(data stored in ACNUC8465 zone)

EMBL: M12174

ID   M12174; SV 1; linear; mRNA; STD; HUM; 539 BP.
XX
AC   M12174;
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Human ras-related rho mRNA (clone 6), partial cds.
XX
KW   c-myc proto-oncogene; ras oncogene; rho gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-539
RA   Madaule P.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-539
RX   DOI; 10.1016/0092-8674(85)90058-3.
RX   PUBMED; 3888408.
RA   Madaule P., Axel R.;
RT   "A novel ras-related gene family";
RL   Cell 41(1):31-40(1985).
XX
DR   MD5; 132d11dd3fa60bc25fefb630d604a5be.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
DR   EuropePMC; PMC1231143; 16113252.
DR   EuropePMC; PMC1346919; 16414985.
DR   EuropePMC; PMC1534055; 16594992.
DR   EuropePMC; PMC344183; 14749371.
XX
CC   [2] has found and sequenced a family of highly evilutionarily
CC   conserved genes with homology to the ras family (H-ras, K-ras,
CC   N-ras) of oncogenes.  [2] named this family rho (for ras homology).
CC   In humans at least three distinct rho genes are present. A draft
CC   entry and computer-readable copy of this sequence were kindly
CC   provided by P.Madaule (07-OCT-1985).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..539
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..508
FT                   /codon_start=2
FT                   /note="rho protein"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000194148.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="AAA36565.1"
FT                   /translation="EFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLS
FT                   YPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELA
FT                   RMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCIN
FT                   CCKVL"
XX
SQ   Sequence 539 BP; 105 A; 180 C; 172 G; 82 T; 0 other;
     cgagttcccc gaggtgtacg tgcccaccgt cttcgagaac tatgtggccg acattgaggt        60
     ggacggcaag caggtggagc tggcgctgtg ggacacggcg ggccaggagg actacgaccg       120
     cctgcggccg ctctcctacc cggacaccga cgtcattctc atgtgcttct cggtggacag       180
     cccggactcg ctggagaaca tccccgagaa gtgggtcccc gaggtgaagc acttctgtcc       240
     caatgtgccc atcatcctgg tggccaacaa aaaagacctg cgcagcgacg agcatgtccg       300
     cacagagctg gcccgcatga agcaggaacc cgtgcgcacg gatgacggcc gcgccatggc       360
     cgtgcgcatc caagcctacg actacctcga gtgctctgcc aagaccaagg aaggcgtgcg       420
     cgaggtcttc gagacggcca cgcgcgccgc gctgcagaag cgctacggct cccagaacgg       480
     ctgcatcaac tgctgcaagg tgctatgagg gccgcgccgt cgcgcctgcc cctgccggc        539
//

If you have problems or comments...

PBIL Back to PBIL home page