(data stored in ACNUC16935 zone)

EMBL: M13755

ID   M13755; SV 1; linear; mRNA; STD; HUM; 634 BP.
XX
AC   M13755;
XX
DT   07-JUN-1987 (Rel. 12, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Human interferon-induced 17-kDa/15-kDa protein mRNA, complete cds.
XX
KW   interferon; interferon-inducible protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-634,1-634
RA   Blomstrom D.C.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-634
RX   PUBMED; 3087979.
RA   Blomstrom D.C., Fahey D., Kutny R., Korant B.D., Knight E.Jr.;
RT   "Molecular characterization of the interferon-induced 15-kDa protein.
RT   Molecular cloning and nucleotide and amino acid sequence";
RL   J Biol Chem 261(19):8811-8816(1986).
XX
DR   MD5; 63255f942ee0f1d2875af1781d37d090.
DR   Ensembl-Gn; ENSG00000187608; homo_sapiens.
DR   Ensembl-Tr; ENST00000379389; homo_sapiens.
DR   EuropePMC; PMC116128; 11711622.
DR   EuropePMC; PMC122433; 11880635.
DR   EuropePMC; PMC129784; 12368479.
DR   EuropePMC; PMC1483835; 16709257.
DR   EuropePMC; PMC2193846; 12642603.
DR   EuropePMC; PMC24397; 9826724.
DR   EuropePMC; PMC28094; 9861020.
DR   EuropePMC; PMC310835; 10568748.
DR   EuropePMC; PMC316542; 10783169.
DR   EuropePMC; PMC523249; 15479790.
DR   EuropePMC; PMC523295; 15479800.
XX
CC   [1]  revises [2].
CC   [1]  revises [1].
CC   Draft entry and computer-readable sequence for [2],[1], kindly
CC   provided by D.C.Blomstrom, 15-DEC-1986, and for [1] 28-MAR-1989.
CC   The 15-kDa protein is formed by a post-translational modification
CC   of the 17-kDa protein in which eight amino acids are removed from
CC   the COOH terminus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..634
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>634
FT                   /note="17-kDa/15-kDa mRNA"
FT   mat_peptide     76..546
FT                   /note="15-kDa protein"
FT   CDS_pept        76..573
FT                   /codon_start=1
FT                   /note="17-kDa protein"
FT                   /db_xref="GOA:P05161"
FT                   /db_xref="H-InvDB:HIT000194245.14"
FT                   /db_xref="HGNC:HGNC:4053"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1Z2M"
FT                   /db_xref="PDB:2HJ8"
FT                   /db_xref="PDB:3PHX"
FT                   /db_xref="PDB:3PSE"
FT                   /db_xref="PDB:3R66"
FT                   /db_xref="PDB:3RT3"
FT                   /db_xref="PDB:3SDL"
FT                   /db_xref="PDB:5TL6"
FT                   /db_xref="PDB:5W8T"
FT                   /db_xref="PDB:5W8U"
FT                   /db_xref="PDB:6BI8"
FT                   /db_xref="PDB:6FFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05161"
FT                   /protein_id="AAA36038.1"
FT                   /translation="MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRL
FT                   AVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTV
FT                   AHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGG
FT                   RS"
XX
SQ   Sequence 634 BP; 130 A; 187 C; 219 G; 98 T; 0 other;
     cggctgagag gcagcgaact catctttgcc agtacaggag cttgtgccgt ggcccacagc        60
     ccacagccca cagccatggg ctgggacctg acggtgaaga tgctggcggg caacgaattc       120
     caggtgtccc tgagcagctc catgtcggtg tcagagctga aggcgcagat cacccagaag       180
     attggcgtgc acgccttcca gcagcgtctg gctgtccacc cgagcggtgt ggcgctgcag       240
     gacagggtcc cccttgccag ccagggcctg ggccctggca gcacggtcct gctggtggtg       300
     gacaaatgcg acgaacctct gagcatcctg gtgaggaata acaagggccg cagcagcacc       360
     tacgaggtcc ggctgacgca gaccgtggcc cacctgaagc agcaagtgag cgggctggag       420
     ggtgtgcagg acgacctgtt ctggctgacc ttcgagggga agcccctgga ggaccagctc       480
     ccgctggggg agtacggcct caagcccctg agcaccgtgt tcatgaatct gcgcctgcgg       540
     ggaggcggca cagagcctgg cgggcggagc taagggcctc caccagcatc cgagcaggat       600
     caagggccgg aaataaaggc tgttgtaaga gaat                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page