(data stored in ACNUC16935 zone)

EMBL: M11100

ID   M11100; SV 1; linear; mRNA; STD; VRT; 622 BP.
XX
AC   M11100;
XX
DT   13-JAN-1992 (Rel. 30, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 5)
XX
DE   Chicken ubiquitin mRNA, from heat shocked embryo cells.
XX
KW   heat shock protein; stress protein; ubiquitin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-622
RX   PUBMED; 2987683.
RA   Bond U., Schlesinger M.J.;
RT   "Ubiquitin is a heat shock protein in chicken embryo fibroblasts";
RL   Mol. Cell. Biol. 5(5):949-956(1985).
XX
RN   [2]
RP   1-622
RA   Bond U., Schlesinger M.J.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 384f2398ddd369385d4fa36342800eff.
XX
CC   Original source text: Chicken embryo fibroblast cells heat shocked
CC   for 1 hr at 45 degrees C, cDNA to mRNA, clone 7.
CC   [2]  revises [1].
CC   Draft entry and sequence in computer readable form for [1] kindly
CC   provided by U.Bond, 12-MAR-1986.
CC   The revisions to [1] were too numerous to be listed individually in
CC   the FEATURES table.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..622
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   mRNA            <1..597
FT                   /product="ubiquitin mRNA"
FT   CDS_pept        <1..474
FT                   /codon_start=1
FT                   /note="ubiquitin polyprotein (heat shock related)"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q91021"
FT                   /protein_id="AAA49129.1"
FT                   /translation="LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
FT                   RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
FT                   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY"
FT   mat_peptide     <1..12
FT                   /product="ubiquitin A"
FT   mat_peptide     13..240
FT                   /product="ubiquitin B"
FT   mat_peptide     241..471
FT                   /product="ubiquitin C"
XX
SQ   Sequence 622 BP; 170 A; 147 C; 157 G; 148 T; 0 other;
     ttgagaggtg ggatgcagat cttcgtgaaa acgttgactg gcaagaccat cacccttgag        60
     gttgagccca gtgacaccat tgaaaatgtg aaggccaaga tccaagacaa agaaggcatc       120
     cctcctgacc aacaaaggtt gatctttgct ggcaagcagc tggaagatgg gcgcaccctg       180
     tctgactaca acatccagaa agagtccacc ctgcatctgg tgctgcgcct gaggggaggc       240
     atgcagatct ttgtgaagac cctgactggc aagaccatca ccctcgaggt tgagcccagt       300
     gacaccattg agaacgtgaa ggccaagatc caagacaaag aaggcattcc tcctgaccag       360
     cagaggctga tttttgctgg caagcagctg gaagatggtc gcaccctgtc tgactacaac       420
     atccaaaagg agtccaccct gcacttggtg ctgcgcctca ggggtggcta ttagttgttg       480
     tcagcagtct tgtcaagcaa gatgcacagc acattgtgtg ttgcactgta gtctttctaa       540
     tgtcttaaat taaatgcaag ctttaagtaa ctgctgatct gtatgttgaa atgctaataa       600
     agtttttctg ttgcacatta ca                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page