcata ttgtgaaagt      5400
     cgcacttctt gtgattgcga ttttagcagt tattgttgga gttattttca ttcagcaagc      5460
     cgtacggaaa attgcgattc aatatgctaa aggcacaggt cgttcacctg ctggcggagg      5520
     tcagtctaca caccttccat tgaaagtgaa tcctgcaggg gttattccgg taatctttgc      5580
     ggttgcgttt ttgataacgc cgcggacgat cgcgtcattc tttggaacaa acgatgtgac      5640
     aaagtggatt caaaacaact ttgataatac gcatccggtg ggtatggcga tatatgttgc      5700
     gttgattatt gcctttacgt acttttatgc ttttgtacag gtaaaccctg aacaaatggc      5760
     tgataacctt aaaaaacagg gtggctatat cccgggggtt cgtccaggga aaatgactca      5820
     agatagaatt acgagcattt tgtatcgact tacgtttgtg ggttctatat tcttagccgt      5880
     gatttccatt cttcctatct ttttcattca attcgctgga ttgcctcaaa gtgcacaaat      5940
     tggcggaaca tctttgttaa ttgttgtcgg ggtagccttg gagacaatga aacaactaga      6000
     aagccagttg gtgaaacgaa actaccgtgg atttatgaaa aactagagga aatggattta      6060
     tccattccct cttaataaag agaggacggg ggaaatccga atgaacttag tcttaatggg      6120
     gcttcctggt gccggtaaag gcacacaggg cgaacgaatt gttgaggatt atgggattcc      6180
     tcatatctca acaggagata tgttccgtgc tgctatgaaa gaagaaacac cactcggact      6240
     cgaagcaaaa tcttatattg ataagggaga gctcgtacct gacgaagtca caatcggaat      6300
     tgtaaaagag agacttggca aagatgattg tgaaagaggt tttcttctgg acggatttcc      6360
     gcgaacagtc gctcaagccg aagctcttga agaaattctt gaggaatacg gcaagccgat      6420
     tgattatgtc attaacattg aagtcgacaa agatgttctg atggaacgtc tgactggacg      6480
     cagaatttgc agtgtttgcg gcacaaccta tcatttagtc tttaatccgc cgaaaacgcc      6540
     gggtatttgt gataaagacg gaggcgaact ctatcaacgg gcagatgata atgaggaaac      6600
     agtctctaaa cggcttgagg taaacatgaa gcaaactcag cctttactcg atttctattc      6660
     agagaaaggt tatcttgcaa acgtgaatgg ccagcaggac attcaagacg tttatgcaga      6720
     tgtgaaggat cttcttggag gattaaaaaa atgattatct gtaaaacccc acgtgaactt      6780
     ggtatcatgc gggaagcagg gcgaatcgtg gctttaactc atgaagagtt aaaaaagcac      6840
     attaaaccag gaatctcgac aaaagaattg gatcaaattg ccgaacgttt tattaagaag      6900
     cagggtgcaa tcccatcttt taaggggtat aatgggtttc gcgggagcat ttgcgtatca      6960
     gttaatgaag aactcgttca cggcatacct ggcagcaggg tgctgaagga cggtgacatc      7020
     atcagtattg atatcggtgc taaattaaat ggttatcatg gtgactctgc atggacatat      7080
     ccggtaggaa acatcagcga tgatgacaaa aaacttctgg aagtgacaga ggagtcttta      7140
     tataaaggct tgcaggaagc aaaaccaggt gaacgtttgt cgaatatttc ccacgcaata      7200
     caaacgtatg tcgaaaatga gcagttttca gttgttaggg agtatgtcgg acatggtgtt      7260
     ggtcaagact tgcatgagga cccgcaaatt cctcattacg gtccgcccaa caaaggacca      7320
     cggcttaaac ctggcatggt tctcgctatt gaacctatgg tgaacgctgg cagccgctac      7380
     gtgaaaacat tggctgataa ctggacggtt gtaacggtag atgggaaaaa gtgtgctcat      7440
     tttgaacata cgattgcgat tacggaaacg ggttttgata tactgacgag agtctagatg      7500
     atgaaaataa ttccgaagac agatgttttt caagcttgat agggcagaaa gcttgggtga      7560
     acattggcaa gaccgaattc atcttgcttc ttgtcgttgg aattttaacc atcatcaatg      7620
     tactaacagc agacggagaa aagcgtacat ttcattctcc taagaaaaag aatatcaatc      7680
     atttaaccct ttatgattgc gtatctccgg aagttcagaa cagtataaac gaaacagggc      7740
     gtgtgacaaa cttcttttga aatttgtcag aaagcaagtt actgatttga agaagggaga      7800
     acacttgaat ggcgaaagac gatgtaattg aagtggaagg tactatagtc gaaacactgc      7860
     caaacgcgat gttcaaagtt gaacttgaaa atggccacac tgttttggct catgtatctg      7920
     gtaaaatccg catgcacttc attcgcattt tacctggaga caaagttacg gtagaattat      7980
     ctccatatga cttaactcgt ggcaggatta cgtaccgtta caaataaagc actccggaaa      8040
     ctgaaggagg ttggaaacac atgaaagtga gaccatcagt taaaccaatc tgcgaaaaat      8100
     gtaaagttat tcgcagaaaa ggaaaagtaa tggtgatctg tgaaaatcca aagcataaac      8160
     aaaaacaagg ataatttata aggaggtgcc cagagaatgg ctcgtattgc tggtgtagat      8220
     atcccacgtg acaaacgtgt tgttatttct ttaacataca tcttcggaat tggccgcaca      8280
     acggctcagc aagttttaaa agaagctgga gtttcagaag atactcgtgt gcgcgatctt      8340
     actgaagaag aacttggtaa aatccgtgat attattgaca aactgaaagt agaaggtgac      8400
     cttcgccgtg aagtttctct taatatcaaa cgtctgatcg aaatcggaag ctaccgcgga      8460
     atccgtcatc gcagaggatt acctgttcgc ggacaaaact ctaaaaacaa cgcgcgtact      8520
     cgtaaaggtc cgcgtcgtac tgtagctaac aagaaaaaat aagtaaggga ggttcttaaa      8580
     caatggctgc tgctcgtaaa tctaacacgc gtaaacgtcg cgtgaaaaag aatattgagt      8640
     ctggaattgc tcatattcgt tcaactttca ataacacgat cgttacgatc actgacactc      8700
     atggtaatgc tatttcttgg tctagtgccg gagctttagg attcagaggt tctcgtaaat      8760
     ctactccttt tgctgcgcaa atggctgcag aaacagctgc taaaggttca atcgaacatg      8820
     gtcttaaaac tctagaggtt actgttaaag gacctggttc aggccgtgaa gctgcaatcc      8880
     gtgcacttca agctgctgga ctagaagtca ctgctatcag agacgtaact cctgttcctc      8940
     ataacggatg ccgtccacca aaacgtcgcc gcgtgtaatt tgtttgtata gattttgtgt      9000
     ccctgtcaat aatgggttat gatacagtta tttatgaaac gaatgcaccg actcgttgcc      9060
     tgagcacata cgggactaaa caatggggaa tttcggatgg aatctcatat gattctattc      9120
     gaggtttcga cgttttgaag gagggtttta agtaatgatc gagattgaaa aaccaaaaat      9180
     cgaaacggtt gaaatcagcg acgatgccaa atttggtaag tttgtcgtag agccacttga      9240
     gcgtggatat ggtacaactc tgggtaactc cttacgtcgt atcctcttat cctcactccc      9300
     tggtgccgct gtaacatcaa tccagataga tggtgtactg cacgaattct cgacaattga      9360
     aggcgttgtg gaagatgtta caacgattat cttacacatt aaaaagcttg cattgaaaat      9420
     ctactctgat gaagagaaga cgctagaaat tgatgtacag ggtgaaggaa ctgtaacggc      9480
     agctgatatt acacacgata gtgatgtaga gatcttaaat cctgatcttc atatcgcgac      9540
     tcttggtgag aatgcgagtt tccgagttcg ccttactgct caaagaggac gtgggtatac      9600
     gcctgctgac gcaaacaaga gagacgatca gccaatcggc gtgattccga tcgattctat      9660
     ctatacgcca gtttctcgtg tatcttatca ggtagagaac actcgtgtag gccaagttgc      9720
     aaactatgat aaacttacac ttgatgtttg gactgatgga agcactggac cgaaagaagc      9780
     aattgcgctt ggttcaaaga ttttaactga acaccttaat atattcgttg gtttaactga      9840
     cgaagctcaa catgctgaaa tcatggttga aaaagaagaa gatcaaaaag agaaagttct      9900
     tgaaatgaca attgaagaat tggatctttc tgttcgttct tacaactgct taaagcgtgc      9960
     gggtattaac acggttcaag agcttgcgaa caagacggaa gaagatatga tgaaagttcg     10020
     aaatctagga cgcaaatcac ttgaagaagt gaaagcgaaa ctagaagaac ttggactcgg     10080
     acttcgcaaa gacgattgac tagtttccct tgtgaactag gattttcgtg tgtttattat     10140
     tcagaaacag cattccaata aaggagggga catcacatgt catacagaaa actaggacgt     10200
     acgagtgcac agcgtaaagc tatgcttcgt gatcttacaa ctgatttgat catcaacgaa     10260
     agaatcgaaa caactgaaac acgtgcgaaa gaacttcgct ctgtagttga aaaaatgatc     10320
     acgcttggca aacgcggtga tcttcacgct cgccgtcaag ctgctgcata catccgcaac     10380
     gaggttgcaa acgaagaaaa taatcaagat gcacttcaaa aattattctc tgacattgca     10440
     actcgttacg aggagcgcca aggtggatac acacgtatta tgaagcttgg tcctcgccgt     10500
     ggtgacggag caccaatggc aattatcgaa ttggtttaat cacatatttt tgtgtatcta     10560
     aagaagggcg ggacagtttc taactggatc tatgcccttt ttttagatac tgcaactttt     10620
     aatagagaga aaagcagagc attagctgag aggaggccgg ttttccatga atcaaaatca     10680
     gttgatatcg gtagaggata tcgtatttcg atatcggaag gacgcagaaa gacgagcact     10740
     agacggcgtc tccctgcag                                                  10759
//

If you have problems or comments...

PBIL Back to PBIL home page