(data stored in SCRATCH zone)

EMBL: M14112

ID   M14112; SV 1; linear; genomic DNA; STD; PRO; 1037 BP.
XX
AC   M14112;
XX
DT   07-JUN-1987 (Rel. 12, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   B.subtilis sin gene causing inhibition of both sporulation and exoprotease
DE   production, complete cds.
XX
KW   exoprotease; sporulation protein.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1037
RX   PUBMED; 3096962.
RA   Gaur N.K., Dubnau E., Smith I.;
RT   "Characterization of a cloned Bacillus subtilis gene that inhibits
RT   sporulation in multiple copies";
RL   J. Bacteriol. 168(2):860-869(1986).
XX
DR   MD5; d738c7581ea5a5b147c01ef6591af341.
DR   GOA; P23308.
DR   GOA; P54507.
DR   InterPro; IPR022121; Peptidase_M73_camelysin.
DR   InterPro; IPR023833; Signal_peptide_camelysin.
DR   InterPro; IPR036281; SinR/SinI_dimer_dom_sf.
DR   PDB; 1B0N; X-ray.
DR   PDB; 5OF1; X-ray.
DR   PDB; 5OF2; X-ray.
DR   PDB; 5TMX; NMR.
DR   UniProtKB/Swiss-Prot; P23308; SINI_BACSU.
DR   UniProtKB/Swiss-Prot; P54507; TASA_BACSU.
XX
CC   Computer-readable sequence for [1] kindly provided by I.Smith,
CC   11-FEB-1987.
CC   ORF 2 and possibly ORF 1 function as negative regulatory elements,
CC   causing inhibition of sporulation and exoprotease production.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1037
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        490..825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="Sin regulatory protein (ttg start codon)"
FT                   /db_xref="GOA:P06533"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010981"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036281"
FT                   /db_xref="PDB:1B0N"
FT                   /db_xref="PDB:2YAL"
FT                   /db_xref="PDB:3QQ6"
FT                   /db_xref="PDB:3ZKC"
FT                   /db_xref="PDB:5TN0"
FT                   /db_xref="PDB:5TN2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06533"
FT                   /protein_id="AAA22757.1"
FT                   /translation="MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQ
FT                   FLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKW
FT                   RKSQKEE"
XX
SQ   Sequence 1037 BP; 349 A; 185 C; 206 G; 297 T; 0 other;
     tctagaaaaa caggcgctga aaaccttgta tcaaccaaag atatcagttg aaattgaaaa        60
     tggcggattg ttttatctgc aaaataatat ttcaagctaa cttttttacc attcgacatc       120
     attctcgttt tttttgagaa aatacgatta taataaaggt atattggaaa aaaattctgg       180
     tgatttaatg gcaaatgact tccagagact aatgaagcat acaataagtc atggccggac       240
     tggctgaaat acataaacaa gtattttagg aggagaaact gcatgaagaa tgcaaaacaa       300
     gagcactttg aattggatca agaatgggtt gaattaatgg tggaagccaa agaggcaaat       360
     atcagcccgg aagaaatacg aaaatattta cttttaaaca aaaagtctgc tcatcctggt       420
     ccggcagcca gaagtcatac cgtaaatcct ttctgaatgt gctataatat cacaaggaag       480
     gtgatgacat tgattggcca gcgtattaaa caataccgta aagaaaaagg ctactcacta       540
     tcagaactag ctgaaaaagc tggggtagcg aagtcttatt taagctcaat agaacgaaat       600
     ctacaaacga acccctccat tcaatttctc gaaaaagtct ccgctgttct ggacgtctcg       660
     gttcatactt tgctcgatga gaaacatgaa accgaatacg atggtcaatt agatagtgaa       720
     tgggagaaat tggttcgcga tgcgatgaca tccggggtat cgaaaaaaca atttcgtgaa       780
     tttttagatt atcaaaaatg gagaaaatcc caaaaagagg agtagtgcct gagcagaggc       840
     actaactcct cttttgtcaa taaccatcga gacggcccag tatatgaata ctgggccgtc       900
     tctttttttt gctgttatta atttttatcc tcgctatgcg ctttttcatt ttctttcacg       960
     taaccatctt tatcagtatg gtcctttttg attgtcaagc cgttccactg tgtagcttcg      1020
     aatgagaatt gaagctt                                                     1037
//

If you have problems or comments...

PBIL Back to PBIL home page