(data stored in ACNUC8465 zone)

EMBL: M14097

ID   M14097; SV 1; linear; genomic DNA; STD; FUN; 2100 BP.
XX
AC   M14097;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Yeast (S.cerevisiae) regulatory gene STE7, complete cds.
XX
KW   protein kinase; regulatory protein; STE7 protein.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-2100
RX   DOI; 10.1073/pnas.83.19.7371.
RX   PUBMED; 3532111.
RA   Teague M.A., Chaleff D.T., Errede B.;
RT   "Nucleotide sequence of the yeast regulatory gene STE7 predicts a protein
RT   homologous to protein kinases";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(19):7371-7375(1986).
XX
DR   MD5; 5e68ddcff1496ce7a724ff84acc6d9df.
XX
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by B.Errede, 08-DEC-1986.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2100
FT                   /organism="Saccharomyces cerevisiae"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4932"
FT   mRNA            311..2037
FT                   /gene="STE7"
FT                   /note="STE7 mRNA (alt.; 3' end +/- 6 bp)"
FT   mRNA            312..2037
FT                   /gene="STE7"
FT                   /note="STE7 mRNA (alt.; 3' end +/- 6 bp)"
FT   mRNA            314..2037
FT                   /gene="STE7"
FT                   /note="STE7 mRNA (alt.; 3' end +/- 6 bp)"
FT   mRNA            318..2037
FT                   /gene="STE7"
FT                   /note="STE7 mRNA (alt.; 3' end +/- 6 bp)"
FT   mRNA            319..2037
FT                   /gene="STE7"
FT                   /note="STE7 mRNA (alt.; 3' end +/- 6 bp)"
FT   CDS_pept        360..1907
FT                   /codon_start=1
FT                   /gene="STE7"
FT                   /note="STE7 protein"
FT                   /db_xref="GOA:P06784"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="SGD:S000002318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06784"
FT                   /protein_id="AAA35118.1"
FT                   /translation="MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGH
FT                   VMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQ
FT                   SPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLE
FT                   ESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTI
FT                   PVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDK
FT                   ILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLIN
FT                   SKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVT
FT                   GEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIH
FT                   ELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH"
XX
SQ   Sequence 2100 BP; 710 A; 380 C; 396 G; 613 T; 1 other;
     aagcttgtgg tcttaaaaga atgtggatga aacaaaactg aatccaatga tgagaaataa        60
     atgtacaatc agataataaa cacttttatt gatgattgtc ttttcttgca aaccccaatg       120
     ttacaatcgc ccattagttc taagattgtg ttgtcctttt tcttacgaaa tttttttccc       180
     tccctttttt gatcactgtc ctcgttataa gtgattcgtg gggtaacggc gatatcatac       240
     tattattggc ccatctgatg gattagaaga cctacaggtt aatgtgaagc gacactaatg       300
     ataagaaaac tgcatcggat catatctgtt tttgcagcgt ggtatattgg ttgttggtca       360
     tgtttcaacg aaagacttta cagagaagga acttgaaagg gctcaatctt aacctgcacc       420
     cagatgtggg caataatggc caattgcagg aaaagacaga gactcaccag ggacaatctc       480
     gaatagaagg ccacgtgatg tctaacatta atgcaataca gaataatagc aacctgtttt       540
     tgcgaagagg cataaaaaaa aaactgacgt tggatgcgtt tggtgatgac caagctatat       600
     cgaaaccaaa cactgtggta atacagcaac cgcaaaatga acctgtttta gttctgtctt       660
     ctctatcaca atccccgtgt gtatcatcat catcatcttt gtccacgcca tgcattatag       720
     atgcgtacag taataatttc ggattatcgc catcatccac gaattctact ccctctacga       780
     ttcagggatt gtccaatatt gcaacaccag ttgaaaacga acattcgata tcactaccac       840
     ctttggagga aagcctatcg ccagccgcag cagatctgaa agatacgttg tcgggaactt       900
     caaatggtaa ttatatacaa ctccaggact tggttcagtt ggggaaaatt ggtgctggaa       960
     attctggaac tgtggtgaag gcactacatg ttcctgattc caaaatagtt gccaaaaaaa      1020
     ccattcctgt ggaacagaat aacagtacaa tcatcaacca attagttagg gaattatcta      1080
     tcgtcaaaaa cgttaagccc catgaaaaca ttatcacctt ctatggagct tattataacc      1140
     agcatataaa taatgaaatc ataattttaa tggaatactc tgattgtggt tctttagata      1200
     aaatactgtc cgtttataaa aggtttgttc aaagagggac tgtttcgagt aagaaaacct      1260
     ggttcaacga attaacaata tcaaaaatag cgtatggcgt actaaatggc ttggatcatt      1320
     tgtaccgaca atataagatc attcatcgtg atatcaagcc ttccaatgtt ctgattaata      1380
     gtaaggggca gattaagtta tgtgattttg gagtttccaa aaaactaata aattctatcg      1440
     ctgatacatt tgttggaacg tccacttata tgtcaccaga gaggatacaa ggaaacgttt      1500
     attctatcaa aggggacgtt tggtcattgg gcttaatgat catcgagctg gtaactggag      1560
     agtttcccct aggtgggcat aacgatacac ctgatggcat attggatttg ctgcaacgta      1620
     ttgtcaacga gccttcacca agattaccca aagaccgtat ctattccaag gaaatgacag      1680
     attttgtcaa taggtgttgt attaagaatg aaagggaaag gtcatcgatt catgaattgc      1740
     tacatcatga tcttataatg aaatacgtat caccgtctaa agatgataaa tttagacatt      1800
     ggtgtagaaa aataaaatct aaaataaagg aagacaagag aattaaaaga gaagccttgg      1860
     accgtgccaa gttagaaaag aaacaatcgg aaagatcaac ccattgaatg catgcgataa      1920
     cattagttag gaacatattg cacttttttt cacatccctt tctcaaagct atattcanat      1980
     atatatagac tctcctgatt atgtaaatca caaaccaatt ttctaatgta acaatatttt      2040
     taaaaataat catcaaagta gcactttatg tacagaaaat ttcacgattg agagaagctt      2100
//

If you have problems or comments...

PBIL Back to PBIL home page