(data stored in SCRATCH zone)

EMBL: M12276

ID   M12276; SV 1; linear; genomic DNA; STD; PRO; 979 BP.
XX
AC   M12276;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   B.subtilis gdh gene encoding glucose dehydrogenase, complete cds.
XX
KW   glucose dehydrogenase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-979
RX   PUBMED; 3082854.
RA   Lampel K.A., Uratani B., Chaudhry G.R., Ramaley R.F., Rudikoff S.;
RT   "Characterization of the developmentally regulated Bacillus subtilis
RT   glucose dehydrogenase gene";
RL   J. Bacteriol. 166(1):238-243(1986).
XX
DR   MD5; d79e2289a7073d713e0291c3c90e7c7c.
DR   GOA; P40420.
DR   InterPro; IPR010651; Sugar_transport.
DR   UniProtKB/Swiss-Prot; P40420; GLCU_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..979
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      59..65
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71..853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="glucose dehydrogenase (EC 1.1.1.47)"
FT                   /db_xref="GOA:P12310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12310"
FT                   /protein_id="AAA22463.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHAFPWPLFVHYAASKGG
FT                   IKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEE
FT                   IAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
XX
SQ   Sequence 979 BP; 303 A; 204 C; 248 G; 224 T; 0 other;
     ctgattattg ccgccgccgt attcttagga atcgccaaaa caaattcata acaaatggag        60
     gaggatgtat atgtatccgg atttaaaagg aaaagtcgtc gctattacag gagctgcttc       120
     agggctcgga aaggcgatgg ccattcgctt cggcaaggag caggcaaaag tggttatcaa       180
     ctattatagt aataaacaag atccgaacga ggtaaaagaa gaggtcatca aggcgggcgg       240
     tgaagctgtt gtcgtccaag gagatgtcac gaaagaggaa gatgtaaaaa atatcgtgca       300
     aacggcaatt aaggagttcg gcacactcga tattatgatt aataatgccg gtcttgaaaa       360
     tcctgtgcca tctcacgaaa tgccgctcaa ggattgggat aaagtcatcg gcacgaactt       420
     aacgggtgcc tttttaggaa gccgtgaagc gattaaatat ttcgtagaaa acgatatcaa       480
     gggaaatgtc attaacatgt ccagtgtgca cgcgtttcct tggccgttat ttgtccacta       540
     tgcggcaagt aaaggcggga taaagctgat gacagaaaca ttagcgttgg aatacgcgcc       600
     gaagggcatt cgcgtcaata atattgggcc aggtgcgatc aacacgccaa tcaatgctga       660
     aaaattcgct gaccctaaac agaaagctga tgtagaaagc atgattccaa tgggatatat       720
     cggcgaaccg gaggagatcg ccgcagtagc agcctggctt gcttcgaagg aagccagcta       780
     cgtcacaggc atcacgttat tcgcggacgg cggtatgaca caatatcctt cattccaggc       840
     aggccgcggt taaacataaa aagcgaccca gacatgacat ctggatcgct ttctttatta       900
     ggcacgcttt ttctttacaa gtgctgctac agataaaata atggcagccg cagacagcac       960
     catcgctgta atgtctaga                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page